F388985

General Info

Members Datasets Scaffolds Average Seq Length
289 196 578 353

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10066599|Ga0070658_100665992
Length 394
Sequence MRPQRSKITIACRLAIRNAWLHHDATRIRASAQTGKAANVAGASESIVAATAARIFADLADPQTVNRAQDDGWAAGVWTAIEAAGLPLAWVPDELGGSGADIEDGFAVLAAAGGCALAVPLAETLLAGWLLARAGISSPPQAMTVAPARPHDRVTLGADGTLSGRAAGVPFAAATRHIAVLADSDRGPVVALAATTDCRVAPGRNIAGDPSDAVVFDHVKPLHLAPAPAGLNRDALMLMGATVRAVQTAGALEAILAMSVAYANERVAFERPIGKFQAVQQNLARLAGEVAAALAVSGSAADTMAQVDVADDAVFLEAASAKIRCAEAAQDGAAIAHQVFGAIGFTKEHVLHRFTLRMLSWRDDFGNESHWAAELGRRVARGGADAFWPLVASR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
86 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
87 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
88 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
89 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
90 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
91 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
101 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
102 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
121 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
140 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
193 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 2643221651 Afipia sp. Root123D2 Isolate Unclassified
196 2643221672 Variovorax sp. Root434 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 0.35
Isolates 0.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.81
Nodule 0
Rhizoplane 3.81
Rhizosphere 89.97
Stem 0
Stem Tuber 0
Unclassified 2.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10066599 3300005327 Bacteria 2942
2 JGI25406J46586_10000306 3300003203 Bacteria 22010
3 rootH1_10037598 3300003323 Bacteria 1622
4 Ga0055529_1002165 3300003763 Bacteria 4101
5 Ga0070658_10163361 3300005327 Bacteria 1869
6 Ga0070670_100017347 3300005331 Bacteria 6175
7 Ga0070677_10021028 3300005333 Bacteria 2388
8 Ga0070666_10137452 3300005335 Bacteria 1701
9 Ga0070680_100026555 3300005336 Bacteria 4631
10 Ga0070689_100084574 3300005340 Bacteria 2494
11 Ga0070689_100098239 3300005340 Bacteria 2315
12 Ga0070671_100001045 3300005355 Bacteria 20408
13 Ga0070671_100212560 3300005355 Bacteria 1640
14 Ga0070673_100011877 3300005364 Bacteria 5962
15 Ga0070688_100128990 3300005365 Bacteria 1703
16 Ga0070659_100171651 3300005366 Bacteria 1777
17 Ga0070714_100076129 3300005435 Bacteria 2912
18 Ga0070711_100033022 3300005439 Bacteria 3445
19 Ga0070685_10045324 3300005466 Bacteria 2521
20 Ga0070679_100224599 3300005530 Bacteria 1838
21 Ga0068853_100228391 3300005539 Bacteria 1702
22 Ga0070672_100034470 3300005543 Bacteria 3841
23 Ga0070665_100116820 3300005548 Bacteria 2671
24 Ga0070704_100008345 3300005549 Bacteria 6206
25 Ga0068855_100137459 3300005563 Bacteria 2787
26 Ga0068854_100036595 3300005578 Bacteria 3442
27 Ga0068854_100161465 3300005578 Bacteria 1736
28 Ga0068856_100203075 3300005614 Bacteria 1996
29 Ga0068852_100053613 3300005616 Bacteria 3472
