F388630
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 288 | 192 | 283 | 204 |
Family's Representative Sequence
| Representative Sequence | 3300025937|Ga0207669_10055588|Ga0207669_100555883 |
| Length | 178 |
| Sequence | MVGKLFVVAALMFSFGYALVPIYRSICSALGVNVLSLSEQGIPGATSSIKPNTQVDLARTVTVEFDANARGVWEFKPATSSLQVHPGEMTTVMYEFRNSQPRTLAAQAIPSYAPKQALPYFHKLECFCFREYTLQAGESKQWPVVFVIDPKMPKDIKTITLSYTFFEVGGKIPAAPQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 2 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 3 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 4 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 40 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 41 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 42 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 43 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 44 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 45 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 46 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 66 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 105 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 106 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 107 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 108 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 109 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 110 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 111 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 112 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 113 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 114 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 115 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 116 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 117 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 118 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 119 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 120 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 121 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 122 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 123 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 124 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 125 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 127 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 128 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 129 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 130 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 131 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 132 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 133 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 134 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 135 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 136 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 137 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 138 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 139 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 140 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 141 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 142 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 143 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 144 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 145 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 146 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 147 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 148 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 149 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 150 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 151 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 152 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 153 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 154 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 155 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 156 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 174 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 175 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 177 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 178 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 179 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 180 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 181 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 182 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 183 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 184 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 185 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 187 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 188 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 189 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 190 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 191 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 192 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.61 |
| Metatranscriptomes | 0 |
| Isolates | 1.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 25 |
