F388843

General Info

Members Datasets Scaffolds Average Seq Length
288 174 576 184

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0141941|Ga0501034_0141941_1396_2034
Length 212
Sequence MAREKAGYSSIHDNISKINKTFDEEKNMASLETPICDFGWKAIDFDLPGVDGKRYNLASARRENGLLVMFICNHCPYVKAIRERIIRDVKELAAYGIGAIAIMSNDPMDYPEDSFDSMVKIAKEFDYPFPYVWDETQQIAKVYGAVCTPDFFGFNGQLELQYRGRLDASRKEAAPVDVRRDLFEAMVQVARTGQGPKDQIPSIGCSIKWRAD

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
82 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
88 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
91 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
97 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
98 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
99 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
102 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
103 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
104 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
105 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
106 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
107 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
108 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
112 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
118 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
128 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
129 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
130 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
169 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
170 2547132512 Azospira oryzae 6a3 Isolate Unclassified
171 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
172 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
173 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
174 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.22
Metatranscriptomes 0.69
Isolates 2.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.69
Rhizoplane 2.43
Rhizosphere 93.75
Stem 0
Stem Tuber 0
Unclassified 2.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0141941 3300049571 Bacteria 2381
2 Ga0070666_10204432 3300005335 Bacteria 1390
3 Ga0070682_100148009 3300005337 Unclassified 1608
4 Ga0068868_100047584 3300005338 Bacteria 3362
5 Ga0070660_100584885 3300005339 Bacteria 933
6 Ga0070691_10040958 3300005341 Bacteria 2190
7 Ga0070687_100009274 3300005343 Bacteria 4210
8 Ga0070692_10003809 3300005345 Bacteria 6202
9 Ga0070674_100128741 3300005356 Bacteria 1884
10 Ga0070688_100400047 3300005365 Bacteria 1016
11 Ga0070659_100010620 3300005366 Bacteria 6781
12 Ga0070659_100104309 3300005366 Bacteria 2284
13 Ga0070659_100706826 3300005366 Bacteria 872
14 Ga0070701_10000414 3300005438 Bacteria 14503
15 Ga0070705_100032069 3300005440 Bacteria 2916
16 Ga0070700_100001742 3300005441 Bacteria 10936
17 Ga0070694_100118211 3300005444 Bacteria 1898
18 Ga0070663_100151216 3300005455 Bacteria 1780
19 Ga0070678_100077341 3300005456 Bacteria 2510
20 Ga0070662_100018678 3300005457 Bacteria 4694
21 Ga0068867_100009005 3300005459 Bacteria 7042
22 Ga0068853_100664062 3300005539 Bacteria 993
23 Ga0070686_100001562 3300005544 Bacteria 12863
