F388991

General Info

Members Datasets Scaffolds Average Seq Length
289 171 578 114

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100012795|Ga0070683_1000127955
Length 122
Sequence MPARLRPASYDVVRDALAADPRSPEQTRLLVKHFLAVLAERAPGASVEVRVPPYAAVQAIAGVRHTRGTPPAVVELDADTWIALATGSLSWADAGSDGRIQASGERADLSPLLPLTPREEDA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
99 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
100 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
104 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
120 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
121 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
122 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
167 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.38
Nodule 0
Rhizoplane 17.3
Rhizosphere 80.28
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100012795 3300005329 Bacteria 7300
2 JGI24735J21928_10102784 3300002067 Bacteria 821
3 rootH1_10349467 3300003323 Bacteria 1336
4 Ga0070658_10136496 3300005327 Bacteria 2047
5 Ga0070658_10195811 3300005327 Bacteria 1704
6 Ga0070658_10427215 3300005327 Bacteria 1140
7 Ga0070683_100003763 3300005329 Bacteria 12383
8 Ga0070683_100048110 3300005329 Bacteria 3942
9 Ga0070690_101551892 3300005330 Bacteria 536
10 Ga0070670_101786069 3300005331 Bacteria 566
11 Ga0070677_10297157 3300005333 Bacteria 819
12 Ga0068869_101029635 3300005334 Bacteria 718
13 Ga0070680_100806071 3300005336 Bacteria 809
14 Ga0070682_100435640 3300005337 Bacteria 1000
15 Ga0070682_101201026 3300005337 Bacteria 640
16 Ga0070660_100015289 3300005339 Bacteria 5537
17 Ga0070660_100073460 3300005339 Bacteria 2674
18 Ga0070689_101313021 3300005340 Bacteria 652
19 Ga0070692_10834201 3300005345 Bacteria 632
20 Ga0070675_101731367 3300005354 Bacteria 577
21 Ga0070659_100143175 3300005366 Bacteria 1947
22 Ga0070705_100380522 3300005440 Bacteria 1039
23 Ga0070700_100994003 3300005441 Bacteria 689
24 Ga0070694_100613916 3300005444 Bacteria 877
25 Ga0070678_101924792 3300005456 Bacteria 559
26 Ga0070662_100601461 3300005457 Bacteria 925
27 Ga0070681_10604363 3300005458 Bacteria 1011
28 Ga0070685_10040552 3300005466 Bacteria 2650
29 Ga0070679_100003617 3300005530 Bacteria 14128
30 Ga0070679_101576341 3300005530 Bacteria 604
31 Ga0070684_100146563 3300005535 Bacteria 2137
32 Ga0068853_100697967 3300005539 Bacteria 968
33 Ga0070686_100091143 3300005544 Bacteria 2039
34 Ga0070686_100808691 3300005544 Bacteria 756
35 Ga0070665_100001439 3300005548 Bacteria 27904
36 Ga0068855_100594655 3300005563 Bacteria 1194
37 Ga0070664_101157772 3300005564 Bacteria 729
38 Ga0068857_100404239 3300005577 Bacteria 1271
39 Ga0068856_100098577 3300005614 Bacteria 2913
40 Ga0068856_100207051 3300005614 Bacteria 1976
41 Ga0068856_100546775 3300005614 Bacteria 1179
42 Ga0070702_100771826 3300005615 Bacteria 740
