F388630

General Info

Members Datasets Scaffolds Average Seq Length
288 192 283 204

Family's Representative Sequence

Representative Sequence 3300025937|Ga0207669_10055588|Ga0207669_100555883
Length 178
Sequence MVGKLFVVAALMFSFGYALVPIYRSICSALGVNVLSLSEQGIPGATSSIKPNTQVDLARTVTVEFDANARGVWEFKPATSSLQVHPGEMTTVMYEFRNSQPRTLAAQAIPSYAPKQALPYFHKLECFCFREYTLQAGESKQWPVVFVIDPKMPKDIKTITLSYTFFEVGGKIPAAPQS

Samples

Sample ID Description Type Environment
1 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
2 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
3 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
4 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
110 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
114 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
115 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
116 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
117 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
118 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
119 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
120 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
121 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
122 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
129 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
130 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
131 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
132 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
133 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
134 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
137 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
138 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
139 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
140 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
141 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
142 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
143 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
144 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
145 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
146 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
147 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
157 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
158 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
159 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
160 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
161 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
172 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
177 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
178 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
179 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
187 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
188 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
189 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
192 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.61
Metatranscriptomes 0
Isolates 1.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25
Nodule 0
Rhizoplane 1.04
Rhizosphere 65.62
Stem 0
Stem Tuber 0
Unclassified 8.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10036704 3300003316 Bacteria 1438
2 rootL2_10014091 3300003322 Bacteria 1360
3 Ga0055534_1004816 3300003784 Bacteria 3787
4 Ga0070670_100161802 3300005331 Bacteria 1940
5 Ga0070670_100736486 3300005331 Bacteria 888
6 Ga0070677_10152164 3300005333 Bacteria 1078
7 Ga0068869_100076606 3300005334 Bacteria 2486
8 Ga0070666_10704224 3300005335 Bacteria 741
9 Ga0068868_100031382 3300005338 Bacteria 4081
10 Ga0068868_100238822 3300005338 Bacteria 1526
11 Ga0070660_100195911 3300005339 Bacteria 1638
12 Ga0070669_100065800 3300005353 Bacteria 2670
13 Ga0070675_100026794 3300005354 Bacteria 4626
14 Ga0070675_100075717 3300005354 Bacteria 2798
15 Ga0070671_100022927 3300005355 Bacteria 5102
16 Ga0070671_100032504 3300005355 Bacteria 4313
17 Ga0070674_100147377 3300005356 Bacteria 1773
18 Ga0070674_100342428 3300005356 Bacteria 1205
19 Ga0070673_100057388 3300005364 Bacteria 3076
20 Ga0070673_100074896 3300005364 Bacteria 2729
21 Ga0070667_100000849 3300005367 Bacteria 28386
22 Ga0070667_100482425 3300005367 Bacteria 1135
23 Ga0070708_100457523 3300005445 Bacteria 1204
24 Ga0070678_100120148 3300005456 Bacteria 2071