24 Ga0070686_100160853 3300005544 Bacteria 1581
25 Ga0070695_100620014 3300005545 Bacteria 851
26 Ga0070696_100041361 3300005546 Bacteria 3184
27 Ga0070693_100004733 3300005547 Bacteria 6472
28 Ga0070693_100068439 3300005547 Bacteria 2084
29 Ga0068854_100059379 3300005578 Bacteria 2764
30 Ga0070702_100003015 3300005615 Bacteria 7446
31 Ga0070702_100003721 3300005615 Bacteria 6878
32 Ga0068852_100862961 3300005616 Bacteria 921
33 Ga0068859_100148029 3300005617 Bacteria 2423
34 Ga0068866_10002813 3300005718 Bacteria 7167
35 Ga0068861_100007174 3300005719 Bacteria 7629
36 Ga0068861_100044195 3300005719 Bacteria 3348
37 Ga0068863_100237479 3300005841 Bacteria 1759
38 Ga0068858_100001423 3300005842 Bacteria 24619
39 Ga0068860_100357496 3300005843 Bacteria 1438
40 Ga0068860_100377189 3300005843 Bacteria 1400
41 Ga0068860_100382425 3300005843 Bacteria 1390
42 Ga0068862_100341873 3300005844 Bacteria 1386
43 Ga0097621_100000834 3300006237 Bacteria 21739
44 Ga0097621_100020124 3300006237 Bacteria 5139
45 Ga0068871_100009584 3300006358 Bacteria 7029
46 Ga0068871_100611918 3300006358 Bacteria 991
47 Ga0075431_100225460 3300006847 Bacteria 1911
48 Ga0068865_100001024 3300006881 Bacteria 16091
49 Ga0068865_100078283 3300006881 Bacteria 2365
50 Ga0097620_100148030 3300006931 Bacteria 2423
51 Ga0097620_100377542 3300006931 Bacteria 1513
52 Ga0111539_10283937 3300009094 Bacteria 1926
53 Ga0111539_10843992 3300009094 Bacteria 1066
54 Ga0105245_10018918 3300009098 Bacteria 6028
55 Ga0105245_10168095 3300009098 Bacteria 2086
56 Ga0105243_10000390 3300009148 Bacteria 46725
57 Ga0105243_10160039 3300009148 Bacteria 1940
58 Ga0105242_10001878 3300009176 Bacteria 16512
59 Ga0105248_10085361 3300009177 Bacteria 3552
60 Ga0105248_11685861 3300009177 Bacteria 718
61 Ga0105237_10400878 3300009545 Bacteria 1376
62 Ga0105249_10103619 3300009553 Bacteria 2680
63 Ga0105249_11393520 3300009553 Bacteria 773
64 Ga0105033_106764 3300009986 Bacteria 993
65 Ga0105246_10214995 3300011119 Bacteria 1503
66 Ga0105246_11065967 3300011119 Bacteria 736
67 Ga0157373_10244479 3300013100 Bacteria 1269
68 Ga0157370_10037008 3300013104 Bacteria 4734
69 Ga0157378_10000691 3300013297 Bacteria 31706
70 Ga0157378_10006213 3300013297 Bacteria 10456
71 Ga0163162_10014841 3300013306 Bacteria 7607
72 Ga0163162_10051168 3300013306 Bacteria 4144
73 Ga0157375_10083633 3300013308 Bacteria 3237
74 Ga0157380_10107075 3300014326 Bacteria 2341
75 Ga0157380_10584885 3300014326 Bacteria 1102
76 Ga0157380_11356809 3300014326 Bacteria 760
77 Ga0157379_10006875 3300014968 Bacteria 9835
78 Ga0157376_10004737 3300014969 Bacteria 9472
79 Ga0157376_10454032 3300014969 Bacteria 1251
80 Ga0207642_10002733 3300025899 Bacteria 5509
81 Ga0207642_10046684 3300025899 Bacteria 1931
82 Ga0207645_10125265 3300025907 Bacteria 1669
83 Ga0207652_11300777 3300025921 Bacteria 630
84 Ga0207687_10000799 3300025927 Bacteria 21252
85 Ga0207687_10024520 3300025927 Bacteria 4031
86 Ga0207664_10011625 3300025929 Bacteria 6269
87 Ga0207706_10011361 3300025933 Bacteria 8114
88 Ga0207706_10228562 3300025933 Bacteria 1628
89 Ga0207706_10288304 3300025933 Bacteria 1431
90 Ga0207686_10001597 3300025934 Bacteria 12708