43 Ga0068852_100143790 3300005616 Bacteria 2210
44 Ga0068859_102481195 3300005617 Bacteria 571
45 Ga0068864_100028454 3300005618 Bacteria 4724
46 Ga0068866_10838231 3300005718 Bacteria 642
47 Ga0068861_100433967 3300005719 Bacteria 1173
48 Ga0068861_100519968 3300005719 Bacteria 1079
49 Ga0068851_10177161 3300005834 Bacteria 1179
50 Ga0068863_100361106 3300005841 Bacteria 1416
51 Ga0068858_100314076 3300005842 Bacteria 1497
52 Ga0068858_101240151 3300005842 Bacteria 733
53 Ga0068860_100029762 3300005843 Bacteria 5253
54 Ga0068862_101735134 3300005844 Bacteria 633
55 Ga0075365_10596572 3300006038 Bacteria 781
56 Ga0075363_100763461 3300006048 Bacteria 586
57 Ga0068865_100420346 3300006881 Bacteria 1099
58 Ga0068865_100774982 3300006881 Bacteria 825
59 Ga0068865_100779452 3300006881 Bacteria 823
60 Ga0068865_100860218 3300006881 Bacteria 786
61 Ga0097620_102481106 3300006931 Bacteria 571
62 Ga0105245_10041557 3300009098 Bacteria 4098
63 Ga0105245_10370376 3300009098 Bacteria 1424
64 Ga0105243_10285172 3300009148 Bacteria 1489
65 Ga0105243_12143261 3300009148 Bacteria 595
66 Ga0105242_10877390 3300009176 Bacteria 895
67 Ga0105248_11243949 3300009177 Bacteria 842
68 Ga0105239_10042597 3300010375 Bacteria 4974
69 Ga0105239_10847205 3300010375 Bacteria 1048
70 Ga0105239_12680452 3300010375 Bacteria 581
71 Ga0105246_10038431 3300011119 Bacteria 3218
72 Ga0157371_10630441 3300013102 Bacteria 799
73 Ga0157371_10740541 3300013102 Bacteria 738
74 Ga0157369_10044259 3300013105 Bacteria 4847
75 Ga0157369_11233301 3300013105 Bacteria 763
76 Ga0163162_11970302 3300013306 Bacteria 669
77 Ga0157372_10007847 3300013307 Bacteria 11342
78 Ga0157372_10658395 3300013307 Bacteria 1219
79 Ga0157372_11816947 3300013307 Bacteria 701
80 Ga0157372_12675531 3300013307 Bacteria 572
81 Ga0157375_10077481 3300013308 Bacteria 3354
82 Ga0157375_10405638 3300013308 Bacteria 1529
83 Ga0157375_10556883 3300013308 Bacteria 1308
84 Ga0157375_10738095 3300013308 Bacteria 1137
85 Ga0157375_12292899 3300013308 Bacteria 644
86 Ga0163163_10638026 3300014325 Bacteria 1128
87 Ga0163163_11890269 3300014325 Bacteria 657
88 Ga0163163_12513187 3300014325 Bacteria 573
89 Ga0157380_10180961 3300014326 Bacteria 1852
90 Ga0157379_10054280 3300014968 Bacteria 3580
91 Ga0157379_11023680 3300014968 Bacteria 788
92 Ga0157376_10086840 3300014969 Bacteria 2698
93 Ga0157376_11811751 3300014969 Bacteria 647
94 Ga0163161_10015960 3300017792 Bacteria 5241
95 Ga0163161_10587913 3300017792 Bacteria 916
96 Ga0163161_11147332 3300017792 Bacteria 670
97 Ga0207688_10061804 3300025901 Bacteria 2112
98 Ga0207647_10008889 3300025904 Bacteria 7163
99 Ga0207647_10040906 3300025904 Bacteria 2917
100 Ga0207643_11027558 3300025908 Bacteria 533
101 Ga0207707_10619312 3300025912 Bacteria 915
102 Ga0207707_11548747 3300025912 Bacteria 524
103 Ga0207660_10428961 3300025917 Bacteria 1067
104 Ga0207657_10021824 3300025919 Bacteria 6014