30 Ga0068852_100069098 3300005616 Bacteria 3095
31 Ga0068862_100109649 3300005844 Bacteria 2422
32 Ga0081455_10016203 3300005937 Bacteria 7205
33 Ga0081538_10019822 3300005981 Bacteria 4976
34 Ga0081539_10000497 3300005985 Bacteria 82280
35 Ga0070717_10053081 3300006028 Bacteria 3341
36 Ga0075363_100018093 3300006048 Bacteria 3505
37 Ga0075364_10043307 3300006051 Bacteria 2926
38 Ga0070716_100103341 3300006173 Bacteria 1752
39 Ga0070712_100002566 3300006175 Bacteria 11216
40 Ga0070712_100171534 3300006175 Bacteria 1684
41 Ga0075362_10001504 3300006177 Bacteria 7495
42 Ga0075366_10009430 3300006195 Bacteria 5447
43 Ga0075366_10084653 3300006195 Unclassified 1896
44 Ga0075370_10037681 3300006353 Bacteria 2719
45 Ga0075428_100118538 3300006844 Bacteria 2882
46 Ga0075428_100189184 3300006844 Bacteria 2226
47 Ga0075430_100071261 3300006846 Bacteria 2915
48 Ga0075430_100250406 3300006846 Bacteria 1468
49 Ga0075430_100313427 3300006846 Unclassified 1297
50 Ga0075431_100025814 3300006847 Bacteria 6022
51 Ga0075431_100079244 3300006847 Bacteria 3390
52 Ga0075431_100235879 3300006847 Bacteria 1862
53 Ga0075433_10209863 3300006852 Bacteria 1731
54 Ga0075434_100020361 3300006871 Bacteria 6434
55 Ga0075434_100062458 3300006871 Bacteria 3708
56 Ga0075434_100082012 3300006871 Bacteria 3222
57 Ga0075429_100004645 3300006880 Bacteria 11810
58 Ga0075429_100036473 3300006880 Bacteria 4276
59 Ga0075435_100111768 3300007076 Bacteria 2273
60 Ga0075435_100208331 3300007076 Unclassified 1658
61 Ga0105240_10193812 3300009093 Bacteria 2388
62 Ga0111539_10021074 3300009094 Bacteria 8026
63 Ga0111539_10039355 3300009094 Bacteria 5700
64 Ga0111539_10077093 3300009094 Bacteria 3924
65 Ga0114129_10004882 3300009147 Bacteria 18919
66 Ga0114129_10033489 3300009147 Bacteria 7261
67 Ga0114129_10048969 3300009147 Bacteria 5939
68 Ga0114129_10160310 3300009147 Bacteria 3073
69 Ga0105238_10006714 3300009551 Bacteria 11481
70 Ga0157370_10216101 3300013104 Bacteria 1776
71 Ga0157370_10262605 3300013104 Bacteria 1596
72 Ga0157369_10384916 3300013105 Bacteria 1456
73 Ga0157372_10227515 3300013307 Bacteria 2162
74 Ga0157372_10546967 3300013307 Bacteria 1350
75 Ga0163163_10024043 3300014325 Bacteria 5796
76 Ga0163163_10093900 3300014325 Bacteria 3017
77 Ga0157376_10033936 3300014969 Bacteria 4114
78 Ga0157376_10165351 3300014969 Bacteria 2010
79 Ga0206353_10898714 3300020082 Bacteria 2006
80 Ga0213875_10000047 3300021388 Bacteria 148835
81 Ga0209455_1001139 3300025272 Bacteria 12895
82 Ga0207682_10028668 3300025893 Bacteria 2223
83 Ga0207692_10037948 3300025898 Bacteria 2359
84 Ga0207705_10310569 3300025909 Bacteria 1210
85 Ga0207693_10028608 3300025915 Bacteria 4405
86 Ga0207693_10134651 3300025915 Bacteria 1943
87 Ga0207660_10077060 3300025917 Bacteria 2439
88 Ga0207657_10052381 3300025919 Bacteria 3542
89 Ga0207652_10025307 3300025921 Bacteria 4932
90 Ga0207652_10091044 3300025921 Bacteria 2681
91 Ga0207681_10092734 3300025923 Bacteria 2160