91 Ga0207686_10004014 3300025934 Bacteria 7899
92 Ga0207709_10016833 3300025935 Bacteria 4073
93 Ga0207709_10130884 3300025935 Bacteria 1710
94 Ga0207669_10078676 3300025937 Bacteria 2102
95 Ga0207669_10146925 3300025937 Bacteria 1645
96 Ga0207704_10001868 3300025938 Bacteria 9435
97 Ga0207711_10068287 3300025941 Bacteria 3078
98 Ga0207711_11508742 3300025941 Bacteria 615
99 Ga0207689_10000558 3300025942 Bacteria 35566
100 Ga0207689_10080965 3300025942 Bacteria 2669
101 Ga0207712_10143003 3300025961 Bacteria 1838
102 Ga0207640_10013837 3300025981 Bacteria 4632
103 Ga0207677_10035772 3300026023 Bacteria 3229
104 Ga0207702_10144193 3300026078 Bacteria 2159
105 Ga0207702_10648919 3300026078 Bacteria 1038
106 Ga0207648_10000159 3300026089 Bacteria 69221
107 Ga0207648_10506956 3300026089 Bacteria 1105
108 Ga0207675_100000068 3300026118 Bacteria 78105
109 Ga0207675_100064708 3300026118 Bacteria 3418
110 Ga0207683_10000169 3300026121 Bacteria 56227
111 Ga0207683_10193455 3300026121 Bacteria 1847
112 Ga0207698_10744249 3300026142 Bacteria 979
113 Ga0207428_10072362 3300027907 Bacteria 2706
114 Ga0268265_10051290 3300028380 Bacteria 3114
115 Ga0268264_10162777 3300028381 Bacteria 2011
116 Ga0268264_10399075 3300028381 Bacteria 1321
117 Ga0265338_10137120 3300028800 Bacteria 1922
118 Ga0265324_10000018 3300029957 Bacteria 184238
119 Ga0265324_10000519 3300029957 Bacteria 26474
120 Ga0265332_10000010 3300031238 Bacteria 289041
121 Ga0265325_10000359 3300031241 Bacteria 32086
122 Ga0265325_10050083 3300031241 Bacteria 2152
123 Ga0265331_10000187 3300031250 Bacteria 75938
124 Ga0265327_10009990 3300031251 Bacteria 6754
125 Ga0265316_10069597 3300031344 Bacteria 2716
126 Ga0265316_10419452 3300031344 Bacteria 962
127 Ga0316575_10290619 3300031665 Bacteria 690
128 Ga0316579_10034964 3300031691 Bacteria 2315
129 Ga0316579_10037426 3300031691 Bacteria 2241
130 Ga0265314_10000583 3300031711 Bacteria 45907
131 Ga0265314_10005039 3300031711 Bacteria 12037
132 Ga0316576_10050292 3300031727 Bacteria 3031
133 Ga0316576_10625419 3300031727 Bacteria 784
134 Ga0316578_10070764 3300031728 Bacteria 2065
135 Ga0316578_10109548 3300031728 Bacteria 1658
136 Ga0307410_11191391 3300031852 Bacteria 663
137 Ga0307412_10150524 3300031911 Bacteria 1716
138 Ga0307416_100857899 3300032002 Bacteria 1006
139 Ga0307411_10023122 3300032005 Bacteria 3675
140 Ga0307411_10066193 3300032005 Unclassified 2427
141 Ga0316583_10012088 3300032133 Bacteria 3115
142 Ga0316585_10015852 3300032137 Bacteria 2264
143 Ga0316580_10064483 3300032139 Bacteria 1124
144 Ga0316593_10040272 3300032168 Bacteria 1552
145 Ga0316593_10133139 3300032168 Bacteria 898
146 Ga0373954_0000993 3300035118 Bacteria 11173
147 Ga0316574_0027974 3300035398 Bacteria 3397
148 Ga0316574_0107670 3300035398 Bacteria 1786
149 Ga0316574_0323293 3300035398 Bacteria 979
150 Ga0316582_0007606 3300036647 Bacteria 5776
151 Ga0316582_0016804 3300036647 Bacteria 4218
152 Ga0316582_0157987 3300036647 Bacteria 1535
153 Ga0316582_0524190 3300036647 Bacteria 816
154 Ga0316584_0011606 3300036712 Bacteria 6196
155 Ga0316584_0027290 3300036712 Bacteria 4202
156 Ga0316584_0160534 3300036712 Bacteria 1670
157 Ga0400490_27043 3300038726 Bacteria 22747