105 Ga0207657_10132790 3300025919 Bacteria 2039
106 Ga0207652_10060388 3300025921 Bacteria 3271
107 Ga0207681_10238786 3300025923 Bacteria 1414
108 Ga0207650_10919415 3300025925 Bacteria 743
109 Ga0207659_10384617 3300025926 Bacteria 1171
110 Ga0207659_10772719 3300025926 Bacteria 825
111 Ga0207687_10253717 3300025927 Bacteria 1399
112 Ga0207644_11115886 3300025931 Bacteria 663
113 Ga0207690_10438937 3300025932 Bacteria 1047
114 Ga0207709_10147877 3300025935 Bacteria 1623
115 Ga0207669_10898596 3300025937 Bacteria 740
116 Ga0207669_11064244 3300025937 Bacteria 682
117 Ga0207704_10163632 3300025938 Bacteria 1586
118 Ga0207704_10292003 3300025938 Bacteria 1245
119 Ga0207704_10418346 3300025938 Bacteria 1062
120 Ga0207704_10808240 3300025938 Bacteria 783
121 Ga0207691_10159202 3300025940 Bacteria 1982
122 Ga0207711_10619514 3300025941 Bacteria 1010
123 Ga0207711_10863458 3300025941 Bacteria 842
124 Ga0207661_10003134 3300025944 Bacteria 11462
125 Ga0207661_10016291 3300025944 Bacteria 5484
126 Ga0207661_10096077 3300025944 Bacteria 2479
127 Ga0207667_10038539 3300025949 Bacteria 5103
128 Ga0207651_11831531 3300025960 Bacteria 546
129 Ga0207712_10136388 3300025961 Bacteria 1877
130 Ga0207712_11850539 3300025961 Bacteria 541
131 Ga0207668_11560567 3300025972 Bacteria 596
132 Ga0207703_10384414 3300026035 Bacteria 1299
133 Ga0207703_11327085 3300026035 Bacteria 692
134 Ga0207639_10790775 3300026041 Bacteria 884
135 Ga0207678_10276418 3300026067 Bacteria 1441
136 Ga0207702_10125720 3300026078 Bacteria 2302
137 Ga0207702_10132444 3300026078 Bacteria 2245
138 Ga0207641_10818700 3300026088 Bacteria 922
139 Ga0207648_10763809 3300026089 Bacteria 898
140 Ga0207676_11161328 3300026095 Bacteria 764
141 Ga0207674_10090800 3300026116 Bacteria 3046
142 Ga0207674_11591708 3300026116 Bacteria 622
143 Ga0207675_100599927 3300026118 Bacteria 1104
144 Ga0207675_101152722 3300026118 Bacteria 795
145 Ga0207698_10237269 3300026142 Bacteria 1659
146 Ga0207698_11079434 3300026142 Bacteria 815
147 Ga0268266_10000937 3300028379 Bacteria 37178
148 Ga0268266_10196149 3300028379 Bacteria 1846
149 Ga0268264_10065806 3300028381 Bacteria 3055
150 Ga0316579_10270209 3300031691 Bacteria 822
151 Ga0316576_10028201 3300031727 Bacteria 3955
152 Ga0316576_10838264 3300031727 Bacteria 660
153 Ga0316578_10887974 3300031728 Unclassified 515
154 Ga0307406_10955726 3300031901 Bacteria 733
155 Ga0307409_100207072 3300031995 Bacteria 1760
156 Ga0316574_0008512 3300035398 Bacteria 5701
157 Ga0316584_0353908 3300036712 Bacteria 1054
158 Ga0395899_0265924 3300037312 Bacteria 1171
159 Ga0395900_0859980 3300037418 Bacteria 832
160 Ga0395898_0014442 3300037466 Bacteria 8111
161 Ga0395901_0433972 3300038443 Bacteria 1345
162 Ga0436365_0367148 3300039437 Bacteria 617
163 Ga0451853_1354462 3300041512 Bacteria 651
164 Ga0466961_0156475 3300044693 Bacteria 1421