25 Ga0070662_100035242 3300005457 Bacteria 3533
26 Ga0070662_100394636 3300005457 Bacteria 1141
27 Ga0070662_100434591 3300005457 Bacteria 1087
28 Ga0070681_10742049 3300005458 Bacteria 898
29 Ga0068867_100441640 3300005459 Bacteria 1106
30 Ga0070706_100135767 3300005467 Bacteria 2296
31 Ga0070707_100007656 3300005468 Bacteria 10028
32 Ga0070698_100217278 3300005471 Bacteria 1846
33 Ga0070699_101060953 3300005518 Bacteria 743
34 Ga0070672_100045399 3300005543 Bacteria 3398
35 Ga0070665_100015847 3300005548 Bacteria 7567
36 Ga0070665_100529000 3300005548 Bacteria 1191
37 Ga0068857_100006256 3300005577 Bacteria 10181
38 Ga0068857_100276548 3300005577 Bacteria 1544
39 Ga0068857_100473080 3300005577 Bacteria 1174
40 Ga0068854_100088737 3300005578 Bacteria 2296
41 Ga0068856_100449837 3300005614 Bacteria 1309
42 Ga0068859_100292956 3300005617 Bacteria 1720
43 Ga0068864_100216749 3300005618 Bacteria 1764
44 Ga0068863_100057481 3300005841 Bacteria 3681
45 Ga0068863_100708363 3300005841 Bacteria 1001
46 Ga0068858_100604392 3300005842 Bacteria 1064
47 Ga0068860_100206781 3300005843 Bacteria 1904
48 Ga0068860_100217301 3300005843 Bacteria 1855
49 Ga0075365_10085342 3300006038 Bacteria 2144
50 Ga0075368_10064428 3300006042 Bacteria 1471
51 Ga0075363_100010995 3300006048 Bacteria 4320
52 Ga0075363_100081544 3300006048 Bacteria 1770
53 Ga0075363_100540295 3300006048 Bacteria 695
54 Ga0075364_10086015 3300006051 Bacteria 2082
55 Ga0075364_10132666 3300006051 Bacteria 1672
56 Ga0075364_10186930 3300006051 Bacteria 1403
57 Ga0075364_10560764 3300006051 Bacteria 781
58 Ga0075362_10031183 3300006177 Bacteria 2306
59 Ga0075367_10006801 3300006178 Bacteria 5809
60 Ga0075367_10064695 3300006178 Bacteria 2188
61 Ga0075367_10385674 3300006178 Bacteria 885
62 Ga0075369_10019440 3300006186 Bacteria 2773
63 Ga0075369_10080316 3300006186 Bacteria 1446
64 Ga0075369_10173978 3300006186 Bacteria 989
65 Ga0075366_10002896 3300006195 Bacteria 8909
66 Ga0075366_10040158 3300006195 Bacteria 2767
67 Ga0075366_10052045 3300006195 Bacteria 2433
68 Ga0075366_10102003 3300006195 Bacteria 1722
69 Ga0075366_10130191 3300006195 Bacteria 1518
70 Ga0075366_10376523 3300006195 Bacteria 873
71 Ga0075366_10420153 3300006195 Bacteria 824
72 Ga0097621_100294142 3300006237 Bacteria 1433
73 Ga0075370_10003402 3300006353 Bacteria 7564
74 Ga0075370_10020265 3300006353 Bacteria 3633
75 Ga0075370_10031870 3300006353 Bacteria 2944
76 Ga0075370_10096275 3300006353 Bacteria 1710
77 Ga0075370_10142117 3300006353 Bacteria 1403
78 Ga0097620_100292949 3300006931 Bacteria 1720
79 Ga0105245_10259217 3300009098 Bacteria 1692
80 Ga0105247_10347159 3300009101 Bacteria 1043
81 Ga0105241_10188932 3300009174 Bacteria 1714
82 Ga0105241_10218303 3300009174 Bacteria 1601
83 Ga0105241_11090679 3300009174 Bacteria 751
84 Ga0105248_10652537 3300009177 Bacteria 1187
85 Ga0105237_10026456 3300009545 Bacteria 5930
86 Ga0105238_10922108 3300009551 Bacteria 892
87 Ga0105249_10131900 3300009553 Bacteria 2386
88 Ga0105239_10165522 3300010375 Bacteria 2472
89 Ga0105239_10314478 3300010375 Bacteria 1765
90 Ga0105246_10113326 3300011119 Bacteria 1996
91 Ga0105246_10502471 3300011119 Bacteria 1030
92 Ga0157378_10167904 3300013297 Bacteria 2056
93 Ga0157378_10923827 3300013297 Bacteria 904
94 Ga0157375_10159070 3300013308 Bacteria 2400
95 Ga0163163_10381814 3300014325 Bacteria 1466
96 Ga0157380_10124994 3300014326 Bacteria 2185
97 Ga0157376_10036665 3300014969 Bacteria 3974
98 Ga0163161_10170391 3300017792 Bacteria 1664
99 Ga0163161_10328294 3300017792 Bacteria 1211
100 Ga0213872_10006949 3300021361 Bacteria 5624
101 Ga0209673_1021783 3300025273 Bacteria 2231
102 Ga0209673_1061473 3300025273 Bacteria 936
103 Ga0209130_1003855 3300025284 Bacteria 6056
104 Ga0209675_1009058 3300025291 Bacteria 3561
105 Ga0209676_1022171 3300025292 Bacteria 2110
106 Ga0209256_1032560 3300025299 Bacteria 1412
107 Ga0209051_1010699 3300025303 Bacteria 4598
108 Ga0209257_1010069 3300025304 Bacteria 4890
109 Ga0207682_10042471 3300025893 Bacteria 1858
110 Ga0207645_10136557 3300025907 Bacteria 1597
111 Ga0207643_10056377 3300025908 Bacteria 2235
112 Ga0207684_10018036 3300025910 Bacteria 6050
113 Ga0207654_10012244 3300025911 Bacteria 4392
114 Ga0207654_10125864 3300025911 Bacteria 1615
115 Ga0207671_10020453 3300025914 Bacteria 5037