92 Ga0207681_10131961 3300025923 Bacteria 1848
93 Ga0207681_10179131 3300025923 Bacteria 1613
94 Ga0207650_10021819 3300025925 Bacteria 4528
95 Ga0207664_10080993 3300025929 Bacteria 2640
96 Ga0207664_10111552 3300025929 Bacteria 2275
97 Ga0207644_10009638 3300025931 Bacteria 6344
98 Ga0207670_10027044 3300025936 Bacteria 3623
99 Ga0207669_10013901 3300025937 Bacteria 4017
100 Ga0207665_10281986 3300025939 Bacteria 1237
101 Ga0207691_10071545 3300025940 Bacteria 3129
102 Ga0207689_10101775 3300025942 Bacteria 2360
103 Ga0207667_10164297 3300025949 Bacteria 2283
104 Ga0207651_10010606 3300025960 Bacteria 5115
105 Ga0207640_10161527 3300025981 Bacteria 1658
106 Ga0207658_10052470 3300025986 Bacteria 3010
107 Ga0207641_10227539 3300026088 Bacteria 1732
108 Ga0207648_10113642 3300026089 Bacteria 2378
109 Ga0207683_10071795 3300026121 Bacteria 3061
110 Ga0207698_10090985 3300026142 Bacteria 2496
111 Ga0268266_10012700 3300028379 Bacteria 7278
112 Ga0268265_10157531 3300028380 Bacteria 1924
113 Ga0265318_10002091 3300028577 Bacteria 10924
114 Ga0265338_10115689 3300028800 Bacteria 2149
115 Ga0265330_10029199 3300031235 Bacteria 2481
116 Ga0265332_10004859 3300031238 Bacteria 6249
117 Ga0265320_10002598 3300031240 Bacteria 12539
118 Ga0265325_10006613 3300031241 Bacteria 7020
119 Ga0265325_10012528 3300031241 Bacteria 4847
120 Ga0265329_10006303 3300031242 Bacteria 4713
121 Ga0265340_10086853 3300031247 Bacteria 1466
122 Ga0265339_10007396 3300031249 Bacteria 7105
123 Ga0265339_10017440 3300031249 Bacteria 4254
124 Ga0265316_10021883 3300031344 Bacteria 5405
125 Ga0307408_100000406 3300031548 Bacteria 38727
126 Ga0265313_10010544 3300031595 Bacteria 5828
127 Ga0265313_10022182 3300031595 Bacteria 3452
128 Ga0265313_10028377 3300031595 Bacteria 2910
129 Ga0265314_10011645 3300031711 Bacteria 7240
130 Ga0265342_10000967 3300031712 Bacteria 28523
131 Ga0265342_10010444 3300031712 Bacteria 6439
132 Ga0307412_10000207 3300031911 Bacteria 40047
133 Ga0307414_10052271 3300032004 Bacteria 2842
134 Ga0307411_10000086 3300032005 Bacteria 28813
135 Ga0373934_0003207 3300035086 Bacteria 5980
136 Ga0373934_0064122 3300035086 Bacteria 1466
137 Ga0373944_0010285 3300035089 Bacteria 2548
138 Ga0373949_0036056 3300035090 Unclassified 1198
139 Ga0373923_0047135 3300035111 Bacteria 1795
140 Ga0373954_0002049 3300035118 Bacteria 8377
141 Ga0373946_0001391 3300035171 Bacteria 8376
142 Ga0373955_0044769 3300035172 Bacteria 2385
143 Ga0373924_0075330 3300035410 Bacteria 1428
144 Ga0373935_0101028 3300035692 Bacteria 1901
145 Ga0373927_0012654 3300035695 Bacteria 5613
146 Ga0373933_0019463 3300035724 Bacteria 3835
147 Ga0373933_0136799 3300035724 Bacteria 1544
148 Ga0373947_0002304 3300035725 Bacteria 11548
149 Ga0373947_0127258 3300035725 Bacteria 1623
150 Ga0373947_0211969 3300035725 Bacteria 1271
151 Ga0373937_0003358 3300036401 Bacteria 13432
152 Ga0373937_0056789 3300036401 Bacteria 3595
153 Ga0373925_0069904 3300037068 Bacteria 2652