158 Ga0400491_13511 3300038727 Bacteria 5143
159 Ga0400483_056405 3300039062 Bacteria 2340
160 Ga0400483_234432 3300039062 Bacteria 2113
161 Ga0400489_24562 3300039093 Bacteria 1806
162 Ga0400487_51369 3300039110 Bacteria 98129
163 Ga0436360_1328506 3300039438 Bacteria 1506
164 Ga0436361_0622987 3300039447 Bacteria 42920
165 Ga0436361_1102247 3300039447 Bacteria 1820
166 Ga0436362_0872414 3300039453 Bacteria 832
167 Ga0439449_0007459 3300042007 Bacteria 4158
168 Ga0451577_0000501 3300042876 Bacteria 65919
169 Ga0451577_0003671 3300042876 Bacteria 16814
170 Ga0451577_0181920 3300042876 Bacteria 1895
171 Ga0453683_0029454 3300044673 Bacteria 3471
172 Ga0453684_0000040 3300044712 Bacteria 690210
173 Ga0453684_0000716 3300044712 Bacteria 117287
174 Ga0453684_0001669 3300044712 Bacteria 60118
175 Ga0453684_0004098 3300044712 Bacteria 31613
176 Ga0451576_0000936 3300045051 Bacteria 55015
177 Ga0451576_0002074 3300045051 Bacteria 31365
178 Ga0451576_0007845 3300045051 Bacteria 12650
179 Ga0495621_0006383 3300046539 Bacteria 3440
180 Ga0495588_0223905 3300046674 Bacteria 993
181 Ga0495599_0106404 3300046678 Bacteria 1748
182 Ga0495687_000685 3300047443 Bacteria 38430
183 Ga0496106_0153892 3300048909 Bacteria 1815
184 Ga0496108_0472589 3300048911 Bacteria 1095
185 Ga0496109_0138347 3300048912 Bacteria 2277
186 Ga0496110_0041157 3300048913 Bacteria 4031
187 Ga0496112_0767169 3300048915 Bacteria 890
188 Ga0496113_0211756 3300048916 Bacteria 1543
189 Ga0496114_0818499 3300048917 Bacteria 810
190 Ga0501294_004674 3300049517 Bacteria 1291
191 Ga0501295_018805 3300049518 Bacteria 1232
192 Ga0501298_044913 3300049521 Bacteria 903
193 Ga0501031_0031561 3300049568 Bacteria 3455
194 Ga0501031_0043406 3300049568 Bacteria 2934
195 Ga0501031_0081414 3300049568 Bacteria 2111
196 Ga0501031_0191487 3300049568 Bacteria 1335
197 Ga0501032_0002393 3300049569 Bacteria 14623
198 Ga0501032_0004647 3300049569 Bacteria 10317
199 Ga0501032_0295616 3300049569 Bacteria 1047
200 Ga0501032_0397191 3300049569 Bacteria 886
201 Ga0501033_0003230 3300049570 Bacteria 13484
202 Ga0501033_0013653 3300049570 Bacteria 6182
203 Ga0501033_0191818 3300049570 Bacteria 1462
204 Ga0501034_0015694 3300049571 Bacteria 7780
205 Ga0501034_0032912 3300049571 Bacteria 5264
206 Ga0501034_0214432 3300049571 Bacteria 1879
207 Ga0501036_0098442 3300049572 Bacteria 2472
208 Ga0501036_0177763 3300049572 Bacteria 1792
209 Ga0501036_0272059 3300049572 Bacteria 1418
210 Ga0501036_0656281 3300049572 Bacteria 868
211 Ga0501037_0055999 3300049573 Bacteria 2882
212 Ga0501037_0357497 3300049573 Bacteria 1006
213 Ga0501038_0013089 3300049574 Bacteria 7568
214 Ga0501038_0035607 3300049574 Bacteria 4369
215 Ga0501038_0047008 3300049574 Bacteria 3740
216 Ga0501038_0234447 3300049574 Bacteria 1459
217 Ga0501038_0452213 3300049574 Bacteria 987
218 Ga0501038_0453621 3300049574 Bacteria 985
219 Ga0501038_0466430 3300049574 Bacteria 969
220 Ga0501039_0007336 3300049575 Bacteria 8401
221 Ga0501039_0096367 3300049575 Bacteria 2306
222 Ga0501039_0338076 3300049575 Bacteria 1183
223 Ga0501039_0898454 3300049575 Bacteria 690
224 Ga0501039_0914552 3300049575 Bacteria 683