116 Ga0207681_10045033 3300025923 Bacteria 2960
117 Ga0207650_10258255 3300025925 Bacteria 1412
118 Ga0207650_10635553 3300025925 Bacteria 899
119 Ga0207659_10023849 3300025926 Bacteria 4091
120 Ga0207659_10202392 3300025926 Bacteria 1587
121 Ga0207687_10368897 3300025927 Bacteria 1173
122 Ga0207644_10033631 3300025931 Bacteria 3585
123 Ga0207644_10563207 3300025931 Bacteria 944
124 Ga0207706_10004061 3300025933 Bacteria 13836
125 Ga0207706_10056290 3300025933 Bacteria 3468
126 Ga0207706_10287821 3300025933 Bacteria 1432
127 Ga0207669_10055588 3300025937 Bacteria 2398
128 Ga0207669_10277157 3300025937 Bacteria 1263
129 Ga0207704_10215010 3300025938 Bacteria 1418
130 Ga0207691_10061139 3300025940 Bacteria 3422
131 Ga0207689_10397926 3300025942 Bacteria 1148
132 Ga0207667_10137410 3300025949 Bacteria 2517
133 Ga0207651_10088441 3300025960 Bacteria 2258
134 Ga0207712_10129949 3300025961 Bacteria 1918
135 Ga0207668_10103233 3300025972 Bacteria 2123
136 Ga0207658_10000968 3300025986 Bacteria 23705
137 Ga0207658_10284933 3300025986 Bacteria 1418
138 Ga0207677_10022994 3300026023 Bacteria 3841
139 Ga0207677_10066199 3300026023 Bacteria 2525
140 Ga0207677_10094389 3300026023 Bacteria 2184
141 Ga0207677_10408008 3300026023 Bacteria 1154
142 Ga0207641_10105723 3300026088 Bacteria 2486
143 Ga0207648_10007326 3300026089 Bacteria 10868
144 Ga0207648_10305735 3300026089 Bacteria 1427
145 Ga0207676_10046391 3300026095 Bacteria 3362
146 Ga0207674_10041528 3300026116 Bacteria 4756
147 Ga0207674_10127087 3300026116 Bacteria 2515
148 Ga0207674_10137753 3300026116 Bacteria 2402
149 Ga0207674_10597104 3300026116 Bacteria 1066
150 Ga0207675_100363134 3300026118 Bacteria 1421
151 Ga0207683_10234558 3300026121 Bacteria 1673
152 Ga0207698_10281107 3300026142 Bacteria 1539
153 Ga0268266_10015567 3300028379 Bacteria 6521
154 Ga0268266_10637052 3300028379 Bacteria 1025
155 Ga0268264_10291478 3300028381 Bacteria 1533
156 Ga0268264_10758023 3300028381 Bacteria 967
157 Ga0307517_10170927 3300028786 Bacteria 1429
158 Ga0307515_10038558 3300028794 Bacteria 7637
159 Ga0307515_10050900 3300028794 Bacteria 6190
160 Ga0307515_10106481 3300028794 Bacteria 3326
161 Ga0307513_10161899 3300031456 Bacteria 2129
162 Ga0307509_10201271 3300031507 Bacteria 1828
163 Ga0307509_10391914 3300031507 Bacteria 1098
164 Ga0307408_100205539 3300031548 Bacteria 1597
165 Ga0307514_10047634 3300031649 Bacteria 3345
166 Ga0307516_10025523 3300031730 Bacteria 6016
167 Ga0307516_10145775 3300031730 Bacteria 2133
168 Ga0307516_10436849 3300031730 Bacteria 966
169 Ga0307412_10198827 3300031911 Bacteria 1521
170 Ga0307412_10501186 3300031911 Bacteria 1011
171 Ga0307412_10676649 3300031911 Bacteria 883
172 Ga0307416_101079668 3300032002 Bacteria 907
173 Ga0307507_10144590 3300033179 Bacteria 1810
174 Ga0307510_10067163 3300033180 Bacteria 3612
175 Ga0307510_10135657 3300033180 Bacteria 2119
176 Ga0373948_0009909 3300034817 Bacteria 1653
177 Ga0373950_0053631 3300034818 Bacteria 796
178 Ga0373949_0164253 3300035090 Bacteria 649
179 Ga0373951_0018243 3300035091 Bacteria 1593
180 Ga0373932_0005873 3300035112 Bacteria 2891
181 Ga0373939_0000820 3300035114 Bacteria 7682
182 Ga0373960_0000664 3300035121 Bacteria 7081
183 Ga0373960_0121165 3300035121 Bacteria 868
184 Ga0373962_0116696 3300035242 Bacteria 847
185 Ga0373931_0000400 3300035691 Bacteria 17756
186 Ga0373931_0072407 3300035691 Bacteria 1884
187 Ga0373927_0359966 3300035695 Bacteria 959
188 Ga0373925_0066461 3300037068 Bacteria 2718
189 Ga0395905_0000071 3300037471 Bacteria 174580
190 Ga0436361_0334210 3300039447 Bacteria 17596
191 Ga0439436_0006509 3300041404 Bacteria 3585
192 Ga0439461_0008859 3300041410 Bacteria 1814
193 Ga0439466_0030929 3300041411 Bacteria 1833
194 Ga0439465_0000677 3300041413 Bacteria 10423
195 Ga0439465_0114067 3300041413 Bacteria 943
196 Ga0451807_1230910 3300041486 Bacteria 1316
197 Ga0451851_0950883 3300041507 Bacteria 1006
198 Ga0451843_0154138 3300041509 Bacteria 610
199 Ga0451853_1029036 3300041512 Bacteria 1427
200 Ga0451853_3952381 3300041512 Bacteria 1099
201 Ga0439431_0012935 3300041997 Bacteria 1922
202 Ga0439433_0000297 3300041999 Bacteria 8590
203 Ga0439432_000674 3300042006 Bacteria 12782
204 Ga0439449_0004068 3300042007 Bacteria 5660
205 Ga0439455_0029709 3300042012 Bacteria 1352
206 Ga0439457_011672 3300042014 Bacteria 1992