154 Ga0395899_0072266 3300037312 Bacteria 2524
155 Ga0395900_0056537 3300037418 Bacteria 4038
156 Ga0395900_0059057 3300037418 Bacteria 3948
157 Ga0395898_0021989 3300037466 Bacteria 6460
158 Ga0395898_0044192 3300037466 Bacteria 4388
159 Ga0395898_0060863 3300037466 Bacteria 3668
160 Ga0436364_0118735 3300037853 Bacteria 19655
161 Ga0395901_0007979 3300038443 Bacteria 10684
162 Ga0395901_0160116 3300038443 Bacteria 2364
163 Ga0436365_1341183 3300039437 Bacteria 5007
164 Ga0439453_0000107 3300041408 Bacteria 6744
165 Ga0466971_0130792 3300044719 Unclassified 1165
166 Ga0466967_0013448 3300045976 Bacteria 6324
167 Ga0495592_0011889 3300046454 Bacteria 6598
168 Ga0495592_0018371 3300046454 Bacteria 5317
169 Ga0495629_0009852 3300046459 Bacteria 6973
170 Ga0495638_0002894 3300046460 Bacteria 13723
171 Ga0495651_0021848 3300046462 Bacteria 4975
172 Ga0495651_0025670 3300046462 Bacteria 4588
173 Ga0495653_0030644 3300046463 Bacteria 4282
174 Ga0495664_0007641 3300046477 Bacteria 6009
175 Ga0495594_0026979 3300046499 Bacteria 3093
176 Ga0495594_0114192 3300046499 Unclassified 1524
177 Ga0495608_0002393 3300046511 Bacteria 13494
178 Ga0495608_0065551 3300046511 Bacteria 2378
179 Ga0495618_0001815 3300046514 Bacteria 14082
180 Ga0495628_0012730 3300046516 Bacteria 7086
181 Ga0495628_0014291 3300046516 Bacteria 6660
182 Ga0495628_0072679 3300046516 Bacteria 2680
183 Ga0495628_0138757 3300046516 Bacteria 1856
184 Ga0495630_0019520 3300046517 Bacteria 4983
185 Ga0495630_0034696 3300046517 Bacteria 3768
186 Ga0495630_0037757 3300046517 Bacteria 3612
187 Ga0495643_0016581 3300046522 Bacteria 4326
188 Ga0495652_0016928 3300046529 Bacteria 6514
189 Ga0495652_0030826 3300046529 Bacteria 4699
190 Ga0495652_0063214 3300046529 Bacteria 3117
191 Ga0495652_0239977 3300046529 Bacteria 1349
192 Ga0495640_0022721 3300046533 Bacteria 4580
193 Ga0495640_0130869 3300046533 Bacteria 1624
194 Ga0495586_0016437 3300046535 Bacteria 3936
195 Ga0495587_0005578 3300046536 Bacteria 8212
196 Ga0495587_0027218 3300046536 Bacteria 3482
197 Ga0495587_0129130 3300046536 Bacteria 1445
198 Ga0495598_0027908 3300046537 Bacteria 1561
199 Ga0495621_0097568 3300046539 Bacteria 1114
200 Ga0495645_0034404 3300046543 Bacteria 3697
201 Ga0495645_0161668 3300046543 Bacteria 1548
202 Ga0495667_0002404 3300046559 Bacteria 12518
203 Ga0495667_0011581 3300046559 Bacteria 5971
204 Ga0495656_0028976 3300046615 Bacteria 2226
205 Ga0495634_0002830 3300046642 Bacteria 14243
206 Ga0495635_0014185 3300046663 Bacteria 5577
207 Ga0495635_0031500 3300046663 Bacteria 3680
208 Ga0495635_0035213 3300046663 Bacteria 3472
209 Ga0495635_0041633 3300046663 Bacteria 3173
210 Ga0495588_0004441 3300046674 Bacteria 6199
211 Ga0495657_0050535 3300046675 Bacteria 2795
212 Ga0495623_0013143 3300046679 Bacteria 5367
213 Ga0495623_0014221 3300046679 Bacteria 5155
214 Ga0495647_0002296 3300046681 Bacteria 5998
215 Ga0495613_0019383 3300046689 Bacteria 5070
