F388846

General Info

Members Datasets Scaffolds Average Seq Length
288 114 288 232

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0160743|Ga0501038_0160743_439_1212
Length 257
Sequence MRADNRDMSRFSLEGKCAVVTGGSRGLGAAIALGLAEAGADVLLTYRDRHADAAVIAQQIEEMGRRALAVPMDVTSRKSVSHAAEQARAFGPVSILINNAGVNKPTDFDQITDADWDTILDTNLKGPFIVAQVFLPLLKEAGGGAITHIGSVSGQYGGPRTAHYAASKAGLISLAQVIARFGAPHGIRSNTLAAGLXXSEMAAAGLANAAVQKAAETIILKRMGSPREVADAAVFLSSDAAGYITAQTLNVNGGLYF

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
21 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
34 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
35 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
57 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
58 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
59 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
60 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
61 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
62 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
63 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
64 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
75 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
76 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
77 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
78 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
79 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
80 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
81 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
82 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
97 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
98 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
101 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
102 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
105 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
108 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
112 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
113 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
114 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0
Rhizoplane 0
Rhizosphere 95.83
Stem 0
Stem Tuber 0
Unclassified 2.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001602 3300003215 Bacteria 13408
2 rootH2_10003154 3300003320 Bacteria 36753
3 Ga0070658_10006353 3300005327 Bacteria 9578
4 Ga0070658_10054551 3300005327 Bacteria 3245
5 Ga0070658_10232540 3300005327 Bacteria 1561
6 Ga0070666_10003718 3300005335 Bacteria 9244
7 Ga0070680_100124627 3300005336 Bacteria 2152
8 Ga0070660_100001001 3300005339 Bacteria 18970
9 Ga0070659_100034056 3300005366 Bacteria 3961
10 Ga0070667_100471033 3300005367 Bacteria 1149
11 Ga0070681_10000002 3300005458 Bacteria 821814
12 Ga0070681_10296469 3300005458 Bacteria 1527
13 Ga0068867_100168361 3300005459 Bacteria 1733
14 Ga0070679_100003234 3300005530 Bacteria 14885
15 Ga0070679_100112879 3300005530 Bacteria 2703
16 Ga0070679_100151288 3300005530 Bacteria 2297
17 Ga0068853_100000169 3300005539 Bacteria 45200
18 Ga0068853_100372001 3300005539 Bacteria 1333
19 Ga0070665_100030152 3300005548 Bacteria 5458
20 Ga0070665_100194340 3300005548 Bacteria 2030
21 Ga0070665_100321594 3300005548 Bacteria 1551
22 Ga0070665_100361990 3300005548 Bacteria 1457
23 Ga0068855_100021956 3300005563 Bacteria 7652
24 Ga0068855_100024217 3300005563 Bacteria 7266
25 Ga0068855_100045111 3300005563 Bacteria 5214
26 Ga0068855_100070743 3300005563 Bacteria 4058
27 Ga0068855_100119576 3300005563 Bacteria 3016
28 Ga0068857_100189071 3300005577 Bacteria 1875
29 Ga0068857_100358613 3300005577 Bacteria 1351
30 Ga0068852_100024705 3300005616 Bacteria 4860
31 Ga0070712_100006001 3300006175 Bacteria 7516
32 Ga0068865_100084645 3300006881 Bacteria 2285
33 Ga0105240_10001622 3300009093 Bacteria 38172
34 Ga0105240_10032745 3300009093 Bacteria 6726
35 Ga0105240_10038730 3300009093 Bacteria 6112
36 Ga0105240_10066773 3300009093 Bacteria 4461
37 Ga0105240_10362513 3300009093 Bacteria 1641
38 Ga0105241_10025249 3300009174 Bacteria 4415
39 Ga0105241_10143423 3300009174 Bacteria 1947
40 Ga0105241_10196111 3300009174 Bacteria 1684
41 Ga0105242_10006495 3300009176 Bacteria 9005
42 Ga0105242_10329426 3300009176 Bacteria 1403
43 Ga0105248_10000001 3300009177 Bacteria 1881304
44 Ga0105237_10035090 3300009545 Bacteria 5076
45 Ga0105237_10167592 3300009545 Bacteria 2196
46 Ga0105237_10231662 3300009545 Bacteria 1848
47 Ga0105238_10001302 3300009551 Bacteria 25101
48 Ga0105238_10142159 3300009551 Bacteria 2376
49 Ga0105238_10149129 3300009551 Bacteria 2314
50 Ga0105028_104696 3300009993 Bacteria 1422
51 Ga0105239_10039737 3300010375 Bacteria 5154
52 Ga0105239_10193808 3300010375 Bacteria 2275
53 Ga0105239_10374614 3300010375 Bacteria 1609
54 Ga0157373_10056494 3300013100 Bacteria 2787
55 Ga0157371_10164035 3300013102 Bacteria 1587
56 Ga0157370_10100024 3300013104 Bacteria 2717
57 Ga0157369_10178627 3300013105 Bacteria 2234
58 Ga0163162_10452967 3300013306 Bacteria 1415
59 Ga0157372_10006121 3300013307 Bacteria 12785
60 Ga0157372_10034296 3300013307 Bacteria 5578
61 Ga0213876_10000405 3300021384 Bacteria 36218
62 Ga0213876_10003096 3300021384 Bacteria 9623
63 Ga0209758_1000008 3300025297 Bacteria 1215263
64 Ga0207680_10003238 3300025903 Bacteria 7663
65 Ga0207705_10000058 3300025909 Bacteria 155967