207 Ga0439462_0006984 3300042015 Bacteria 2819
208 Ga0439446_0027186 3300042156 Bacteria 1641
209 Ga0439434_0006337 3300042435 Bacteria 3450
210 Ga0439459_0049783 3300042438 Bacteria 916
211 Ga0466972_0000828 3300044658 Bacteria 14809
212 Ga0466965_0052829 3300044683 Bacteria 2019
213 Ga0466966_0337555 3300044684 Bacteria 905
214 Ga0466961_0048056 3300044693 Bacteria 2727
215 Ga0466964_0017252 3300044706 Bacteria 2763
216 Ga0466964_0218956 3300044706 Bacteria 923
217 Ga0453684_0134527 3300044712 Bacteria 2962
218 Ga0466971_0005612 3300044719 Bacteria 5456
219 Ga0466957_0124533 3300044842 Bacteria 1646
220 Ga0466959_0012248 3300045049 Bacteria 6189
221 Ga0451576_0006110 3300045051 Bacteria 14839
222 Ga0451576_0167234 3300045051 Bacteria 2295
223 Ga0495590_0027037 3300046457 Bacteria 2014
224 Ga0495650_0087464 3300046471 Bacteria 1191
225 Ga0495605_0162870 3300046474 Bacteria 989
226 Ga0495583_0058798 3300046506 Bacteria 1725
227 Ga0495610_0162346 3300046512 Bacteria 943
228 Ga0495632_0079150 3300046519 Bacteria 1569
229 Ga0495643_0109876 3300046522 Bacteria 1403
230 Ga0495666_0216814 3300046526 Bacteria 877
231 Ga0495621_0092295 3300046539 Bacteria 1142
232 Ga0495597_0066742 3300046542 Bacteria 1558
233 Ga0495597_0111863 3300046542 Bacteria 1144
234 Ga0495611_0147396 3300046648 Bacteria 1099
235 Ga0495625_0248465 3300046660 Bacteria 1155
236 Ga0495659_0102851 3300046664 Bacteria 1108
237 Ga0495624_0174588 3300046690 Bacteria 1310
238 Ga0495649_0002161 3300046694 Bacteria 14071
239 Ga0495687_001027 3300047443 Bacteria 27802
240 Ga0495687_012737 3300047443 Bacteria 4430
241 Ga0495679_073335 3300047446 Bacteria 982
242 Ga0496102_0001594 3300048905 Bacteria 20010
243 Ga0496102_1256820 3300048905 Bacteria 660
244 Ga0496122_0142706 3300048925 Bacteria 1495
245 Ga0501034_0258741 3300049571 Bacteria 1684
246 Ga0501198_000001 3300049649 Bacteria 234552
247 Ga0501222_000004 3300049662 Bacteria 136139
248 nmdc:mga03683_41214_c1 3300050489 Bacteria 1896
249 nmdc:mga03683_9751_c1 3300050489 Bacteria 2301
250 nmdc:mga03n38_117295_c1 3300050490 Bacteria 1304
251 nmdc:mga03n38_192775_c1 3300050490 Bacteria 1051
252 nmdc:mga00v17_163685_c1 3300050491 Bacteria 1433
253 nmdc:mga00v17_588910_c1 3300050491 Bacteria 718
254 nmdc:mga0yw44_208621_c1 3300050492 Bacteria 1292
255 nmdc:mga0k408_112526_c1 3300050493 Bacteria 1610
256 nmdc:mga0k408_191030_c1 3300050493 Bacteria 1222
257 nmdc:mga0k408_214782_c1 3300050493 Bacteria 1149
258 nmdc:mga0k408_28233_c1 3300050493 Bacteria 3191
259 nmdc:mga0k408_288662_c1 3300050493 Bacteria 979
260 nmdc:mga0k408_565_c1 3300050493 Bacteria 20434
261 nmdc:mga0k408_61278_c1 3300050493 Bacteria 2187
262 nmdc:mga0k408_82129_c1 3300050493 Bacteria 1888
263 nmdc:mga0k408_83755_c1 3300050493 Bacteria 1870
264 nmdc:mga0k408_88978_c1 3300050493 Bacteria 1813
265 nmdc:mga0k408_96999_c1 3300050493 Bacteria 1736
266 nmdc:mga06z11_142983_c1 3300050494 Bacteria 1354
267 nmdc:mga06z11_26746_c1 3300050494 Bacteria 2750
268 nmdc:mga06z11_75830_c1 3300050494 Bacteria 1792
269 nmdc:mga07m45_109271_c1 3300050496 Bacteria 1592
270 nmdc:mga07m45_15044_c1 3300050496 Bacteria 4132
271 nmdc:mga07m45_186498_c1 3300050496 Bacteria 1206
272 nmdc:mga07m45_24515_c1 3300050496 Bacteria 3306
273 nmdc:mga07m45_5077_c1 3300050496 Bacteria 6512
274 nmdc:mga07m45_9342_c1 3300050496 Bacteria 5083
275 nmdc:mga08y16_854343_c1 3300050511 Bacteria 899
276 nmdc:mga0sz30_33107_c1 3300050516 Bacteria 2147
277 Ga0500578_0056364 3300053086 Bacteria 2513
278 Ga0500658_0001020 3300053134 Bacteria 11428
279 Ga0500568_0001863 3300053139 Bacteria 12976
280 Ga0500568_0043971 3300053139 Bacteria 1783
281 Ga0500616_0220446 3300053153 Bacteria 828
282 Ga0500645_030325 3300053730 Bacteria 1627
283 Ga0590071_000228 3300059421 Bacteria 16440

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041509 Ga0451843_0154138 Ga0451843_0154138_36_593 171
2 3300050511 nmdc:mga08y16_854343_c1 nmdc:mga08y16_854343_c1_102_698 176
3 3300006195 Ga0075366_10420153 Ga0075366_104201532 177
4 3300005356 Ga0070674_100147377 Ga0070674_1001473773 178
5 3300025937 Ga0207669_10055588 Ga0207669_100555883 178
6 3300031730 Ga0307516_10025523 Ga0307516_100255237 178
7 3300041486 Ga0451807_1230910 Ga0451807_1230910_611_1213 179
8 3300025933 Ga0207706_10004061 Ga0207706_1000406117 180
9 3300046471 Ga0495650_0087464 Ga0495650_0087464_606_1172 182