216 Ga0495624_0016857 3300046690 Bacteria 4915
217 Ga0495624_0063326 3300046690 Bacteria 2312
218 Ga0495600_0016520 3300046809 Bacteria 4686
219 Ga0495581_0052899 3300047315 Bacteria 2345
220 Ga0495604_0000186 3300047317 Bacteria 55450
221 Ga0495604_0007114 3300047317 Bacteria 8874
222 Ga0495604_0011540 3300047317 Bacteria 7021
223 Ga0495674_0002525 3300047319 Bacteria 17802
224 Ga0495674_0158335 3300047319 Bacteria 1896
225 Ga0495672_0141717 3300047320 Bacteria 1255
226 Ga0495680_0021098 3300047322 Bacteria 5459
227 Ga0495680_0024022 3300047322 Bacteria 5062
228 Ga0495680_0090813 3300047322 Bacteria 2290
229 Ga0495675_0136501 3300047444 Bacteria 1522
230 Ga0495684_0001718 3300047471 Bacteria 17625
231 Ga0495684_0009913 3300047471 Bacteria 7356
232 Ga0495593_0019852 3300047673 Bacteria 3765
233 Ga0495593_0081257 3300047673 Bacteria 1676
234 Ga0495602_0006523 3300048088 Bacteria 12236
235 Ga0495602_0014715 3300048088 Bacteria 7934
236 Ga0495602_0046520 3300048088 Bacteria 3919
237 Ga0495602_0054805 3300048088 Bacteria 3517
238 Ga0496100_0053059 3300048903 Bacteria 2639
239 Ga0496102_0350698 3300048905 Bacteria 1389
240 Ga0496106_0247667 3300048909 Bacteria 1424
241 Ga0496107_0251214 3300048910 Bacteria 1316
242 Ga0496109_0151560 3300048912 Bacteria 2171
243 Ga0496110_0079031 3300048913 Unclassified 2929
244 Ga0496110_0083513 3300048913 Bacteria 2850
245 Ga0496111_0101806 3300048914 Bacteria 2111
246 Ga0496112_0012164 3300048915 Bacteria 7899
247 Ga0496113_0169608 3300048916 Bacteria 1728
248 Ga0496115_0095276 3300048918 Bacteria 2436
249 Ga0496116_0001436 3300048919 Bacteria 26765
250 Ga0501047_0114546 3300049581 Bacteria 2578
251 Ga0501067_0015976 3300049583 Bacteria 4153
252 Ga0501070_0075327 3300049586 Bacteria 2794
253 Ga0501071_0169889 3300049587 Bacteria 1632
254 Ga0501072_0017083 3300049588 Bacteria 5575
255 Ga0501073_0149686 3300049589 Bacteria 1617
256 Ga0501074_0054748 3300049590 Bacteria 2876
257 Ga0501080_0087803 3300049742 Bacteria 2889
258 Ga0501044_0157796 3300049823 Bacteria 2247
259 nmdc:mga0k408_2921_c3 3300050493 Bacteria 8343
260 nmdc:mga0k408_78745_c1 3300050493 Unclassified 1928
261 nmdc:mga07m45_36925_c1 3300050496 Bacteria 2723
262 nmdc:mga05p37_4375_c1 3300050507 Bacteria 16496
263 nmdc:mga05p37_78_c1 3300050507 Bacteria 85760
264 nmdc:mga09592_17565_c1 3300050508 Bacteria 5863
265 nmdc:mga09592_3378_c1 3300050508 Bacteria 12896
266 nmdc:mga0qj67_76221_c1 3300050509 Bacteria 2682
267 nmdc:mga06r32_2153_c1 3300050510 Bacteria 17616
268 nmdc:mga06r32_21789_c1 3300050510 Bacteria 5916
269 nmdc:mga0n895_49093_c1 3300050512 Bacteria 4133
270 nmdc:mga0n895_73308_c1 3300050512 Bacteria 3399
271 nmdc:mga0rr50_15333_c1 3300050513 Bacteria 5056
272 nmdc:mga0rr50_49905_c1 3300050513 Bacteria 3099
273 nmdc:mga0rr50_78869_c1 3300050513 Bacteria 2535
274 nmdc:mga0a205_375399_c1 3300050515 Bacteria 1287
275 nmdc:mga0a205_55815_c1 3300050515 Bacteria 3814
276 Ga0495601_0016562 3300053077 Bacteria 4467