66 Ga0207705_10030376 3300025909 Bacteria 3856
67 Ga0207654_10050850 3300025911 Bacteria 2383
68 Ga0207707_10000002 3300025912 Bacteria 1142054
69 Ga0207707_10000263 3300025912 Bacteria 56613
70 Ga0207707_10240141 3300025912 Bacteria 1575
71 Ga0207695_10005200 3300025913 Bacteria 17414
72 Ga0207695_10006498 3300025913 Bacteria 15143
73 Ga0207695_10012352 3300025913 Bacteria 10260
74 Ga0207695_10034643 3300025913 Bacteria 5487
75 Ga0207695_10043779 3300025913 Bacteria 4767
76 Ga0207671_10076438 3300025914 Bacteria 2506
77 Ga0207671_10191168 3300025914 Bacteria 1596
78 Ga0207660_10000358 3300025917 Bacteria 29719
79 Ga0207660_10000598 3300025917 Bacteria 24324
80 Ga0207657_10000305 3300025919 Bacteria 51999
81 Ga0207652_10000505 3300025921 Bacteria 39729
82 Ga0207652_10000679 3300025921 Bacteria 33231
83 Ga0207652_10244300 3300025921 Bacteria 1618
84 Ga0207652_10523007 3300025921 Bacteria 1067
85 Ga0207694_10136382 3300025924 Bacteria 1971
86 Ga0207690_10030680 3300025932 Bacteria 3432
87 Ga0207686_10008912 3300025934 Bacteria 5428
88 Ga0207709_10368674 3300025935 Bacteria 1089
89 Ga0207711_10000001 3300025941 Bacteria 1325674
90 Ga0207667_10096671 3300025949 Bacteria 3048
91 Ga0207667_10121742 3300025949 Bacteria 2688
92 Ga0207667_10150552 3300025949 Bacteria 2395
93 Ga0207658_10471347 3300025986 Bacteria 1114
94 Ga0207639_10000177 3300026041 Bacteria 49899
95 Ga0207639_10668513 3300026041 Bacteria 962
96 Ga0207674_10304114 3300026116 Bacteria 1544
97 Ga0268266_10025825 3300028379 Bacteria 4997
98 Ga0268266_10084226 3300028379 Bacteria 2776
99 Ga0268266_10187758 3300028379 Bacteria 1886
100 Ga0265318_10000457 3300028577 Bacteria 30611
101 Ga0265318_10001562 3300028577 Bacteria 13304
102 Ga0265338_10325174 3300028800 Bacteria 1112
103 Ga0265330_10006393 3300031235 Bacteria 5821
104 Ga0265330_10041354 3300031235 Bacteria 2044
105 Ga0265330_10044017 3300031235 Bacteria 1973
106 Ga0265330_10055798 3300031235 Bacteria 1725
107 Ga0265330_10086826 3300031235 Bacteria 1345
108 Ga0265332_10019587 3300031238 Bacteria 2986
109 Ga0265332_10033385 3300031238 Bacteria 2240
110 Ga0265332_10056242 3300031238 Bacteria 1686
111 Ga0265332_10108705 3300031238 Bacteria 1168
112 Ga0265328_10023661 3300031239 Bacteria 2328
113 Ga0265320_10001704 3300031240 Bacteria 15623
114 Ga0265320_10038358 3300031240 Bacteria 2404
115 Ga0265325_10000163 3300031241 Bacteria 47195
116 Ga0265325_10005952 3300031241 Bacteria 7472
117 Ga0265325_10006421 3300031241 Bacteria 7131
118 Ga0265325_10011881 3300031241 Bacteria 4993
119 Ga0265340_10000016 3300031247 Bacteria 94019
120 Ga0265340_10000602 3300031247 Bacteria 20076
121 Ga0265340_10002201 3300031247 Bacteria 11159
122 Ga0265340_10008447 3300031247 Bacteria 5560
123 Ga0265340_10079911 3300031247 Bacteria 1540
124 Ga0265340_10092593 3300031247 Bacteria 1411
125 Ga0265340_10135141 3300031247 Bacteria 1129
126 Ga0265339_10018440 3300031249 Bacteria 4113
127 Ga0265339_10036072 3300031249 Bacteria 2769
128 Ga0265339_10041758 3300031249 Bacteria 2543
129 Ga0265339_10059072 3300031249 Bacteria 2069
130 Ga0265339_10065195 3300031249 Bacteria 1953
131 Ga0265339_10134447 3300031249 Bacteria 1262
132 Ga0265331_10000008 3300031250 Bacteria 324311
133 Ga0265331_10001065 3300031250 Bacteria 21378
134 Ga0265331_10024067 3300031250 Bacteria 3086
135 Ga0265327_10000036 3300031251 Bacteria 312827
136 Ga0265316_10004664 3300031344 Bacteria 13572
137 Ga0265316_10029797 3300031344 Bacteria 4482
138 Ga0265316_10113944 3300031344 Bacteria 2045
139 Ga0265316_10220722 3300031344 Bacteria 1399
140 Ga0265313_10000338 3300031595 Bacteria 50856
141 Ga0265313_10001699 3300031595 Bacteria 20295
142 Ga0265313_10002422 3300031595 Bacteria 16124
143 Ga0265313_10011346 3300031595 Bacteria 5549
144 Ga0265314_10001645 3300031711 Bacteria 24453
145 Ga0265314_10003469 3300031711 Bacteria 15229
146 Ga0265314_10007827 3300031711 Bacteria 9233
147 Ga0265314_10016015 3300031711 Bacteria 5936
148 Ga0265314_10027241 3300031711 Bacteria 4282
149 Ga0265314_10042947 3300031711 Bacteria 3219
150 Ga0265314_10044560 3300031711 Bacteria 3144
151 Ga0265314_10046442 3300031711 Bacteria 3064
152 Ga0265314_10119819 3300031711 Bacteria 1658
153 Ga0265314_10139621 3300031711 Bacteria 1500
154 Ga0265314_10179244 3300031711 Bacteria 1271
155 Ga0265314_10184078 3300031711 Unclassified 1248
156 Ga0265314_10267194 3300031711 Bacteria 974
157 Ga0265342_10007691 3300031712 Bacteria 7848
158 Ga0265342_10014330 3300031712 Bacteria 5267
159 Ga0265342_10016965 3300031712 Bacteria 4745
160 Ga0265342_10019463 3300031712 Bacteria 4374
161 Ga0265342_10047291 3300031712 Bacteria 2583
162 Ga0307409_101015639 3300031995 Bacteria 848
163 Ga0373937_0462372 3300036401 Bacteria 1205
164 Ga0395900_0593777 3300037418 Bacteria 1048
165 Ga0395898_0088956 3300037466 Bacteria 2972
166 Ga0395901_0038339 3300038443 Bacteria 4956
167 Ga0436365_1513507 3300039437 Bacteria 68714
168 Ga0436365_1758299 3300039437 Bacteria 1964
169 Ga0436365_1848959 3300039437 Bacteria 20440
170 Ga0495630_0112827 3300046517 Bacteria 2059
171 Ga0495587_0021699 3300046536 Bacteria 3962
172 Ga0495622_0006579 3300046557 Bacteria 5389
173 Ga0495674_0099172 3300047319 Bacteria 2480
174 Ga0495675_0063577 3300047444 Bacteria 2335
175 Ga0495602_0115665 3300048088 Bacteria 2169
176 Ga0496121_0001374 3300048924 Bacteria 41288