10 3300048905 Ga0496102_0001594 Ga0496102_0001594_18889_19494 183
11 3300053139 Ga0500568_0001863 Ga0500568_0001863_4204_4755 183
12 iso_pu_bacteria 2932422444 2932424898 184
13 3300006051 Ga0075364_10560764 Ga0075364_105607641 185
14 iso_pu_bacteria 2643221639 2644217172 186
15 iso_pu_bacteria 2643221646 2644259055 186
16 3300035090 Ga0373949_0164253 Ga0373949_0164253_30_635 187
17 3300059421 Ga0590071_000228 Ga0590071_000228_12141_12794 188
18 3300006048 Ga0075363_100540295 Ga0075363_1005402951 189
19 3300003322 rootL2_10014091 rootL2_100140913 190
20 3300005577 Ga0068857_100276548 Ga0068857_1002765482 190
21 3300005614 Ga0068856_100449837 Ga0068856_1004498372 190
22 3300006195 Ga0075366_10040158 Ga0075366_100401584 190
23 3300006353 Ga0075370_10142117 Ga0075370_101421173 190
24 3300009174 Ga0105241_10188932 Ga0105241_101889321 190
25 3300009551 Ga0105238_10922108 Ga0105238_109221082 190
26 3300010375 Ga0105239_10314478 Ga0105239_103144783 190
27 3300014969 Ga0157376_10036665 Ga0157376_100366654 190
28 3300021361 Ga0213872_10006949 Ga0213872_100069495 190
29 3300025299 Ga0209256_1032560 Ga0209256_10325603 190
30 3300025911 Ga0207654_10012244 Ga0207654_100122445 190
31 3300025949 Ga0207667_10137410 Ga0207667_101374105 190
32 3300026023 Ga0207677_10066199 Ga0207677_100661993 190
33 3300026023 Ga0207677_10408008 Ga0207677_104080082 190
34 3300026116 Ga0207674_10127087 Ga0207674_101270873 190
35 3300034817 Ga0373948_0009909 Ga0373948_0009909_860_1471 190
36 3300034818 Ga0373950_0053631 Ga0373950_0053631_82_693 190
37 3300035091 Ga0373951_0018243 Ga0373951_0018243_838_1449 190
38 3300035114 Ga0373939_0000820 Ga0373939_0000820_5569_6180 190
39 3300035121 Ga0373960_0000664 Ga0373960_0000664_1238_1849 190
40 3300035242 Ga0373962_0116696 Ga0373962_0116696_10_621 190
41 3300035691 Ga0373931_0000400 Ga0373931_0000400_15732_16343 190
42 3300037471 Ga0395905_0000071 Ga0395905_0000071_84856_85470 190
43 3300039447 Ga0436361_0334210 Ga0436361_0334210_2762_3382 190
44 3300042438 Ga0439459_0049783 Ga0439459_0049783_236_841 190
45 3300045051 Ga0451576_0167234 Ga0451576_0167234_1300_1914 190
46 3300005331 Ga0070670_100736486 Ga0070670_1007364861 191
47 3300005333 Ga0070677_10152164 Ga0070677_101521642 191
48 3300005353 Ga0070669_100065800 Ga0070669_1000658002 191
49 3300005354 Ga0070675_100075717 Ga0070675_1000757175 191
50 3300005364 Ga0070673_100074896 Ga0070673_1000748965 191
51 3300005367 Ga0070667_100482425 Ga0070667_1004824252 191
52 3300005456 Ga0070678_100120148 Ga0070678_1001201483 191
53 3300006051 Ga0075364_10186930 Ga0075364_101869302 191
54 3300009177 Ga0105248_10652537 Ga0105248_106525373 191
55 3300014326 Ga0157380_10124994 Ga0157380_101249943 191
56 3300025893 Ga0207682_10042471 Ga0207682_100424712 191
57 3300025923 Ga0207681_10045033 Ga0207681_100450333 191
58 3300025925 Ga0207650_10635553 Ga0207650_106355532 191
59 3300025926 Ga0207659_10202392 Ga0207659_102023922 191
60 3300025933 Ga0207706_10287821 Ga0207706_102878213 191
61 3300028794 Ga0307515_10106481 Ga0307515_101064815 191
62 3300031456 Ga0307513_10161899 Ga0307513_101618993 191
63 3300031548 Ga0307408_100205539 Ga0307408_1002055393 191
64 3300031911 Ga0307412_10501186 Ga0307412_105011862 191
65 3300046539 Ga0495621_0092295 Ga0495621_0092295_211_828 191
66 3300050491 nmdc:mga00v17_163685_c1 nmdc:mga00v17_163685_c1_614_1231 191
67 3300032002 Ga0307416_101079668 Ga0307416_1010796682 192
68 3300044658 Ga0466972_0000828 Ga0466972_0000828_13029_13622 192
69 3300044683 Ga0466965_0052829 Ga0466965_0052829_358_951 192
70 3300044684 Ga0466966_0337555 Ga0466966_0337555_283_873 192
71 3300044693 Ga0466961_0048056 Ga0466961_0048056_1351_1941 192
72 3300044706 Ga0466964_0017252 Ga0466964_0017252_492_1082 192
73 3300044706 Ga0466964_0218956 Ga0466964_0218956_201_794 192
74 3300044719 Ga0466971_0005612 Ga0466971_0005612_548_1138 192
75 3300044842 Ga0466957_0124533 Ga0466957_0124533_610_1200 192
76 3300045049 Ga0466959_0012248 Ga0466959_0012248_527_1117 192
77 3300048905 Ga0496102_1256820 Ga0496102_1256820_27_632 192
78 3300050493 nmdc:mga0k408_82129_c1 nmdc:mga0k408_82129_c1_456_1070 192
79 3300031911 Ga0307412_10676649 Ga0307412_106766492 193
80 3300003784 Ga0055534_1004816 Ga0055534_10048165 194
81 3300011119 Ga0105246_10502471 Ga0105246_105024712 194