165 Ga0466963_0169489 3300044694 Bacteria 1521
166 Ga0466963_0253078 3300044694 Bacteria 1236
167 Ga0466963_0296870 3300044694 Bacteria 1136
168 Ga0466964_0342089 3300044706 Bacteria 766
169 Ga0466960_0062123 3300044901 Bacteria 1835
170 Ga0466959_0040705 3300045049 Bacteria 3432
171 Ga0451576_2223095 3300045051 Bacteria 563
172 Ga0466958_0067288 3300045836 Bacteria 2188
173 Ga0466958_0101376 3300045836 Bacteria 1790
174 Ga0466967_0039228 3300045976 Bacteria 4069
175 Ga0466967_0484964 3300045976 Bacteria 1211
176 Ga0466967_0729027 3300045976 Bacteria 982
177 Ga0495641_0159996 3300046461 Bacteria 1007
178 Ga0495639_0693574 3300046475 Bacteria 526
179 Ga0495662_0378469 3300046476 Bacteria 695
180 Ga0495584_0313121 3300046491 Bacteria 797
181 Ga0495585_0505163 3300046492 Bacteria 574
182 Ga0495635_0814014 3300046663 Bacteria 601
183 Ga0495657_0510090 3300046675 Bacteria 701
184 Ga0495658_0020795 3300046683 Bacteria 3451
185 Ga0495658_0712504 3300046683 Bacteria 643
186 Ga0495676_0204316 3300047321 Bacteria 1371
187 Ga0495680_0345505 3300047322 Bacteria 1037
188 Ga0496100_0136537 3300048903 Bacteria 1733
189 Ga0496100_0143828 3300048903 Bacteria 1694
190 Ga0496100_0233256 3300048903 Bacteria 1355
191 Ga0496100_0352117 3300048903 Bacteria 1112
192 Ga0496100_0681409 3300048903 Bacteria 802
193 Ga0496100_1078011 3300048903 Bacteria 633
194 Ga0496101_0011903 3300048904 Bacteria 5793
195 Ga0496101_0160663 3300048904 Bacteria 1723
196 Ga0496101_0488300 3300048904 Bacteria 973
197 Ga0496101_0545565 3300048904 Bacteria 917
198 Ga0496101_0702130 3300048904 Bacteria 799
199 Ga0496102_0291229 3300048905 Bacteria 1539
200 Ga0496102_0312743 3300048905 Bacteria 1480
201 Ga0496102_0355452 3300048905 Bacteria 1379
202 Ga0496102_0500584 3300048905 Bacteria 1137
203 Ga0496103_0095716 3300048906 Bacteria 1876
204 Ga0496103_0117073 3300048906 Bacteria 1696
205 Ga0496103_0779093 3300048906 Bacteria 604
206 Ga0496104_0102173 3300048907 Bacteria 2745
207 Ga0496105_0048989 3300048908 Bacteria 3487
208 Ga0496105_0277287 3300048908 Bacteria 1353
209 Ga0496106_0038101 3300048909 Bacteria 3597
210 Ga0496107_0005733 3300048910 Bacteria 8500
211 Ga0496107_0048616 3300048910 Bacteria 3056
212 Ga0496107_0291087 3300048910 Bacteria 1216
213 Ga0496108_0294940 3300048911 Bacteria 1412
214 Ga0496108_0404817 3300048911 Bacteria 1192
215 Ga0496108_0813163 3300048911 Bacteria 806
216 Ga0496109_0706920 3300048912 Bacteria 945
217 Ga0496109_0826255 3300048912 Bacteria 864
218 Ga0496109_1300588 3300048912 Bacteria 663
219 Ga0496109_1316918 3300048912 Bacteria 658
220 Ga0496109_1430323 3300048912 Bacteria 627
221 Ga0496110_0351776 3300048913 Bacteria 1342
222 Ga0496111_0013362 3300048914 Bacteria 5585
223 Ga0496111_0429372 3300048914 Bacteria 976
224 Ga0496111_0569421 3300048914 Bacteria 831
225 Ga0496111_0945337 3300048914 Bacteria 619