177 Ga0501031_0002794 3300049568 Bacteria 11134
178 Ga0501031_0345611 3300049568 Bacteria 963
179 Ga0501032_0024461 3300049569 Bacteria 4170
180 Ga0501032_0037478 3300049569 Bacteria 3306
181 Ga0501032_0088576 3300049569 Bacteria 2055
182 Ga0501032_0139034 3300049569 Bacteria 1600
183 Ga0501033_0019912 3300049570 Bacteria 5071
184 Ga0501033_0023939 3300049570 Bacteria 4606
185 Ga0501033_0052455 3300049570 Bacteria 3022
186 Ga0501033_0089005 3300049570 Bacteria 2258
187 Ga0501033_0137570 3300049570 Bacteria 1767
188 Ga0501033_0362454 3300049570 Bacteria 1014
189 Ga0501034_0012623 3300049571 Bacteria 8718
190 Ga0501034_0113246 3300049571 Bacteria 2703
191 Ga0501034_0135898 3300049571 Bacteria 2439
192 Ga0501034_0331387 3300049571 Bacteria 1454
193 Ga0501034_0343253 3300049571 Bacteria 1423
194 Ga0501034_0364670 3300049571 Bacteria 1371
195 Ga0501034_0503795 3300049571 Bacteria 1124
196 Ga0501036_0020774 3300049572 Bacteria 5515
197 Ga0501036_0069827 3300049572 Bacteria 2970
198 Ga0501037_0007429 3300049573 Bacteria 8012
199 Ga0501038_0020605 3300049574 Bacteria 5926
200 Ga0501038_0021730 3300049574 Bacteria 5757
201 Ga0501038_0160743 3300049574 Bacteria 1826
202 Ga0501038_0184123 3300049574 Bacteria 1684
203 Ga0501038_0334105 3300049574 Bacteria 1183
204 Ga0501038_0431318 3300049574 Bacteria 1016
205 Ga0501039_0004176 3300049575 Bacteria 10875
206 Ga0501039_0232639 3300049575 Bacteria 1449
207 Ga0501040_0039463 3300049576 Bacteria 3211
208 Ga0501042_0071772 3300049578 Bacteria 2477
209 Ga0501043_0073863 3300049579 Bacteria 2678
210 Ga0501043_0224972 3300049579 Bacteria 1450
211 Ga0501043_0237975 3300049579 Bacteria 1405
212 Ga0501046_0004058 3300049580 Bacteria 13359
213 Ga0501046_0078552 3300049580 Bacteria 2553
214 Ga0501046_0354901 3300049580 Bacteria 1064
215 Ga0501047_0001789 3300049581 Bacteria 20799
216 Ga0501047_0004036 3300049581 Bacteria 13807
217 Ga0501047_0014890 3300049581 Bacteria 7403
218 Ga0501047_0050609 3300049581 Bacteria 4012
219 Ga0501047_0063156 3300049581 Bacteria 3572
220 Ga0501047_0099902 3300049581 Bacteria 2781
221 Ga0501047_0157994 3300049581 Bacteria 2140
222 Ga0501047_0164163 3300049581 Bacteria 2092
223 Ga0501047_0248274 3300049581 Bacteria 1628
224 Ga0501047_0263661 3300049581 Bacteria 1570
225 Ga0501047_0266282 3300049581 Bacteria 1561
226 Ga0501047_0314427 3300049581 Bacteria 1406
227 Ga0501047_0625161 3300049581 Bacteria 897
228 Ga0501048_0016343 3300049582 Bacteria 5468
229 Ga0501048_0054746 3300049582 Bacteria 2834
230 Ga0501067_0000181 3300049583 Bacteria 35717
231 Ga0501067_0002170 3300049583 Bacteria 10818
232 Ga0501067_0106320 3300049583 Bacteria 1559
233 Ga0501068_0062127 3300049584 Bacteria 2270
234 Ga0501069_0003293 3300049585 Bacteria 8292
235 Ga0501069_0007006 3300049585 Bacteria 5900
236 Ga0501070_0000017 3300049586 Bacteria 173127
237 Ga0501070_0005722 3300049586 Bacteria 10599
238 Ga0501070_0013842 3300049586 Bacteria 6794
239 Ga0501070_0017855 3300049586 Bacteria 5958
240 Ga0501070_0064332 3300049586 Bacteria 3038
241 Ga0501071_0164631 3300049587 Bacteria 1659
242 Ga0501072_0008074 3300049588 Bacteria 7988
243 Ga0501072_0198322 3300049588 Bacteria 1600
244 Ga0501073_0012264 3300049589 Bacteria 6253
245 Ga0501073_0021824 3300049589 Bacteria 4612
246 Ga0501073_0028307 3300049589 Bacteria 4004
247 Ga0501074_0012666 3300049590 Bacteria 6133
248 Ga0501074_0036270 3300049590 Bacteria 3572
249 Ga0501076_0082351 3300049592 Bacteria 2583
250 Ga0501079_0002077 3300049741 Bacteria 14360
251 Ga0501079_0016389 3300049741 Bacteria 5659
252 Ga0501080_0018022 3300049742 Bacteria 6538
253 Ga0501080_0049848 3300049742 Bacteria 3897
254 Ga0501080_0050759 3300049742 Bacteria 3860
255 Ga0501080_0213537 3300049742 Bacteria 1768
256 Ga0501083_0011885 3300049744 Bacteria 6100
257 Ga0501083_0075004 3300049744 Bacteria 2247
258 Ga0501083_0146225 3300049744 Bacteria 1548
259 Ga0501035_0002699 3300049822 Bacteria 17244
260 Ga0501035_0006022 3300049822 Bacteria 11418
261 Ga0501035_0028142 3300049822 Bacteria 5132
262 Ga0501035_0125243 3300049822 Bacteria 2243
263 Ga0501035_0133774 3300049822 Bacteria 2160
264 Ga0501035_0298851 3300049822 Bacteria 1357
265 Ga0501044_0002656 3300049823 Bacteria 20336
266 Ga0501044_0003942 3300049823 Bacteria 16632
267 Ga0501044_0007218 3300049823 Bacteria 12222
268 Ga0501044_0010021 3300049823 Bacteria 10296
269 Ga0501044_0027516 3300049823 Bacteria 6008
270 Ga0501044_0049659 3300049823 Bacteria 4330
271 Ga0501044_0058846 3300049823 Bacteria 3939
272 Ga0501044_0090052 3300049823 Unclassified 3096
273 Ga0501044_0122638 3300049823 Bacteria 2598
274 Ga0501044_0128621 3300049823 Bacteria 2528
275 Ga0501044_0199549 3300049823 Bacteria 1959
276 Ga0501044_0346603 3300049823 Bacteria 1406
277 Ga0501044_0360791 3300049823 Bacteria 1371
278 Ga0501045_0165218 3300049824 Bacteria 1648
279 Ga0500643_000027 3300053087 Bacteria 251062
280 Ga0500643_073068 3300053087 Bacteria 950
281 Ga0500595_076761 3300053119 Bacteria 983
282 Ga0501084_0004285 3300054114 Bacteria 11616
283 Ga0501084_0017537 3300054114 Bacteria 5954
284 Ga0501084_0044882 3300054114 Bacteria 3700
285 Ga0501084_0076849 3300054114 Bacteria 2799
286 Ga0501084_0135454 3300054114 Bacteria 2074
287 Ga0501082_0005158 3300060353 Bacteria 11371
288 Ga0501082_0095067 3300060353 Bacteria 2575