277 Ga0495601_0018530 3300053077 Bacteria 4238
278 Ga0495601_0020047 3300053077 Bacteria 4081
279 Ga0495601_0034757 3300053077 Bacteria 3145
280 Ga0495612_0010276 3300053078 Bacteria 3787
281 Ga0495612_0030824 3300053078 Bacteria 2161
282 Ga0495612_0046409 3300053078 Bacteria 1779
283 Ga0495595_0001334 3300053084 Bacteria 9599
284 Ga0495595_0022853 3300053084 Bacteria 2748
285 Ga0495595_0032017 3300053084 Bacteria 2366
286 Ga0495619_0013675 3300053085 Bacteria 5116
287 Ga0495619_0227791 3300053085 Bacteria 1291
288 2644290677 2643221651 Bacteria 4798932
289 2644401286 2643221672 Bacteria 6322190
290 Ga0070658_10066599
291 JGI25406J46586_10000306
292 rootH1_10037598
293 Ga0055529_1002165
294 Ga0070658_10163361
295 Ga0070670_100017347
296 Ga0070677_10021028
297 Ga0070666_10137452
298 Ga0070680_100026555
299 Ga0070689_100084574
300 Ga0070689_100098239
301 Ga0070671_100001045
302 Ga0070671_100212560
303 Ga0070673_100011877
304 Ga0070688_100128990
305 Ga0070659_100171651
306 Ga0070714_100076129
307 Ga0070711_100033022
308 Ga0070685_10045324
309 Ga0070679_100224599
310 Ga0068853_100228391
311 Ga0070672_100034470
312 Ga0070665_100116820
313 Ga0070704_100008345
314 Ga0068855_100137459
315 Ga0068854_100036595
316 Ga0068854_100161465
317 Ga0068856_100203075
318 Ga0068852_100053613
319 Ga0068852_100069098
320 Ga0068862_100109649
321 Ga0081455_10016203
322 Ga0081538_10019822
323 Ga0081539_10000497
324 Ga0070717_10053081
325 Ga0075363_100018093
326 Ga0075364_10043307
327 Ga0070716_100103341
328 Ga0070712_100002566
329 Ga0070712_100171534
330 Ga0075362_10001504
331 Ga0075366_10009430
332 Ga0075366_10084653
333 Ga0075370_10037681
334 Ga0075428_100118538
335 Ga0075428_100189184
336 Ga0075430_100071261
337 Ga0075430_100250406
338 Ga0075430_100313427
339 Ga0075431_100025814
340 Ga0075431_100079244
341 Ga0075431_100235879
342 Ga0075433_10209863
343 Ga0075434_100020361
344 Ga0075434_100062458
345 Ga0075434_100082012
346 Ga0075429_100004645
347 Ga0075429_100036473
348 Ga0075435_100111768
349 Ga0075435_100208331
350 Ga0105240_10193812
351 Ga0111539_10021074
352 Ga0111539_10039355
353 Ga0111539_10077093
354 Ga0114129_10004882
355 Ga0114129_10033489
356 Ga0114129_10048969
357 Ga0114129_10160310
358 Ga0105238_10006714
359 Ga0157370_10216101
360 Ga0157370_10262605
361 Ga0157369_10384916
362 Ga0157372_10227515
363 Ga0157372_10546967
364 Ga0163163_10024043
365 Ga0163163_10093900
366 Ga0157376_10033936
367 Ga0157376_10165351
368 Ga0206353_10898714
369 Ga0213875_10000047
370 Ga0209455_1001139
371 Ga0207682_10028668
372 Ga0207692_10037948
373 Ga0207705_10310569
374 Ga0207693_10028608
375 Ga0207693_10134651
376 Ga0207660_10077060
377 Ga0207657_10052381
378 Ga0207652_10025307
379 Ga0207652_10091044
380 Ga0207681_10092734
381 Ga0207681_10131961
382 Ga0207681_10179131
383 Ga0207650_10021819
384 Ga0207664_10080993
385 Ga0207664_10111552
386 Ga0207644_10009638
387 Ga0207670_10027044
388 Ga0207669_10013901
389 Ga0207665_10281986
390 Ga0207691_10071545