226 Ga0496112_0296438 3300048915 Bacteria 1563
227 Ga0496112_0464377 3300048915 Bacteria 1203
228 Ga0496113_1089091 3300048916 Bacteria 627
229 Ga0496113_1247096 3300048916 Bacteria 579
230 Ga0496114_0003706 3300048917 Bacteria 11760
231 Ga0496114_0062954 3300048917 Bacteria 3105
232 Ga0496114_0075412 3300048917 Bacteria 2841
233 Ga0496114_0198304 3300048917 Bacteria 1757
234 Ga0496114_0350454 3300048917 Bacteria 1306
235 Ga0496114_0475423 3300048917 Unclassified 1106
236 Ga0496115_0019380 3300048918 Bacteria 5233
237 Ga0496115_0097935 3300048918 Bacteria 2402
238 Ga0501034_0005419 3300049571 Bacteria 13950
239 Ga0501034_0092556 3300049571 Bacteria 3020
240 Ga0501038_0689330 3300049574 Bacteria 766
241 Ga0501039_0255462 3300049575 Bacteria 1378
242 Ga0501047_0080695 3300049581 Bacteria 3127
243 Ga0501067_0004076 3300049583 Bacteria 8061
244 Ga0501067_0063121 3300049583 Bacteria 2051
245 Ga0501067_0075913 3300049583 Bacteria 1862
246 Ga0501067_0607064 3300049583 Bacteria 614
247 Ga0501068_0006966 3300049584 Bacteria 6251
248 Ga0501068_0085836 3300049584 Bacteria 1937
249 Ga0501069_0024905 3300049585 Bacteria 3267
250 Ga0501069_0028039 3300049585 Bacteria 3087
251 Ga0501069_0164931 3300049585 Bacteria 1277
252 Ga0501069_0483922 3300049585 Bacteria 737
253 Ga0501069_0928815 3300049585 Bacteria 530
254 Ga0501070_0001111 3300049586 Bacteria 24148
255 Ga0501070_0007680 3300049586 Bacteria 9148
256 Ga0501070_0016758 3300049586 Bacteria 6151
257 Ga0501070_0056121 3300049586 Bacteria 3265
258 Ga0501070_0261030 3300049586 Bacteria 1416
259 Ga0501071_0017760 3300049587 Bacteria 4913
260 Ga0501071_0051584 3300049587 Bacteria 2965
261 Ga0501072_0057260 3300049588 Bacteria 3071
262 Ga0501073_0002339 3300049589 Bacteria 14184
263 Ga0501073_0006959 3300049589 Bacteria 8421
264 Ga0501073_0134694 3300049589 Bacteria 1712
265 Ga0501074_0001111 3300049590 Bacteria 17546
266 Ga0501074_0003908 3300049590 Bacteria 10613
267 Ga0501074_0035350 3300049590 Bacteria 3620
268 Ga0501075_0297022 3300049591 Bacteria 1231
269 Ga0501076_0572927 3300049592 Bacteria 931
270 Ga0501077_0035837 3300049593 Bacteria 3159
271 Ga0501077_0118329 3300049593 Bacteria 1679
272 Ga0501079_0031165 3300049741 Bacteria 4098
273 Ga0501080_0005037 3300049742 Bacteria 11767
274 Ga0501080_0229854 3300049742 Bacteria 1695
275 Ga0501083_0005510 3300049744 Bacteria 8969
276 Ga0501083_0015422 3300049744 Bacteria 5351
277 Ga0501044_0296841 3300049823 Bacteria 1546
278 nmdc:mga03n38_918369_c1 3300050490 Bacteria 515
279 nmdc:mga0yw44_532920_c1 3300050492 Bacteria 797
280 Ga0495612_0313536 3300053078 Bacteria 705
281 Ga0495595_0390587 3300053084 Bacteria 705
282 Ga0495619_0043714 3300053085 Bacteria 2938
283 Ga0501084_0034666 3300054114 Bacteria 4219
284 Ga0501084_0089422 3300054114 Bacteria 2585
285 Ga0501082_0049062 3300060353 Bacteria 3640
286 Ga0501082_0056635 3300060353 Bacteria 3377