225 Ga0501040_0004292 3300049576 Bacteria 9260
226 Ga0501041_0404723 3300049577 Bacteria 865
227 Ga0501042_0002512 3300049578 Bacteria 11297
228 Ga0501043_0018143 3300049579 Bacteria 5516
229 Ga0501043_0030751 3300049579 Bacteria 4222
230 Ga0501043_0062317 3300049579 Unclassified 2928
231 Ga0501043_0129728 3300049579 Bacteria 1976
232 Ga0501043_0294815 3300049579 Bacteria 1241
233 Ga0501046_0005898 3300049580 Bacteria 10921
234 Ga0501046_0010092 3300049580 Bacteria 8128
235 Ga0501046_0021673 3300049580 Bacteria 5301
236 Ga0501046_0093137 3300049580 Bacteria 2316
237 Ga0501048_0314817 3300049582 Unclassified 1114
238 Ga0501067_0073011 3300049583 Bacteria 1901
239 Ga0501068_0005085 3300049584 Bacteria 7172
240 Ga0501068_0434724 3300049584 Unclassified 848
241 Ga0501070_0056224 3300049586 Bacteria 3262
242 Ga0501070_0487711 3300049586 Unclassified 991
243 Ga0501071_0017582 3300049587 Bacteria 4935
244 Ga0501072_0086702 3300049588 Bacteria 2484
245 Ga0501072_0643984 3300049588 Bacteria 834
246 Ga0501073_0011620 3300049589 Bacteria 6433
247 Ga0501074_0295234 3300049590 Bacteria 1151
248 Ga0501075_0003945 3300049591 Bacteria 9994
249 Ga0501077_0015936 3300049593 Bacteria 4735
250 Ga0501077_0046074 3300049593 Bacteria 2771
251 Ga0501206_002118 3300049653 Bacteria 2506
252 Ga0501079_0005884 3300049741 Bacteria 9177
253 Ga0501079_0056520 3300049741 Bacteria 3028
254 Ga0501080_0146681 3300049742 Bacteria 2181
255 Ga0501081_0003596 3300049743 Bacteria 9916
256 Ga0501081_0019802 3300049743 Bacteria 4483
257 Ga0501083_0026367 3300049744 Bacteria 4016
258 Ga0501083_0075756 3300049744 Bacteria 2234
259 Ga0501262_009954 3300049759 Bacteria 1183
260 Ga0501035_0000258 3300049822 Bacteria 63033
261 Ga0501035_0032877 3300049822 Bacteria 4717
262 Ga0501035_0057455 3300049822 Bacteria 3469
263 Ga0501035_0727767 3300049822 Bacteria 798
264 Ga0501035_0875172 3300049822 Bacteria 713
265 Ga0501044_0000186 3300049823 Bacteria 77642
266 Ga0501044_0022421 3300049823 Bacteria 6729
267 Ga0501044_0026168 3300049823 Bacteria 6178
268 Ga0501044_0129445 3300049823 Bacteria 2519
269 Ga0501044_0340706 3300049823 Bacteria 1420
270 Ga0501045_0001846 3300049824 Bacteria 14316
271 Ga0501045_0161420 3300049824 Bacteria 1668
272 nmdc:mga08y16_41443_c1 3300050511 Unclassified 4823
273 nmdc:mga0n895_919419_c1 3300050512 Bacteria 859
274 nmdc:mga0rr50_256010_c1 3300050513 Bacteria 1455
275 nmdc:mga0a205_90740_c1 3300050515 Bacteria 2952
276 Ga0501084_0040137 3300054114 Bacteria 3915
277 Ga0501084_0046292 3300054114 Bacteria 3643
278 Ga0501084_0201008 3300054114 Bacteria 1681
279 Ga0501082_0034689 3300060353 Bacteria 4349
280 Ga0501082_0294257 3300060353 Bacteria 1414
281 Ga0501082_0424992 3300060353 Bacteria 1160
282 Ga0530510_0008580 3300061734 Bacteria 7138
283 2526211425 2526164512 Bacteria 4025691
284 2548847668 2547132512 Bacteria 3416496
285 2753463773 2751185821 Bacteria 6189929
286 2792643784 2791355094 Bacteria 7011481
287 2889917720 2889914905 Bacteria 5702301
288 8016587730 8016583857 Bacteria 10421953
289 Ga0501034_0141941
290 Ga0070666_10204432
291 Ga0070682_100148009
292 Ga0068868_100047584
293 Ga0070660_100584885
294 Ga0070691_10040958
295 Ga0070687_100009274