391 Ga0207689_10101775
392 Ga0207667_10164297
393 Ga0207651_10010606
394 Ga0207640_10161527
395 Ga0207658_10052470
396 Ga0207641_10227539
397 Ga0207648_10113642
398 Ga0207683_10071795
399 Ga0207698_10090985
400 Ga0268266_10012700
401 Ga0268265_10157531
402 Ga0265318_10002091
403 Ga0265338_10115689
404 Ga0265330_10029199
405 Ga0265332_10004859
406 Ga0265320_10002598
407 Ga0265325_10006613
408 Ga0265325_10012528
409 Ga0265329_10006303
410 Ga0265340_10086853
411 Ga0265339_10007396
412 Ga0265339_10017440
413 Ga0265316_10021883
414 Ga0307408_100000406
415 Ga0265313_10010544
416 Ga0265313_10022182
417 Ga0265313_10028377
418 Ga0265314_10011645
419 Ga0265342_10000967
420 Ga0265342_10010444
421 Ga0307412_10000207
422 Ga0307414_10052271
423 Ga0307411_10000086
424 Ga0373934_0003207
425 Ga0373934_0064122
426 Ga0373944_0010285
427 Ga0373949_0036056
428 Ga0373923_0047135
429 Ga0373954_0002049
430 Ga0373946_0001391
431 Ga0373955_0044769
432 Ga0373924_0075330
433 Ga0373935_0101028
434 Ga0373927_0012654
435 Ga0373933_0019463
436 Ga0373933_0136799
437 Ga0373947_0002304
438 Ga0373947_0127258
439 Ga0373947_0211969
440 Ga0373937_0003358
441 Ga0373937_0056789
442 Ga0373925_0069904
443 Ga0395899_0072266
444 Ga0395900_0056537
445 Ga0395900_0059057
446 Ga0395898_0021989
447 Ga0395898_0044192
448 Ga0395898_0060863
449 Ga0436364_0118735
450 Ga0395901_0007979
451 Ga0395901_0160116
452 Ga0436365_1341183
453 Ga0439453_0000107
454 Ga0466971_0130792
455 Ga0466967_0013448
456 Ga0495592_0011889
457 Ga0495592_0018371
458 Ga0495629_0009852
459 Ga0495638_0002894
460 Ga0495651_0021848
461 Ga0495651_0025670
462 Ga0495653_0030644
463 Ga0495664_0007641
464 Ga0495594_0026979
465 Ga0495594_0114192
466 Ga0495608_0002393
467 Ga0495608_0065551
468 Ga0495618_0001815
469 Ga0495628_0012730
470 Ga0495628_0014291
471 Ga0495628_0072679
472 Ga0495628_0138757
473 Ga0495630_0019520
474 Ga0495630_0034696
475 Ga0495630_0037757
476 Ga0495643_0016581
477 Ga0495652_0016928
478 Ga0495652_0030826
479 Ga0495652_0063214
480 Ga0495652_0239977
481 Ga0495640_0022721
482 Ga0495640_0130869
483 Ga0495586_0016437
484 Ga0495587_0005578
485 Ga0495587_0027218
486 Ga0495587_0129130
487 Ga0495598_0027908
488 Ga0495621_0097568
489 Ga0495645_0034404
490 Ga0495645_0161668
491 Ga0495667_0002404
492 Ga0495667_0011581
493 Ga0495656_0028976
494 Ga0495634_0002830
495 Ga0495635_0014185
496 Ga0495635_0031500
497 Ga0495635_0035213
498 Ga0495635_0041633
499 Ga0495588_0004441
500 Ga0495657_0050535
501 Ga0495623_0013143
502 Ga0495623_0014221
503 Ga0495647_0002296
504 Ga0495613_0019383
505 Ga0495624_0016857
506 Ga0495624_0063326
507 Ga0495600_0016520
508 Ga0495581_0052899
509 Ga0495604_0000186
510 Ga0495604_0007114
511 Ga0495604_0011540
512 Ga0495674_0002525
513 Ga0495674_0158335
514 Ga0495672_0141717
515 Ga0495680_0021098
516 Ga0495680_0024022
517 Ga0495680_0090813
518 Ga0495675_0136501
519 Ga0495684_0001718
520 Ga0495684_0009913
521 Ga0495593_0019852
522 Ga0495593_0081257
523 Ga0495602_0006523