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031247 Ga0265340_10000016 Ga0265340_100000168 208
2 3300031249 Ga0265339_10134447 Ga0265339_101344472 208
3 3300031344 Ga0265316_10004664 Ga0265316_1000466410 208
4 3300031711 Ga0265314_10044560 Ga0265314_100445603 208
5 3300031712 Ga0265342_10007691 Ga0265342_100076915 208
6 3300013307 Ga0157372_10034296 Ga0157372_100342965 213
7 3300009993 Ga0105028_104696 Ga0105028_1046962 216
8 3300046557 Ga0495622_0006579 Ga0495622_0006579_690_1433 216
9 3300005548 Ga0070665_100030152 Ga0070665_1000301524 217
10 3300025913 Ga0207695_10012352 Ga0207695_100123524 217
11 3300028379 Ga0268266_10025825 Ga0268266_100258253 217
12 3300031247 Ga0265340_10092593 Ga0265340_100925931 218
13 3300025911 Ga0207654_10050850 Ga0207654_100508501 219
14 3300049574 Ga0501038_0184123 Ga0501038_0184123_569_1324 219
15 3300049823 Ga0501044_0346603 Ga0501044_0346603_194_949 219
16 3300006175 Ga0070712_100006001 Ga0070712_1000060012 220
17 3300006881 Ga0068865_100084645 Ga0068865_1000846453 220
18 3300005335 Ga0070666_10003718 Ga0070666_100037188 224
19 3300005367 Ga0070667_100471033 Ga0070667_1004710332 224
20 3300005548 Ga0070665_100194340 Ga0070665_1001943402 224
21 3300005563 Ga0068855_100119576 Ga0068855_1001195762 224
22 3300025903 Ga0207680_10003238 Ga0207680_100032388 224
23 3300025949 Ga0207667_10121742 Ga0207667_101217422 224
24 3300025986 Ga0207658_10471347 Ga0207658_104713472 224
25 3300028379 Ga0268266_10187758 Ga0268266_101877582 224
26 3300031247 Ga0265340_10002201 Ga0265340_1000220110 225
27 3300031344 Ga0265316_10220722 Ga0265316_102207222 225
28 3300031711 Ga0265314_10042947 Ga0265314_100429471 225
29 3300031711 Ga0265314_10267194 Ga0265314_102671942 225
30 3300031712 Ga0265342_10047291 Ga0265342_100472913 225
31 3300031995 Ga0307409_101015639 Ga0307409_1010156391 225
32 3300049570 Ga0501033_0137570 Ga0501033_0137570_315_1064 225
33 3300049574 Ga0501038_0431318 Ga0501038_0431318_73_822 225
34 3300049575 Ga0501039_0232639 Ga0501039_0232639_672_1421 225
35 3300049579 Ga0501043_0073863 Ga0501043_0073863_787_1536 225
36 3300049589 Ga0501073_0028307 Ga0501073_0028307_2836_3588 225
37 3300049823 Ga0501044_0199549 Ga0501044_0199549_1065_1814 225
38 3300005327 Ga0070658_10232540 Ga0070658_102325402 226
39 3300005366 Ga0070659_100034056 Ga0070659_1000340563 226
40 3300005530 Ga0070679_100151288 Ga0070679_1001512883 226
41 3300005539 Ga0068853_100372001 Ga0068853_1003720012 226
42 3300005563 Ga0068855_100021956 Ga0068855_1000219562 226
43 3300005577 Ga0068857_100358613 Ga0068857_1003586132 226
44 3300013104 Ga0157370_10100024 Ga0157370_101000242 226
45 3300025921 Ga0207652_10244300 Ga0207652_102443002 226
46 3300025932 Ga0207690_10030680 Ga0207690_100306803 226
47 3300025949 Ga0207667_10096671 Ga0207667_100966713 226
48 3300026116 Ga0207674_10304114 Ga0207674_103041142 226
49 3300028800 Ga0265338_10325174 Ga0265338_103251742 226
50 3300031235 Ga0265330_10006393 Ga0265330_100063933 226
51 3300031238 Ga0265332_10108705 Ga0265332_101087052 226
52 3300031247 Ga0265340_10008447 Ga0265340_100084473 226
53 3300031247 Ga0265340_10135141 Ga0265340_101351412 226
54 3300031249 Ga0265339_10036072 Ga0265339_100360723 226
55 3300031249 Ga0265339_10065195 Ga0265339_100651952 226
56 3300031344 Ga0265316_10029797 Ga0265316_100297975 226
57 3300031344 Ga0265316_10113944 Ga0265316_101139442 226
58 3300031595 Ga0265313_10011346 Ga0265313_100113463 226
59 3300031711 Ga0265314_10046442 Ga0265314_100464422 226
60 3300031711 Ga0265314_10139621 Ga0265314_101396211 226
61 3300031711 Ga0265314_10184078 Ga0265314_101840782 226
62 3300031712 Ga0265342_10014330 Ga0265342_100143303 226
63 3300049568 Ga0501031_0002794 Ga0501031_0002794_1255_2010 226
64 3300049569 Ga0501032_0024461 Ga0501032_0024461_53_808 226
65 3300049570 Ga0501033_0023939 Ga0501033_0023939_1767_2522 226
66 3300049571 Ga0501034_0135898 Ga0501034_0135898_577_1332 226
67 3300049572 Ga0501036_0069827 Ga0501036_0069827_1639_2394 226
68 3300049573 Ga0501037_0007429 Ga0501037_0007429_5619_6374 226
69 3300049574 Ga0501038_0020605 Ga0501038_0020605_577_1332 226
70 3300049575 Ga0501039_0004176 Ga0501039_0004176_1059_1814 226
71 3300049576 Ga0501040_0039463 Ga0501040_0039463_830_1585 226
72 3300049578 Ga0501042_0071772 Ga0501042_0071772_159_914 226
73 3300049580 Ga0501046_0004058 Ga0501046_0004058_3874_4629 226
74 3300049581 Ga0501047_0014890 Ga0501047_0014890_302_1057 226