82 3300017792 Ga0163161_10170391 Ga0163161_101703913 194
83 3300025273 Ga0209673_1021783 Ga0209673_10217833 194
84 3300025273 Ga0209673_1061473 Ga0209673_10614731 194
85 3300025284 Ga0209130_1003855 Ga0209130_10038553 194
86 3300025291 Ga0209675_1009058 Ga0209675_10090585 194
87 3300025292 Ga0209676_1022171 Ga0209676_10221713 194
88 3300025303 Ga0209051_1010699 Ga0209051_10106993 194
89 3300025304 Ga0209257_1010069 Ga0209257_10100693 194
90 3300041997 Ga0439431_0012935 Ga0439431_0012935_1079_1699 194
91 3300044712 Ga0453684_0134527 Ga0453684_0134527_513_1106 194
92 3300045051 Ga0451576_0006110 Ga0451576_0006110_680_1273 194
93 3300046664 Ga0495659_0102851 Ga0495659_0102851_55_669 194
94 3300006048 Ga0075363_100081544 Ga0075363_1000815443 195
95 3300006195 Ga0075366_10002896 Ga0075366_1000289611 195
96 3300041404 Ga0439436_0006509 Ga0439436_0006509_647_1273 195
97 3300041410 Ga0439461_0008859 Ga0439461_0008859_495_1121 195
98 3300041411 Ga0439466_0030929 Ga0439466_0030929_712_1338 195
99 3300041413 Ga0439465_0000677 Ga0439465_0000677_9784_10410 195
100 3300041999 Ga0439433_0000297 Ga0439433_0000297_7201_7827 195
101 3300042006 Ga0439432_000674 Ga0439432_000674_1241_1867 195
102 3300042007 Ga0439449_0004068 Ga0439449_0004068_4205_4831 195
103 3300042014 Ga0439457_011672 Ga0439457_011672_965_1591 195
104 3300042015 Ga0439462_0006984 Ga0439462_0006984_1742_2368 195
105 3300042156 Ga0439446_0027186 Ga0439446_0027186_871_1497 195
106 3300042435 Ga0439434_0006337 Ga0439434_0006337_1001_1627 195
107 3300049571 Ga0501034_0258741 Ga0501034_0258741_314_934 195
108 3300049649 Ga0501198_000001 Ga0501198_000001_77162_77782 195
109 3300049662 Ga0501222_000004 Ga0501222_000004_66138_66758 195
110 3300050489 nmdc:mga03683_41214_c1 nmdc:mga03683_41214_c1_402_1025 195
111 3300050490 nmdc:mga03n38_117295_c1 nmdc:mga03n38_117295_c1_127_750 195
112 3300050496 nmdc:mga07m45_15044_c1 nmdc:mga07m45_15044_c1_2337_2960 195
113 iso_pu_bacteria 2643221654 2644302997 195
114 3300031730 Ga0307516_10145775 Ga0307516_101457753 196
115 3300005356 Ga0070674_100342428 Ga0070674_1003424282 197
116 3300005367 Ga0070667_100000849 Ga0070667_1000008492 197
117 3300006195 Ga0075366_10130191 Ga0075366_101301912 197
118 3300006353 Ga0075370_10096275 Ga0075370_100962753 197
119 3300013308 Ga0157375_10159070 Ga0157375_101590703 197
120 3300025937 Ga0207669_10277157 Ga0207669_102771571 197
121 3300025986 Ga0207658_10000968 Ga0207658_1000096816 197
122 3300028381 Ga0268264_10291478 Ga0268264_102914781 197
123 3300035695 Ga0373927_0359966 Ga0373927_0359966_173_823 197
124 3300037068 Ga0373925_0066461 Ga0373925_0066461_924_1574 197
125 3300050493 nmdc:mga0k408_191030_c1 nmdc:mga0k408_191030_c1_251_844 197
126 3300005458 Ga0070681_10742049 Ga0070681_107420492 198
127 3300005577 Ga0068857_100473080 Ga0068857_1004730802 198
128 3300006038 Ga0075365_10085342 Ga0075365_100853422 198
129 3300006048 Ga0075363_100010995 Ga0075363_1000109953 198
130 3300006051 Ga0075364_10132666 Ga0075364_101326663 198
131 3300006177 Ga0075362_10031183 Ga0075362_100311833 198
132 3300006178 Ga0075367_10064695 Ga0075367_100646953 198
133 3300006186 Ga0075369_10019440 Ga0075369_100194403 198
134 3300006195 Ga0075366_10102003 Ga0075366_101020032 198
135 3300026116 Ga0207674_10597104 Ga0207674_105971043 198
136 3300026118 Ga0207675_100363134 Ga0207675_1003631343 198
137 3300028794 Ga0307515_10050900 Ga0307515_100509008 198
138 3300046660 Ga0495625_0248465 Ga0495625_0248465_141_737 198
139 3300050489 nmdc:mga03683_9751_c1 nmdc:mga03683_9751_c1_889_1485 198
140 3300050490 nmdc:mga03n38_192775_c1 nmdc:mga03n38_192775_c1_37_633 198
141 3300050491 nmdc:mga00v17_588910_c1 nmdc:mga00v17_588910_c1_71_667 198
142 3300050492 nmdc:mga0yw44_208621_c1 nmdc:mga0yw44_208621_c1_462_1058 198
143 3300050493 nmdc:mga0k408_565_c1 nmdc:mga0k408_565_c1_15374_15970 198
144 3300050493 nmdc:mga0k408_565_c1 nmdc:mga0k408_565_c1_17605_18201 198
145 3300050493 nmdc:mga0k408_61278_c1 nmdc:mga0k408_61278_c1_909_1505 198
146 3300050493 nmdc:mga0k408_96999_c1 nmdc:mga0k408_96999_c1_806_1402 198
147 3300050494 nmdc:mga06z11_26746_c1 nmdc:mga06z11_26746_c1_660_1256 198
148 3300050496 nmdc:mga07m45_9342_c1 nmdc:mga07m45_9342_c1_692_1288 198
149 3300050516 nmdc:mga0sz30_33107_c1 nmdc:mga0sz30_33107_c1_616_1212 198
150 3300005457 Ga0070662_100434591 Ga0070662_1004345912 199