296 Ga0070692_10003809
297 Ga0070674_100128741
298 Ga0070688_100400047
299 Ga0070659_100010620
300 Ga0070659_100104309
301 Ga0070659_100706826
302 Ga0070701_10000414
303 Ga0070705_100032069
304 Ga0070700_100001742
305 Ga0070694_100118211
306 Ga0070663_100151216
307 Ga0070678_100077341
308 Ga0070662_100018678
309 Ga0068867_100009005
310 Ga0068853_100664062
311 Ga0070686_100001562
312 Ga0070686_100160853
313 Ga0070695_100620014
314 Ga0070696_100041361
315 Ga0070693_100004733
316 Ga0070693_100068439
317 Ga0068854_100059379
318 Ga0070702_100003015
319 Ga0070702_100003721
320 Ga0068852_100862961
321 Ga0068859_100148029
322 Ga0068866_10002813
323 Ga0068861_100007174
324 Ga0068861_100044195
325 Ga0068863_100237479
326 Ga0068858_100001423
327 Ga0068860_100357496
328 Ga0068860_100377189
329 Ga0068860_100382425
330 Ga0068862_100341873
331 Ga0097621_100000834
332 Ga0097621_100020124
333 Ga0068871_100009584
334 Ga0068871_100611918
335 Ga0075431_100225460
336 Ga0068865_100001024
337 Ga0068865_100078283
338 Ga0097620_100148030
339 Ga0097620_100377542
340 Ga0111539_10283937
341 Ga0111539_10843992
342 Ga0105245_10018918
343 Ga0105245_10168095
344 Ga0105243_10000390
345 Ga0105243_10160039
346 Ga0105242_10001878
347 Ga0105248_10085361
348 Ga0105248_11685861
349 Ga0105237_10400878
350 Ga0105249_10103619
351 Ga0105249_11393520
352 Ga0105033_106764
353 Ga0105246_10214995
354 Ga0105246_11065967
355 Ga0157373_10244479
356 Ga0157370_10037008
357 Ga0157378_10000691
358 Ga0157378_10006213
359 Ga0163162_10014841
360 Ga0163162_10051168
361 Ga0157375_10083633
362 Ga0157380_10107075
363 Ga0157380_10584885
364 Ga0157380_11356809
365 Ga0157379_10006875
366 Ga0157376_10004737
367 Ga0157376_10454032
368 Ga0207642_10002733
369 Ga0207642_10046684
370 Ga0207645_10125265
371 Ga0207652_11300777
372 Ga0207687_10000799
373 Ga0207687_10024520
374 Ga0207664_10011625
375 Ga0207706_10011361
376 Ga0207706_10228562
377 Ga0207706_10288304
378 Ga0207686_10001597
379 Ga0207686_10004014
380 Ga0207709_10016833
381 Ga0207709_10130884
382 Ga0207669_10078676
383 Ga0207669_10146925
384 Ga0207704_10001868
385 Ga0207711_10068287
386 Ga0207711_11508742
387 Ga0207689_10000558
388 Ga0207689_10080965
389 Ga0207712_10143003
390 Ga0207640_10013837
391 Ga0207677_10035772
392 Ga0207702_10144193
393 Ga0207702_10648919
394 Ga0207648_10000159
395 Ga0207648_10506956
396 Ga0207675_100000068
397 Ga0207675_100064708
398 Ga0207683_10000169
399 Ga0207683_10193455
400 Ga0207698_10744249
401 Ga0207428_10072362
402 Ga0268265_10051290
403 Ga0268264_10162777
404 Ga0268264_10399075
405 Ga0265338_10137120
406 Ga0265324_10000018
407 Ga0265324_10000519
408 Ga0265332_10000010
409 Ga0265325_10000359
410 Ga0265325_10050083
411 Ga0265331_10000187
412 Ga0265327_10009990
413 Ga0265316_10069597
414 Ga0265316_10419452
415 Ga0316575_10290619
416 Ga0316579_10034964
417 Ga0316579_10037426
418 Ga0265314_10000583
419 Ga0265314_10005039
420 Ga0316576_10050292
421 Ga0316576_10625419
422 Ga0316578_10070764
423 Ga0316578_10109548
424 Ga0307410_11191391
425 Ga0307412_10150524
426 Ga0307416_100857899
427 Ga0307411_10023122
428 Ga0307411_10066193
429 Ga0316583_10012088
430 Ga0316585_10015852