287 Ga0501082_0369382 3300060353 Bacteria 1251
288 Ga0466962_0031112 3300061719 Bacteria 2555
289 Ga0466962_0335788 3300061719 Bacteria 751
290 Ga0070683_100012795
291 JGI24735J21928_10102784
292 rootH1_10349467
293 Ga0070658_10136496
294 Ga0070658_10195811
295 Ga0070658_10427215
296 Ga0070683_100003763
297 Ga0070683_100048110
298 Ga0070690_101551892
299 Ga0070670_101786069
300 Ga0070677_10297157
301 Ga0068869_101029635
302 Ga0070680_100806071
303 Ga0070682_100435640
304 Ga0070682_101201026
305 Ga0070660_100015289
306 Ga0070660_100073460
307 Ga0070689_101313021
308 Ga0070692_10834201
309 Ga0070675_101731367
310 Ga0070659_100143175
311 Ga0070705_100380522
312 Ga0070700_100994003
313 Ga0070694_100613916
314 Ga0070678_101924792
315 Ga0070662_100601461
316 Ga0070681_10604363
317 Ga0070685_10040552
318 Ga0070679_100003617
319 Ga0070679_101576341
320 Ga0070684_100146563
321 Ga0068853_100697967
322 Ga0070686_100091143
323 Ga0070686_100808691
324 Ga0070665_100001439
325 Ga0068855_100594655
326 Ga0070664_101157772
327 Ga0068857_100404239
328 Ga0068856_100098577
329 Ga0068856_100207051
330 Ga0068856_100546775
331 Ga0070702_100771826
332 Ga0068852_100143790
333 Ga0068859_102481195
334 Ga0068864_100028454
335 Ga0068866_10838231
336 Ga0068861_100433967
337 Ga0068861_100519968
338 Ga0068851_10177161
339 Ga0068863_100361106
340 Ga0068858_100314076
341 Ga0068858_101240151
342 Ga0068860_100029762
343 Ga0068862_101735134
344 Ga0075365_10596572
345 Ga0075363_100763461
346 Ga0068865_100420346
347 Ga0068865_100774982
348 Ga0068865_100779452
349 Ga0068865_100860218
350 Ga0097620_102481106
351 Ga0105245_10041557
352 Ga0105245_10370376
353 Ga0105243_10285172
354 Ga0105243_12143261
355 Ga0105242_10877390
356 Ga0105248_11243949
357 Ga0105239_10042597
358 Ga0105239_10847205
359 Ga0105239_12680452
360 Ga0105246_10038431
361 Ga0157371_10630441
362 Ga0157371_10740541
363 Ga0157369_10044259
364 Ga0157369_11233301
365 Ga0163162_11970302
366 Ga0157372_10007847
367 Ga0157372_10658395
368 Ga0157372_11816947
369 Ga0157372_12675531
370 Ga0157375_10077481
371 Ga0157375_10405638
372 Ga0157375_10556883
373 Ga0157375_10738095
374 Ga0157375_12292899
375 Ga0163163_10638026
376 Ga0163163_11890269
377 Ga0163163_12513187
378 Ga0157380_10180961
379 Ga0157379_10054280
380 Ga0157379_11023680
381 Ga0157376_10086840
382 Ga0157376_11811751
383 Ga0163161_10015960
384 Ga0163161_10587913
385 Ga0163161_11147332
386 Ga0207688_10061804
387 Ga0207647_10008889
388 Ga0207647_10040906
389 Ga0207643_11027558
390 Ga0207707_10619312
391 Ga0207707_11548747
392 Ga0207660_10428961
393 Ga0207657_10021824
394 Ga0207657_10132790
395 Ga0207652_10060388
396 Ga0207681_10238786
397 Ga0207650_10919415
398 Ga0207659_10384617
399 Ga0207659_10772719
400 Ga0207687_10253717
401 Ga0207644_11115886
402 Ga0207690_10438937
403 Ga0207709_10147877
404 Ga0207669_10898596
405 Ga0207669_11064244