524 Ga0495602_0014715
525 Ga0495602_0046520
526 Ga0495602_0054805
527 Ga0496100_0053059
528 Ga0496102_0350698
529 Ga0496106_0247667
530 Ga0496107_0251214
531 Ga0496109_0151560
532 Ga0496110_0079031
533 Ga0496110_0083513
534 Ga0496111_0101806
535 Ga0496112_0012164
536 Ga0496113_0169608
537 Ga0496115_0095276
538 Ga0496116_0001436
539 Ga0501047_0114546
540 Ga0501067_0015976
541 Ga0501070_0075327
542 Ga0501071_0169889
543 Ga0501072_0017083
544 Ga0501073_0149686
545 Ga0501074_0054748
546 Ga0501080_0087803
547 Ga0501044_0157796
548 nmdc:mga0k408_2921_c3
549 nmdc:mga0k408_78745_c1
550 nmdc:mga07m45_36925_c1
551 nmdc:mga05p37_4375_c1
552 nmdc:mga05p37_78_c1
553 nmdc:mga09592_17565_c1
554 nmdc:mga09592_3378_c1
555 nmdc:mga0qj67_76221_c1
556 nmdc:mga06r32_2153_c1
557 nmdc:mga06r32_21789_c1
558 nmdc:mga0n895_49093_c1
559 nmdc:mga0n895_73308_c1
560 nmdc:mga0rr50_15333_c1
561 nmdc:mga0rr50_49905_c1
562 nmdc:mga0rr50_78869_c1
563 nmdc:mga0a205_375399_c1
564 nmdc:mga0a205_55815_c1
565 Ga0495601_0016562
566 Ga0495601_0018530
567 Ga0495601_0020047
568 Ga0495601_0034757
569 Ga0495612_0010276
570 Ga0495612_0030824
571 Ga0495612_0046409
572 Ga0495595_0001334
573 Ga0495595_0022853
574 Ga0495595_0032017
575 Ga0495619_0013675
576 Ga0495619_0227791
577 2644290677
578 2644401286

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

234

368

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4x28-assembly1.cif.gz_C crystal structure of the chse4-chse5 complex from mycobacterium tuberculosis 0.8122 4 304
3oib-assembly1.cif.gz_A crystal structure of a putative acyl-coa dehydrogenase from mycobacterium smegmatis, iodide soak 0.7911 7 298
2d29-assembly1.cif.gz_A structural study on project id tt0172 from thermus thermophilus hb8 0.7844 4 304
5jsc-assembly1.cif.gz_C crystal structure of a putative acyl-coa dehydrogenase from burkholderia xenovorans 0.7838 6 308
4o5m-assembly1.cif.gz_C x-ray crystal structure of isovaleryl-coa dehydrogenase from brucella suis 0.7829 3 303
ID Description Score Start End Superfamily
af_I6YCF5_2_116_1.10.540.10 Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain 0.8487 4 94 1.10.540.10
af_P96845_3_117_1.10.540.10 Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain 0.8163 6 92 1.10.540.10
af_A0A1D8PTU4_270_427_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.8146 173 303 1.20.140.10
af_P96845_177_319_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.7816 175 298 1.20.140.10
6cy8B03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.7733 173 296 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A7V7WTP5-F1-model_v4 Acyl-CoA dehydrogenase 0.8969 4 134 GO:0016627
GO:0050660
AF-A0A365VQZ4-F1-model_v4 deleted 0.8952 7 125
AF-A0A7K0C924-F1-model_v4 Acyl-CoA dehydrogenase/oxidase C-terminal domain-containing protein 0.8838 6 301 GO:0003995
GO:0050660
AF-A0A836QLT0-F1-model_v4 Acyl-CoA dehydrogenase 0.8831 8 217 GO:0016627
GO:0050660
AF-A0A0M3CP76-F1-model_v4 deleted 0.8811 4 315

Map