431 Ga0316580_10064483
432 Ga0316593_10040272
433 Ga0316593_10133139
434 Ga0373954_0000993
435 Ga0316574_0027974
436 Ga0316574_0107670
437 Ga0316574_0323293
438 Ga0316582_0007606
439 Ga0316582_0016804
440 Ga0316582_0157987
441 Ga0316582_0524190
442 Ga0316584_0011606
443 Ga0316584_0027290
444 Ga0316584_0160534
445 Ga0400490_27043
446 Ga0400491_13511
447 Ga0400483_056405
448 Ga0400483_234432
449 Ga0400489_24562
450 Ga0400487_51369
451 Ga0436360_1328506
452 Ga0436361_0622987
453 Ga0436361_1102247
454 Ga0436362_0872414
455 Ga0439449_0007459
456 Ga0451577_0000501
457 Ga0451577_0003671
458 Ga0451577_0181920
459 Ga0453683_0029454
460 Ga0453684_0000040
461 Ga0453684_0000716
462 Ga0453684_0001669
463 Ga0453684_0004098
464 Ga0451576_0000936
465 Ga0451576_0002074
466 Ga0451576_0007845
467 Ga0495621_0006383
468 Ga0495588_0223905
469 Ga0495599_0106404
470 Ga0495687_000685
471 Ga0496106_0153892
472 Ga0496108_0472589
473 Ga0496109_0138347
474 Ga0496110_0041157
475 Ga0496112_0767169
476 Ga0496113_0211756
477 Ga0496114_0818499
478 Ga0501294_004674
479 Ga0501295_018805
480 Ga0501298_044913
481 Ga0501031_0031561
482 Ga0501031_0043406
483 Ga0501031_0081414
484 Ga0501031_0191487
485 Ga0501032_0002393
486 Ga0501032_0004647
487 Ga0501032_0295616
488 Ga0501032_0397191
489 Ga0501033_0003230
490 Ga0501033_0013653
491 Ga0501033_0191818
492 Ga0501034_0015694
493 Ga0501034_0032912
494 Ga0501034_0214432
495 Ga0501036_0098442
496 Ga0501036_0177763
497 Ga0501036_0272059
498 Ga0501036_0656281
499 Ga0501037_0055999
500 Ga0501037_0357497
501 Ga0501038_0013089
502 Ga0501038_0035607
503 Ga0501038_0047008
504 Ga0501038_0234447
505 Ga0501038_0452213
506 Ga0501038_0453621
507 Ga0501038_0466430
508 Ga0501039_0007336
509 Ga0501039_0096367
510 Ga0501039_0338076
511 Ga0501039_0898454
512 Ga0501039_0914552
513 Ga0501040_0004292
514 Ga0501041_0404723
515 Ga0501042_0002512
516 Ga0501043_0018143
517 Ga0501043_0030751
518 Ga0501043_0062317
519 Ga0501043_0129728
520 Ga0501043_0294815
521 Ga0501046_0005898
522 Ga0501046_0010092
523 Ga0501046_0021673
524 Ga0501046_0093137
525 Ga0501048_0314817
526 Ga0501067_0073011
527 Ga0501068_0005085
528 Ga0501068_0434724
529 Ga0501070_0056224
530 Ga0501070_0487711
531 Ga0501071_0017582
532 Ga0501072_0086702
533 Ga0501072_0643984
534 Ga0501073_0011620
535 Ga0501074_0295234
536 Ga0501075_0003945
537 Ga0501077_0015936
538 Ga0501077_0046074
539 Ga0501206_002118
540 Ga0501079_0005884
541 Ga0501079_0056520
542 Ga0501080_0146681
543 Ga0501081_0003596
544 Ga0501081_0019802
545 Ga0501083_0026367
546 Ga0501083_0075756
547 Ga0501262_009954
548 Ga0501035_0000258
549 Ga0501035_0032877
550 Ga0501035_0057455
551 Ga0501035_0727767
552 Ga0501035_0875172
553 Ga0501044_0000186
554 Ga0501044_0022421
555 Ga0501044_0026168
556 Ga0501044_0129445
557 Ga0501044_0340706
558 Ga0501045_0001846
559 Ga0501045_0161420
560 nmdc:mga08y16_41443_c1
561 nmdc:mga0n895_919419_c1
562 nmdc:mga0rr50_256010_c1
563 nmdc:mga0a205_90740_c1
564 Ga0501084_0040137
565 Ga0501084_0046292
566 Ga0501084_0201008
567 Ga0501082_0034689
568 Ga0501082_0294257
569 Ga0501082_0424992
570 Ga0530510_0008580
571 2526211425
572 2548847668
573 2753463773
574 2792643784
575 2889917720
576 8016587730