406 Ga0207704_10163632
407 Ga0207704_10292003
408 Ga0207704_10418346
409 Ga0207704_10808240
410 Ga0207691_10159202
411 Ga0207711_10619514
412 Ga0207711_10863458
413 Ga0207661_10003134
414 Ga0207661_10016291
415 Ga0207661_10096077
416 Ga0207667_10038539
417 Ga0207651_11831531
418 Ga0207712_10136388
419 Ga0207712_11850539
420 Ga0207668_11560567
421 Ga0207703_10384414
422 Ga0207703_11327085
423 Ga0207639_10790775
424 Ga0207678_10276418
425 Ga0207702_10125720
426 Ga0207702_10132444
427 Ga0207641_10818700
428 Ga0207648_10763809
429 Ga0207676_11161328
430 Ga0207674_10090800
431 Ga0207674_11591708
432 Ga0207675_100599927
433 Ga0207675_101152722
434 Ga0207698_10237269
435 Ga0207698_11079434
436 Ga0268266_10000937
437 Ga0268266_10196149
438 Ga0268264_10065806
439 Ga0316579_10270209
440 Ga0316576_10028201
441 Ga0316576_10838264
442 Ga0316578_10887974
443 Ga0307406_10955726
444 Ga0307409_100207072
445 Ga0316574_0008512
446 Ga0316584_0353908
447 Ga0395899_0265924
448 Ga0395900_0859980
449 Ga0395898_0014442
450 Ga0395901_0433972
451 Ga0436365_0367148
452 Ga0451853_1354462
453 Ga0466961_0156475
454 Ga0466963_0169489
455 Ga0466963_0253078
456 Ga0466963_0296870
457 Ga0466964_0342089
458 Ga0466960_0062123
459 Ga0466959_0040705
460 Ga0451576_2223095
461 Ga0466958_0067288
462 Ga0466958_0101376
463 Ga0466967_0039228
464 Ga0466967_0484964
465 Ga0466967_0729027
466 Ga0495641_0159996
467 Ga0495639_0693574
468 Ga0495662_0378469
469 Ga0495584_0313121
470 Ga0495585_0505163
471 Ga0495635_0814014
472 Ga0495657_0510090
473 Ga0495658_0020795
474 Ga0495658_0712504
475 Ga0495676_0204316
476 Ga0495680_0345505
477 Ga0496100_0136537
478 Ga0496100_0143828
479 Ga0496100_0233256
480 Ga0496100_0352117
481 Ga0496100_0681409
482 Ga0496100_1078011
483 Ga0496101_0011903
484 Ga0496101_0160663
485 Ga0496101_0488300
486 Ga0496101_0545565
487 Ga0496101_0702130
488 Ga0496102_0291229
489 Ga0496102_0312743
490 Ga0496102_0355452
491 Ga0496102_0500584
492 Ga0496103_0095716
493 Ga0496103_0117073
494 Ga0496103_0779093
495 Ga0496104_0102173
496 Ga0496105_0048989
497 Ga0496105_0277287
498 Ga0496106_0038101
499 Ga0496107_0005733
500 Ga0496107_0048616
501 Ga0496107_0291087
502 Ga0496108_0294940
503 Ga0496108_0404817
504 Ga0496108_0813163
505 Ga0496109_0706920
506 Ga0496109_0826255
507 Ga0496109_1300588
508 Ga0496109_1316918
509 Ga0496109_1430323
510 Ga0496110_0351776
511 Ga0496111_0013362
512 Ga0496111_0429372
513 Ga0496111_0569421
514 Ga0496111_0945337
515 Ga0496112_0296438
516 Ga0496112_0464377
517 Ga0496113_1089091
518 Ga0496113_1247096
519 Ga0496114_0003706
520 Ga0496114_0062954
521 Ga0496114_0075412
522 Ga0496114_0198304
523 Ga0496114_0350454
524 Ga0496114_0475423
525 Ga0496115_0019380
526 Ga0496115_0097935
527 Ga0501034_0005419
528 Ga0501034_0092556
529 Ga0501038_0689330
530 Ga0501039_0255462
531 Ga0501047_0080695
532 Ga0501067_0004076
533 Ga0501067_0063121