151 3300005459 Ga0068867_100441640 Ga0068867_1004416401 199
152 3300005548 Ga0070665_100015847 Ga0070665_10001584710 199
153 3300005842 Ga0068858_100604392 Ga0068858_1006043923 199
154 3300006237 Ga0097621_100294142 Ga0097621_1002941423 199
155 3300013297 Ga0157378_10167904 Ga0157378_101679043 199
156 3300026089 Ga0207648_10305735 Ga0207648_103057352 199
157 3300026121 Ga0207683_10234558 Ga0207683_102345583 199
158 3300028379 Ga0268266_10015567 Ga0268266_100155673 199
159 3300031507 Ga0307509_10201271 Ga0307509_102012713 199
160 3300031507 Ga0307509_10391914 Ga0307509_103919142 199
161 3300031649 Ga0307514_10047634 Ga0307514_100476341 199
162 3300031730 Ga0307516_10436849 Ga0307516_104368492 199
163 3300033179 Ga0307507_10144590 Ga0307507_101445903 199
164 3300033180 Ga0307510_10067163 Ga0307510_100671633 199
165 3300033180 Ga0307510_10135657 Ga0307510_101356572 199
166 3300035112 Ga0373932_0005873 Ga0373932_0005873_1115_1729 199
167 3300035121 Ga0373960_0121165 Ga0373960_0121165_177_791 199
168 3300035691 Ga0373931_0072407 Ga0373931_0072407_324_938 199
169 3300046522 Ga0495643_0109876 Ga0495643_0109876_424_1029 199
170 3300046526 Ga0495666_0216814 Ga0495666_0216814_65_679 199
171 3300046542 Ga0495597_0066742 Ga0495597_0066742_419_1024 199
172 3300046690 Ga0495624_0174588 Ga0495624_0174588_31_645 199
173 3300050496 nmdc:mga07m45_109271_c1 nmdc:mga07m45_109271_c1_547_1149 199
174 3300053086 Ga0500578_0056364 Ga0500578_0056364_1159_1812 199
175 3300053153 Ga0500616_0220446 Ga0500616_0220446_49_666 199
176 3300053730 Ga0500645_030325 Ga0500645_030325_765_1418 199
177 3300005331 Ga0070670_100161802 Ga0070670_1001618023 200
178 3300005334 Ga0068869_100076606 Ga0068869_1000766062 200
179 3300005338 Ga0068868_100031382 Ga0068868_1000313826 200
180 3300005338 Ga0068868_100238822 Ga0068868_1002388221 200
181 3300005354 Ga0070675_100026794 Ga0070675_1000267942 200
182 3300005355 Ga0070671_100022927 Ga0070671_1000229273 200
183 3300005355 Ga0070671_100032504 Ga0070671_1000325046 200
184 3300005364 Ga0070673_100057388 Ga0070673_1000573883 200
185 3300005457 Ga0070662_100394636 Ga0070662_1003946362 200
186 3300005543 Ga0070672_100045399 Ga0070672_1000453994 200
187 3300005548 Ga0070665_100529000 Ga0070665_1005290001 200
188 3300005618 Ga0068864_100216749 Ga0068864_1002167492 200
189 3300005841 Ga0068863_100057481 Ga0068863_1000574813 200
190 3300005843 Ga0068860_100206781 Ga0068860_1002067813 200
191 3300005843 Ga0068860_100217301 Ga0068860_1002173012 200
192 3300006195 Ga0075366_10052045 Ga0075366_100520453 200
193 3300006195 Ga0075366_10376523 Ga0075366_103765232 200
194 3300006353 Ga0075370_10003402 Ga0075370_100034028 200
195 3300009101 Ga0105247_10347159 Ga0105247_103471593 200
196 3300009174 Ga0105241_10218303 Ga0105241_102183032 200
197 3300009553 Ga0105249_10131900 Ga0105249_101319003 200
198 3300011119 Ga0105246_10113326 Ga0105246_101133263 200
199 3300013297 Ga0157378_10923827 Ga0157378_109238271 200
200 3300014325 Ga0163163_10381814 Ga0163163_103818142 200
201 3300025907 Ga0207645_10136557 Ga0207645_101365573 200
202 3300025908 Ga0207643_10056377 Ga0207643_100563773 200
203 3300025911 Ga0207654_10125864 Ga0207654_101258641 200
204 3300025925 Ga0207650_10258255 Ga0207650_102582552 200
205 3300025926 Ga0207659_10023849 Ga0207659_100238497 200
206 3300025927 Ga0207687_10368897 Ga0207687_103688971 200
207 3300025931 Ga0207644_10033631 Ga0207644_100336313 200
208 3300025931 Ga0207644_10563207 Ga0207644_105632071 200
209 3300025938 Ga0207704_10215010 Ga0207704_102150103 200
210 3300025940 Ga0207691_10061139 Ga0207691_100611394 200
211 3300025942 Ga0207689_10397926 Ga0207689_103979262 200
212 3300025961 Ga0207712_10129949 Ga0207712_101299493 200
213 3300025986 Ga0207658_10284933 Ga0207658_102849333 200
214 3300026023 Ga0207677_10022994 Ga0207677_100229946 200
215 3300026023 Ga0207677_10094389 Ga0207677_100943893 200
216 3300026088 Ga0207641_10105723 Ga0207641_101057235 200
217 3300026089 Ga0207648_10007326 Ga0207648_100073267 200
218 3300026095 Ga0207676_10046391 Ga0207676_100463915 200
219 3300026116 Ga0207674_10041528 Ga0207674_100415283 200
220 3300028379 Ga0268266_10637052 Ga0268266_106370521 200
221 3300028381 Ga0268264_10758023 Ga0268264_107580233 200
222 3300028786 Ga0307517_10170927 Ga0307517_101709272 200
223 3300028794 Ga0307515_10038558 Ga0307515_100385583 200