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

38

166

0.89

PF08534

Redoxin

Redoxin

38

177

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u5r-assembly1.cif.gz_E crystal structure of a hypothetical protein smc02350 from sinorhizobium meliloti 1021 0.9123 2 183
2ywi-assembly2.cif.gz_B crystal structure of uncharacterized conserved protein from geobacillus kaustophilus 0.9062 1 183
2ywi-assembly2.cif.gz_B crystal structure of uncharacterized conserved protein from geobacillus kaustophilus 0.9015 1 183
2cvb-assembly1.cif.gz_A crystal structure of a thioredoxin-like protein from thermus thermophilus hb8 0.8951 3 181
5um7-assembly2.cif.gz_B crystal structure of the reduced state of the thiol-disulfide reductase sdba from streptococcus gordonii 0.8751 11 135
ID Description Score Start End Superfamily
af_I1KAL3_50_244_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9007 1 181 3.40.30.10
2ywoA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.895 3 181 3.40.30.10
af_P71990_1_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8878 1 181 3.40.30.10
af_I1KAL3_50_244_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8865 1 181 3.40.30.10
af_P71990_1_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8785 1 181 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A530QHJ9-F1-model_v4 Thioredoxin family protein 0.9988 31 135 GO:0016209
GO:0016491
AF-A0A537G179-F1-model_v4 Thioredoxin family protein 0.9977 12 182 GO:0016209
GO:0016491
AF-A0A516SET8-F1-model_v4 Thioredoxin family protein 0.9976 1 183 GO:0016209
GO:0016491
AF-A0A661EN42-F1-model_v4 Thioredoxin family protein 0.9976 43 183 GO:0016209
GO:0016491
AF-A0A1G5SGT6-F1-model_v4 Redoxin domain protein 0.9971 1 183 GO:0016209
GO:0016491

Map