534 Ga0501067_0075913
535 Ga0501067_0607064
536 Ga0501068_0006966
537 Ga0501068_0085836
538 Ga0501069_0024905
539 Ga0501069_0028039
540 Ga0501069_0164931
541 Ga0501069_0483922
542 Ga0501069_0928815
543 Ga0501070_0001111
544 Ga0501070_0007680
545 Ga0501070_0016758
546 Ga0501070_0056121
547 Ga0501070_0261030
548 Ga0501071_0017760
549 Ga0501071_0051584
550 Ga0501072_0057260
551 Ga0501073_0002339
552 Ga0501073_0006959
553 Ga0501073_0134694
554 Ga0501074_0001111
555 Ga0501074_0003908
556 Ga0501074_0035350
557 Ga0501075_0297022
558 Ga0501076_0572927
559 Ga0501077_0035837
560 Ga0501077_0118329
561 Ga0501079_0031165
562 Ga0501080_0005037
563 Ga0501080_0229854
564 Ga0501083_0005510
565 Ga0501083_0015422
566 Ga0501044_0296841
567 nmdc:mga03n38_918369_c1
568 nmdc:mga0yw44_532920_c1
569 Ga0495612_0313536
570 Ga0495595_0390587
571 Ga0495619_0043714
572 Ga0501084_0034666
573 Ga0501084_0089422
574 Ga0501082_0049062
575 Ga0501082_0056635
576 Ga0501082_0369382
577 Ga0466962_0031112
578 Ga0466962_0335788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17844

SCP_3

Bacterial SCP ortholog

23

115

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nss-assembly1.cif.gz_A a structural and functional investigation of a novel protein from mycobacterium smegmatis implicated in mycobacterial macrophage survivability 0.8695 2 103
4nss-assembly2.cif.gz_B a structural and functional investigation of a novel protein from mycobacterium smegmatis implicated in mycobacterial macrophage survivability 0.8656 2 103
4zy7-assembly2.cif.gz_B crystal structure of a mycobacterial protein 0.8551 5 103
4zy7-assembly1.cif.gz_A crystal structure of a mycobacterial protein 0.8525 5 103
2i00-assembly2.cif.gz_C crystal structure of acetyltransferase (gnat family) from enterococcus faecalis 0.807 60 101
ID Description Score Start End Superfamily
af_I6Y8U3_1_129_3.30.1050.40 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A; 0.8749 7 103 3.30.1050.40
4nssB00 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A; 0.8656 2 103 3.30.1050.40
2i00C03 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.807 60 101 3.30.1050.10
af_I6Y8U3_1_129_3.30.1050.40 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A; 0.777 7 103 3.30.1050.40
4nssB00 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A; 0.7434 2 103 3.30.1050.40
ID Description Score Start End GO Terms
AF-A0A7W0L5Y8-F1-model_v4 Maleylpyruvate isomerase family mycothiol-dependent enzyme 0.9418 9 103 GO:0016853
GO:0046872
AF-C7QJA6-F1-model_v4 Mycothiol-dependent maleylpyruvate isomerase metal-binding domain-containing protein 0.9361 11 105 GO:0046872
AF-A0A7W0KRE7-F1-model_v4 Bacterial SCP orthologue domain-containing protein 0.9329 16 104
AF-Z9JWC9-F1-model_v4 Bacterial SCP orthologue domain-containing protein 0.9253 15 103
AF-A0A6J6EYG9-F1-model_v4 Unannotated protein 0.9249 9 107

Map