75 3300049582 Ga0501048_0016343 Ga0501048_0016343_1959_2714 226
76 3300049583 Ga0501067_0002170 Ga0501067_0002170_1767_2522 226
77 3300049584 Ga0501068_0062127 Ga0501068_0062127_80_835 226
78 3300049585 Ga0501069_0003293 Ga0501069_0003293_4510_5265 226
79 3300049586 Ga0501070_0005722 Ga0501070_0005722_5971_6726 226
80 3300049587 Ga0501071_0164631 Ga0501071_0164631_215_970 226
81 3300049588 Ga0501072_0198322 Ga0501072_0198322_126_881 226
82 3300049589 Ga0501073_0012264 Ga0501073_0012264_2744_3499 226
83 3300049590 Ga0501074_0012666 Ga0501074_0012666_2016_2771 226
84 3300049592 Ga0501076_0082351 Ga0501076_0082351_148_903 226
85 3300049741 Ga0501079_0002077 Ga0501079_0002077_5892_6647 226
86 3300049742 Ga0501080_0049848 Ga0501080_0049848_1255_2010 226
87 3300049744 Ga0501083_0011885 Ga0501083_0011885_3331_4086 226
88 3300049822 Ga0501035_0028142 Ga0501035_0028142_2611_3366 226
89 3300049823 Ga0501044_0049659 Ga0501044_0049659_1408_2163 226
90 3300049824 Ga0501045_0165218 Ga0501045_0165218_832_1587 226
91 3300054114 Ga0501084_0017537 Ga0501084_0017537_2212_2967 226
92 3300060353 Ga0501082_0005158 Ga0501082_0005158_9179_9934 226
93 3300005327 Ga0070658_10006353 Ga0070658_100063532 227
94 3300005339 Ga0070660_100001001 Ga0070660_10000100110 227
95 3300005459 Ga0068867_100168361 Ga0068867_1001683612 227
96 3300005577 Ga0068857_100189071 Ga0068857_1001890712 227
97 3300009174 Ga0105241_10196111 Ga0105241_101961111 227
98 3300009176 Ga0105242_10006495 Ga0105242_100064958 227
99 3300013102 Ga0157371_10164035 Ga0157371_101640352 227
100 3300013307 Ga0157372_10006121 Ga0157372_100061217 227
101 3300025909 Ga0207705_10000058 Ga0207705_1000005882 227
102 3300025912 Ga0207707_10000263 Ga0207707_1000026336 227
103 3300025934 Ga0207686_10008912 Ga0207686_100089122 227
104 3300025935 Ga0207709_10368674 Ga0207709_103686742 227
105 3300031235 Ga0265330_10041354 Ga0265330_100413542 227
106 3300031235 Ga0265330_10044017 Ga0265330_100440172 227
107 3300031241 Ga0265325_10000163 Ga0265325_100001637 227
108 3300031247 Ga0265340_10000602 Ga0265340_1000060215 227
109 3300031247 Ga0265340_10079911 Ga0265340_100799112 227
110 3300031249 Ga0265339_10018440 Ga0265339_100184402 227
111 3300031249 Ga0265339_10041758 Ga0265339_100417583 227
112 3300031711 Ga0265314_10003469 Ga0265314_100034698 227
113 3300031711 Ga0265314_10179244 Ga0265314_101792442 227
114 3300031712 Ga0265342_10019463 Ga0265342_100194634 227
115 3300039437 Ga0436365_1758299 Ga0436365_1758299_647_1399 227
116 3300048924 Ga0496121_0001374 Ga0496121_0001374_39446_40201 227
117 3300049569 Ga0501032_0088576 Ga0501032_0088576_462_1235 227
118 3300049570 Ga0501033_0089005 Ga0501033_0089005_1303_2076 227
119 3300049571 Ga0501034_0364670 Ga0501034_0364670_606_1361 227
120 3300049571 Ga0501034_0503795 Ga0501034_0503795_292_1065 227
121 3300049580 Ga0501046_0354901 Ga0501046_0354901_69_842 227
122 3300049581 Ga0501047_0099902 Ga0501047_0099902_1476_2249 227
123 3300049581 Ga0501047_0164163 Ga0501047_0164163_1160_1915 227
124 3300049581 Ga0501047_0625161 Ga0501047_0625161_122_874 227
125 3300049586 Ga0501070_0017855 Ga0501070_0017855_3706_4461 227
126 3300049742 Ga0501080_0213537 Ga0501080_0213537_323_1078 227
127 3300053087 Ga0500643_000027 Ga0500643_000027_119605_120357 227
128 3300054114 Ga0501084_0076849 Ga0501084_0076849_1853_2605 227
129 3300005563 Ga0068855_100024217 Ga0068855_1000242172 228
130 3300009551 Ga0105238_10001302 Ga0105238_100013024 228
131 3300013100 Ga0157373_10056494 Ga0157373_100564943 228
132 3300025917 Ga0207660_10000358 Ga0207660_1000035810 228
133 3300025919 Ga0207657_10000305 Ga0207657_1000030519 228
134 3300025921 Ga0207652_10000679 Ga0207652_1000067911 228
135 3300031711 Ga0265314_10119819 Ga0265314_101198192 228
136 3300049571 Ga0501034_0113246 Ga0501034_0113246_933_1685 228
137 3300005327 Ga0070658_10054551 Ga0070658_100545513 229
138 3300005563 Ga0068855_100045111 Ga0068855_1000451113 229
139 3300005563 Ga0068855_100070743 Ga0068855_1000707433 229
140 3300009093 Ga0105240_10038730 Ga0105240_100387304 229
141 3300009093 Ga0105240_10066773 Ga0105240_100667732 229
142 3300009174 Ga0105241_10143423 Ga0105241_101434232 229
143 3300009545 Ga0105237_10167592 Ga0105237_101675922 229
144 3300009551 Ga0105238_10149129 Ga0105238_101491292 229
145 3300010375 Ga0105239_10374614 Ga0105239_103746142 229
146 3300021384 Ga0213876_10003096 Ga0213876_100030968 229