224 3300041507 Ga0451851_0950883 Ga0451851_0950883_339_992 200
225 3300041512 Ga0451853_1029036 Ga0451853_1029036_603_1247 200
226 3300041512 Ga0451853_3952381 Ga0451853_3952381_387_1013 200
227 3300048925 Ga0496122_0142706 Ga0496122_0142706_426_1082 200
228 3300050493 nmdc:mga0k408_288662_c1 nmdc:mga0k408_288662_c1_272_895 200
229 3300050493 nmdc:mga0k408_83755_c1 nmdc:mga0k408_83755_c1_618_1262 200
230 3300050493 nmdc:mga0k408_88978_c1 nmdc:mga0k408_88978_c1_537_1139 200
231 3300050496 nmdc:mga07m45_24515_c1 nmdc:mga07m45_24515_c1_2421_3023 200
232 3300006178 Ga0075367_10385674 Ga0075367_103856741 201
233 3300006353 Ga0075370_10020265 Ga0075370_100202655 201
234 3300031911 Ga0307412_10198827 Ga0307412_101988272 201
235 3300041413 Ga0439465_0114067 Ga0439465_0114067_57_698 201
236 3300047443 Ga0495687_001027 Ga0495687_001027_550_1155 201
237 3300050493 nmdc:mga0k408_28233_c1 nmdc:mga0k408_28233_c1_1204_1809 201
238 3300050496 nmdc:mga07m45_186498_c1 nmdc:mga07m45_186498_c1_252_890 201
239 3300050496 nmdc:mga07m45_5077_c1 nmdc:mga07m45_5077_c1_5083_5688 201
240 3300017792 Ga0163161_10328294 Ga0163161_103282942 202
241 3300046457 Ga0495590_0027037 Ga0495590_0027037_783_1391 202
242 3300046474 Ga0495605_0162870 Ga0495605_0162870_272_880 202
243 3300046506 Ga0495583_0058798 Ga0495583_0058798_586_1194 202
244 3300046512 Ga0495610_0162346 Ga0495610_0162346_242_850 202
245 3300046519 Ga0495632_0079150 Ga0495632_0079150_924_1532 202
246 3300046542 Ga0495597_0111863 Ga0495597_0111863_79_687 202
247 3300046648 Ga0495611_0147396 Ga0495611_0147396_436_1044 202
248 3300046694 Ga0495649_0002161 Ga0495649_0002161_12905_13513 202
249 3300047443 Ga0495687_012737 Ga0495687_012737_2264_2872 202
250 3300047446 Ga0495679_073335 Ga0495679_073335_87_695 202
251 3300053134 Ga0500658_0001020 Ga0500658_0001020_5395_6003 202
252 3300053139 Ga0500568_0043971 Ga0500568_0043971_801_1409 202
253 3300005335 Ga0070666_10704224 Ga0070666_107042241 204
254 3300005339 Ga0070660_100195911 Ga0070660_1001959113 204
255 3300005457 Ga0070662_100035242 Ga0070662_1000352425 204
256 3300005577 Ga0068857_100006256 Ga0068857_10000625611 204
257 3300005578 Ga0068854_100088737 Ga0068854_1000887373 204
258 3300005617 Ga0068859_100292956 Ga0068859_1002929563 204
259 3300006042 Ga0075368_10064428 Ga0075368_100644283 204
260 3300006051 Ga0075364_10086015 Ga0075364_100860153 204
261 3300006186 Ga0075369_10173978 Ga0075369_101739782 204
262 3300006931 Ga0097620_100292949 Ga0097620_1002929493 204
263 3300009098 Ga0105245_10259217 Ga0105245_102592173 204
264 3300009174 Ga0105241_11090679 Ga0105241_110906791 204
265 3300009545 Ga0105237_10026456 Ga0105237_100264568 204
266 3300010375 Ga0105239_10165522 Ga0105239_101655223 204
267 3300025914 Ga0207671_10020453 Ga0207671_100204537 204
268 3300025933 Ga0207706_10056290 Ga0207706_100562905 204
269 3300025960 Ga0207651_10088441 Ga0207651_100884413 204
270 3300025972 Ga0207668_10103233 Ga0207668_101032333 204
271 3300026116 Ga0207674_10137753 Ga0207674_101377533 204
272 3300026142 Ga0207698_10281107 Ga0207698_102811072 204
273 3300042012 Ga0439455_0029709 Ga0439455_0029709_496_1110 204
274 3300050493 nmdc:mga0k408_112526_c1 nmdc:mga0k408_112526_c1_353_967 204
275 3300050494 nmdc:mga06z11_75830_c1 nmdc:mga06z11_75830_c1_537_1151 204
276 3300005445 Ga0070708_100457523 Ga0070708_1004575232 205
277 3300005467 Ga0070706_100135767 Ga0070706_1001357673 205
278 3300005468 Ga0070707_100007656 Ga0070707_1000076563 205
279 3300005471 Ga0070698_100217278 Ga0070698_1002172783 205
280 3300005518 Ga0070699_101060953 Ga0070699_1010609531 205
281 3300005841 Ga0068863_100708363 Ga0068863_1007083632 205
282 3300006178 Ga0075367_10006801 Ga0075367_100068013 205
283 3300006186 Ga0075369_10080316 Ga0075369_100803162 205
284 3300006353 Ga0075370_10031870 Ga0075370_100318703 205
285 3300025910 Ga0207684_10018036 Ga0207684_100180368 205
286 3300050493 nmdc:mga0k408_214782_c1 nmdc:mga0k408_214782_c1_92_709 205
287 3300050494 nmdc:mga06z11_142983_c1 nmdc:mga06z11_142983_c1_359_976 205
288 3300003316 rootH1_10036704 rootH1_100367042 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04442

CtaG_Cox11

Cytochrome c oxidase assembly protein CtaG/Cox11

19

167

0.92

Feature Viewer

pLDDT pTM Quality
66.6 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map