147 3300025909 Ga0207705_10030376 Ga0207705_100303762 229
148 3300025913 Ga0207695_10005200 Ga0207695_1000520013 229
149 3300025913 Ga0207695_10043779 Ga0207695_100437793 229
150 3300025949 Ga0207667_10150552 Ga0207667_101505522 229
151 3300037418 Ga0395900_0593777 Ga0395900_0593777_90_842 229
152 3300037466 Ga0395898_0088956 Ga0395898_0088956_969_1721 229
153 3300038443 Ga0395901_0038339 Ga0395901_0038339_4104_4856 229
154 3300039437 Ga0436365_1848959 Ga0436365_1848959_8346_9098 229
155 3300049570 Ga0501033_0362454 Ga0501033_0362454_50_805 229
156 3300049574 Ga0501038_0021730 Ga0501038_0021730_2784_3539 229
157 3300049581 Ga0501047_0263661 Ga0501047_0263661_632_1387 229
158 3300049586 Ga0501070_0000017 Ga0501070_0000017_39672_40427 229
159 3300049742 Ga0501080_0018022 Ga0501080_0018022_3296_4051 229
160 3300049744 Ga0501083_0075004 Ga0501083_0075004_1097_1852 229
161 3300049822 Ga0501035_0002699 Ga0501035_0002699_11353_12108 229
162 3300049823 Ga0501044_0002656 Ga0501044_0002656_6562_7317 229
163 3300049823 Ga0501044_0007218 Ga0501044_0007218_5623_6378 229
164 3300049823 Ga0501044_0010021 Ga0501044_0010021_2965_3720 229
165 3300049823 Ga0501044_0360791 Ga0501044_0360791_274_1029 229
166 3300003320 rootH2_10003154 rootH2_1000315418 230
167 3300009093 Ga0105240_10001622 Ga0105240_1000162218 230
168 3300009545 Ga0105237_10231662 Ga0105237_102316622 230
169 3300010375 Ga0105239_10039737 Ga0105239_100397373 230
170 3300025913 Ga0207695_10006498 Ga0207695_100064984 230
171 3300025914 Ga0207671_10191168 Ga0207671_101911682 230
172 3300031250 Ga0265331_10000008 Ga0265331_10000008276 230
173 3300031251 Ga0265327_10000036 Ga0265327_10000036156 230
174 3300049570 Ga0501033_0052455 Ga0501033_0052455_474_1226 230
175 3300049574 Ga0501038_0334105 Ga0501038_0334105_215_967 230
176 3300049823 Ga0501044_0027516 Ga0501044_0027516_2714_3466 230
177 3300009176 Ga0105242_10329426 Ga0105242_103294262 231
178 3300005548 Ga0070665_100321594 Ga0070665_1003215942 232
179 3300009545 Ga0105237_10035090 Ga0105237_100350902 232
180 3300009551 Ga0105238_10142159 Ga0105238_101421592 232
181 3300010375 Ga0105239_10193808 Ga0105239_101938082 232
182 3300025914 Ga0207671_10076438 Ga0207671_100764382 232
183 3300025924 Ga0207694_10136382 Ga0207694_101363822 232
184 3300028379 Ga0268266_10084226 Ga0268266_100842262 232
185 3300036401 Ga0373937_0462372 Ga0373937_0462372_288_1040 232
186 3300049570 Ga0501033_0019912 Ga0501033_0019912_1411_2163 232
187 3300049581 Ga0501047_0248274 Ga0501047_0248274_13_765 232
188 3300049742 Ga0501080_0050759 Ga0501080_0050759_516_1268 232
189 3300049822 Ga0501035_0133774 Ga0501035_0133774_202_954 232
190 3300049823 Ga0501044_0122638 Ga0501044_0122638_1381_2133 232
191 3300031241 Ga0265325_10005952 Ga0265325_100059525 233
192 3300031250 Ga0265331_10024067 Ga0265331_100240674 233
193 3300031595 Ga0265313_10002422 Ga0265313_100024223 233
194 3300031711 Ga0265314_10016015 Ga0265314_100160153 233
195 3300049569 Ga0501032_0139034 Ga0501032_0139034_255_1028 233
196 3300049571 Ga0501034_0331387 Ga0501034_0331387_214_966 233
197 3300049579 Ga0501043_0237975 Ga0501043_0237975_373_1125 233
198 3300049581 Ga0501047_0001789 Ga0501047_0001789_5811_6584 233
199 3300049581 Ga0501047_0004036 Ga0501047_0004036_2339_3091 233
200 3300049581 Ga0501047_0050609 Ga0501047_0050609_564_1313 233
201 3300049583 Ga0501067_0106320 Ga0501067_0106320_315_1067 233
202 3300049744 Ga0501083_0146225 Ga0501083_0146225_89_862 233
203 3300049822 Ga0501035_0125243 Ga0501035_0125243_298_1047 233
204 3300049822 Ga0501035_0298851 Ga0501035_0298851_478_1233 233
205 3300049823 Ga0501044_0058846 Ga0501044_0058846_806_1561 233
206 3300049823 Ga0501044_0128621 Ga0501044_0128621_600_1373 233
207 3300013105 Ga0157369_10178627 Ga0157369_101786272 234
208 3300046536 Ga0495587_0021699 Ga0495587_0021699_2917_3669 234
209 3300047319 Ga0495674_0099172 Ga0495674_0099172_1188_1940 234
210 3300048088 Ga0495602_0115665 Ga0495602_0115665_1326_2078 234
211 3300049571 Ga0501034_0343253 Ga0501034_0343253_603_1376 234
212 3300049586 Ga0501070_0064332 Ga0501070_0064332_397_1170 234
213 3300049588 Ga0501072_0008074 Ga0501072_0008074_4613_5386 234
214 3300053087 Ga0500643_073068 Ga0500643_073068_67_819 234
215 3300053119 Ga0500595_076761 Ga0500595_076761_132_884 234
216 3300005458 Ga0070681_10296469 Ga0070681_102964692 236
217 3300005530 Ga0070679_100112879 Ga0070679_1001128793 236
218 3300013306 Ga0163162_10452967 Ga0163162_104529672 236
219 3300025921 Ga0207652_10523007 Ga0207652_105230072 236
220 3300031235 Ga0265330_10055798 Ga0265330_100557982 236
221 3300031249 Ga0265339_10059072 Ga0265339_100590722 236
222 3300026041 Ga0207639_10668513 Ga0207639_106685131 237
223 3300049581 Ga0501047_0314427 Ga0501047_0314427_573_1346 237
224 3300005336 Ga0070680_100124627 Ga0070680_1001246271 238
225 3300025912 Ga0207707_10240141 Ga0207707_102401412 238
226 3300046517 Ga0495630_0112827 Ga0495630_0112827_1011_1754 238
227 3300049822 Ga0501035_0006022 Ga0501035_0006022_7003_7755 239
228 3300049823 Ga0501044_0090052 Ga0501044_0090052_2044_2796 239
229 3300005539 Ga0068853_100000169 Ga0068853_10000016919 241
230 3300026041 Ga0207639_10000177 Ga0207639_1000017718 241
231 3300028577 Ga0265318_10001562 Ga0265318_1000156211 242
232 3300031238 Ga0265332_10019587 Ga0265332_100195873 242
233 3300031240 Ga0265320_10038358 Ga0265320_100383582 242
234 3300031250 Ga0265331_10001065 Ga0265331_100010654 242
235 3300031595 Ga0265313_10000338 Ga0265313_100003387 242
236 3300031711 Ga0265314_10007827 Ga0265314_100078276 242
237 3300021384 Ga0213876_10000405 Ga0213876_100004054 248
238 3300039437 Ga0436365_1513507 Ga0436365_1513507_37409_38155 248
239 3300054114 Ga0501084_0004285 Ga0501084_0004285_5880_6626 248
240 3300005458 Ga0070681_10000002 Ga0070681_10000002593 250
241 3300005530 Ga0070679_100003234 Ga0070679_1000032344 250
242 3300005548 Ga0070665_100361990 Ga0070665_1003619902 250
243 3300005616 Ga0068852_100024705 Ga0068852_1000247053 250
244 3300009093 Ga0105240_10032745 Ga0105240_100327454 250
245 3300009093 Ga0105240_10362513 Ga0105240_103625132 250
246 3300009174 Ga0105241_10025249 Ga0105241_100252494 250
247 3300009177 Ga0105248_10000001 Ga0105248_100000011721 250
248 3300025912 Ga0207707_10000002 Ga0207707_10000002365 250
249 3300025913 Ga0207695_10034643 Ga0207695_100346433 250
250 3300025917 Ga0207660_10000598 Ga0207660_1000059810 250
251 3300025921 Ga0207652_10000505 Ga0207652_1000050521 250
252 3300025941 Ga0207711_10000001 Ga0207711_10000001151 250
253 3300028577 Ga0265318_10000457 Ga0265318_1000045717 250
254 3300031235 Ga0265330_10086826 Ga0265330_100868262 250
255 3300031238 Ga0265332_10033385 Ga0265332_100333852 250
256 3300031238 Ga0265332_10056242 Ga0265332_100562422 250
257 3300031239 Ga0265328_10023661 Ga0265328_100236612 250
258 3300031240 Ga0265320_10001704 Ga0265320_1000170413 250
259 3300031241 Ga0265325_10006421 Ga0265325_100064217 250
260 3300031241 Ga0265325_10011881 Ga0265325_100118811 250
261 3300031595 Ga0265313_10001699 Ga0265313_100016997 250
262 3300031711 Ga0265314_10001645 Ga0265314_1000164513 250
263 3300031711 Ga0265314_10027241 Ga0265314_100272413 250
264 3300031712 Ga0265342_10016965 Ga0265342_100169652 250
265 3300047444 Ga0495675_0063577 Ga0495675_0063577_59_811 250
266 3300049568 Ga0501031_0345611 Ga0501031_0345611_149_901 250
267 3300049569 Ga0501032_0037478 Ga0501032_0037478_160_912 250
268 3300049571 Ga0501034_0012623 Ga0501034_0012623_4158_4910 250
269 3300049572 Ga0501036_0020774 Ga0501036_0020774_3816_4568 250
270 3300049579 Ga0501043_0224972 Ga0501043_0224972_609_1361 250
271 3300049580 Ga0501046_0078552 Ga0501046_0078552_1149_1901 250
272 3300049581 Ga0501047_0063156 Ga0501047_0063156_1240_1992 250
273 3300049581 Ga0501047_0266282 Ga0501047_0266282_721_1473 250
274 3300049582 Ga0501048_0054746 Ga0501048_0054746_616_1368 250
275 3300049583 Ga0501067_0000181 Ga0501067_0000181_32471_33223 250
276 3300049585 Ga0501069_0007006 Ga0501069_0007006_3583_4335 250
277 3300049586 Ga0501070_0013842 Ga0501070_0013842_4174_4926 250
278 3300049589 Ga0501073_0021824 Ga0501073_0021824_1240_1992 250
279 3300049590 Ga0501074_0036270 Ga0501074_0036270_1240_1992 250
280 3300049741 Ga0501079_0016389 Ga0501079_0016389_4189_4941 250
281 3300049823 Ga0501044_0003942 Ga0501044_0003942_2252_3004 250
282 3300054114 Ga0501084_0044882 Ga0501084_0044882_1240_1992 250
283 3300054114 Ga0501084_0135454 Ga0501084_0135454_381_1133 250
284 3300060353 Ga0501082_0095067 Ga0501082_0095067_880_1632 250
285 3300003215 JGI25153J46596_10001602 JGI25153J46596_1000160214 251
286 3300025297 Ga0209758_1000008 Ga0209758_1000008202 251
287 3300049574 Ga0501038_0160743 Ga0501038_0160743_439_1212 251
288 3300049581 Ga0501047_0157994 Ga0501047_0157994_556_1311 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

16

210

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

22

256

0.94

PF08659

KR

KR domain

17

199

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ijk-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 0.9291 6 250
7eny-assembly2.cif.gz_G crystal structure of hydroxysteroid dehydrogenase from escherichia coli 0.9237 1 248
2hq1-assembly1.cif.gz_A crystal structure of orf 1438 a putative glucose/ribitol dehydrogenase from clostridium thermocellum 0.9214 6 249
4ijk-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 0.9212 6 250
4ijk-assembly1.cif.gz_D crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 0.9197 6 250
ID Description Score Start End Superfamily
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9231 6 248 3.40.50.720
2hq1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9214 6 249 3.40.50.720
2ntnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9147 12 248 3.40.50.720
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9143 3 250 3.40.50.720
2hq1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9134 6 249 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7V5HY18-F1-model_v4 SDR family oxidoreductase 0.9226 6 248 GO:0016616
AF-A0A7V3DJP4-F1-model_v4 Glucose 1-dehydrogenase (EC 1.1.1.47) 0.9224 3 248 GO:0047936
AF-Q39TK3-F1-model_v4 Oxidoreductase, short-chain dehydrogenase/reductase family 0.9223 4 248 GO:0016616
AF-A0A3B9C073-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9219 7 251 GO:0004316
GO:0006633
GO:0051287
AF-A0A845CCR8-F1-model_v4 Glucose 1-dehydrogenase (EC 1.1.1.47) 0.921 1 250 GO:0016616

Feature Viewer

pLDDT pTM Quality
85.41 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map