| Nodule | 0 |
| Rhizoplane | 1.04 |
| Rhizosphere | 65.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10036704 | 3300003316 | Bacteria | 1438 |
| 2 | rootL2_10014091 | 3300003322 | Bacteria | 1360 |
| 3 | Ga0055534_1004816 | 3300003784 | Bacteria | 3787 |
| 4 | Ga0070670_100161802 | 3300005331 | Bacteria | 1940 |
| 5 | Ga0070670_100736486 | 3300005331 | Bacteria | 888 |
| 6 | Ga0070677_10152164 | 3300005333 | Bacteria | 1078 |
| 7 | Ga0068869_100076606 | 3300005334 | Bacteria | 2486 |
| 8 | Ga0070666_10704224 | 3300005335 | Bacteria | 741 |
| 9 | Ga0068868_100031382 | 3300005338 | Bacteria | 4081 |
| 10 | Ga0068868_100238822 | 3300005338 | Bacteria | 1526 |
| 11 | Ga0070660_100195911 | 3300005339 | Bacteria | 1638 |
| 12 | Ga0070669_100065800 | 3300005353 | Bacteria | 2670 |
| 13 | Ga0070675_100026794 | 3300005354 | Bacteria | 4626 |
| 14 | Ga0070675_100075717 | 3300005354 | Bacteria | 2798 |
| 15 | Ga0070671_100022927 | 3300005355 | Bacteria | 5102 |
| 16 | Ga0070671_100032504 | 3300005355 | Bacteria | 4313 |
| 17 | Ga0070674_100147377 | 3300005356 | Bacteria | 1773 |
| 18 | Ga0070674_100342428 | 3300005356 | Bacteria | 1205 |
| 19 | Ga0070673_100057388 | 3300005364 | Bacteria | 3076 |
| 20 | Ga0070673_100074896 | 3300005364 | Bacteria | 2729 |
| 21 | Ga0070667_100000849 | 3300005367 | Bacteria | 28386 |
| 22 | Ga0070667_100482425 | 3300005367 | Bacteria | 1135 |
| 23 | Ga0070708_100457523 | 3300005445 | Bacteria | 1204 |
| 24 | Ga0070678_100120148 | 3300005456 | Bacteria | 2071 |
| 25 | Ga0070662_100035242 | 3300005457 | Bacteria | 3533 |
| 26 | Ga0070662_100394636 | 3300005457 | Bacteria | 1141 |
| 27 | Ga0070662_100434591 | 3300005457 | Bacteria | 1087 |
| 28 | Ga0070681_10742049 | 3300005458 | Bacteria | 898 |
| 29 | Ga0068867_100441640 | 3300005459 | Bacteria | 1106 |
| 30 | Ga0070706_100135767 | 3300005467 | Bacteria | 2296 |
| 31 | Ga0070707_100007656 | 3300005468 | Bacteria | 10028 |
| 32 | Ga0070698_100217278 | 3300005471 | Bacteria | 1846 |
| 33 | Ga0070699_101060953 | 3300005518 | Bacteria | 743 |
| 34 | Ga0070672_100045399 | 3300005543 | Bacteria | 3398 |
| 35 | Ga0070665_100015847 | 3300005548 | Bacteria | 7567 |
| 36 | Ga0070665_100529000 | 3300005548 | Bacteria | 1191 |
| 37 | Ga0068857_100006256 | 3300005577 | Bacteria | 10181 |
| 38 | Ga0068857_100276548 | 3300005577 | Bacteria | 1544 |
| 39 | Ga0068857_100473080 | 3300005577 | Bacteria | 1174 |
| 40 | Ga0068854_100088737 | 3300005578 | Bacteria | 2296 |
| 41 | Ga0068856_100449837 | 3300005614 | Bacteria | 1309 |
| 42 | Ga0068859_100292956 | 3300005617 | Bacteria | 1720 |
| 43 | Ga0068864_100216749 | 3300005618 | Bacteria | 1764 |
| 44 | Ga0068863_100057481 | 3300005841 | Bacteria | 3681 |
| 45 | Ga0068863_100708363 | 3300005841 | Bacteria | 1001 |
| 46 | Ga0068858_100604392 | 3300005842 | Bacteria | 1064 |
| 47 | Ga0068860_100206781 | 3300005843 | Bacteria | 1904 |
| 48 | Ga0068860_100217301 | 3300005843 | Bacteria | 1855 |
| 49 | Ga0075365_10085342 | 3300006038 | Bacteria | 2144 |
| 50 | Ga0075368_10064428 | 3300006042 | Bacteria | 1471 |
| 51 | Ga0075363_100010995 | 3300006048 | Bacteria | 4320 |
| 52 | Ga0075363_100081544 | 3300006048 | Bacteria | 1770 |
| 53 | Ga0075363_100540295 | 3300006048 | Bacteria | 695 |
| 54 | Ga0075364_10086015 | 3300006051 | Bacteria | 2082 |
| 55 | Ga0075364_10132666 | 3300006051 | Bacteria | 1672 |
| 56 | Ga0075364_10186930 | 3300006051 | Bacteria | 1403 |
| 57 | Ga0075364_10560764 | 3300006051 | Bacteria | 781 |
| 58 | Ga0075362_10031183 | 3300006177 | Bacteria | 2306 |
| 59 | Ga0075367_10006801 | 3300006178 | Bacteria | 5809 |
| 60 | Ga0075367_10064695 | 3300006178 | Bacteria | 2188 |
| 61 | Ga0075367_10385674 | 3300006178 | Bacteria | 885 |
| 62 | Ga0075369_10019440 | 3300006186 | Bacteria | 2773 |
| 63 | Ga0075369_10080316 | 3300006186 | Bacteria | 1446 |
| 64 | Ga0075369_10173978 | 3300006186 | Bacteria | 989 |
| 65 | Ga0075366_10002896 | 3300006195 | Bacteria | 8909 |
| 66 | Ga0075366_10040158 | 3300006195 | Bacteria | 2767 |
| 67 | Ga0075366_10052045 | 3300006195 | Bacteria | 2433 |
| 68 | Ga0075366_10102003 | 3300006195 | Bacteria | 1722 |
| 69 | Ga0075366_10130191 | 3300006195 | Bacteria | 1518 |
| 70 | Ga0075366_10376523 | 3300006195 | Bacteria | 873 |
| 71 | Ga0075366_10420153 | 3300006195 | Bacteria | 824 |
| 72 | Ga0097621_100294142 | 3300006237 | Bacteria | 1433 |
| 73 | Ga0075370_10003402 | 3300006353 | Bacteria | 7564 |
| 74 | Ga0075370_10020265 | 3300006353 | Bacteria | 3633 |
| 75 | Ga0075370_10031870 | 3300006353 | Bacteria | 2944 |
| 76 | Ga0075370_10096275 | 3300006353 | Bacteria | 1710 |
| 77 | Ga0075370_10142117 | 3300006353 | Bacteria | 1403 |
| 78 | Ga0097620_100292949 | 3300006931 | Bacteria | 1720 |
| 79 | Ga0105245_10259217 | 3300009098 | Bacteria | 1692 |
| 80 | Ga0105247_10347159 | 3300009101 | Bacteria | 1043 |
| 81 | Ga0105241_10188932 | 3300009174 | Bacteria | 1714 |
| 82 | Ga0105241_10218303 | 3300009174 | Bacteria | 1601 |
| 83 | Ga0105241_11090679 | 3300009174 | Bacteria | 751 |
| 84 | Ga0105248_10652537 | 3300009177 | Bacteria | 1187 |
| 85 | Ga0105237_10026456 | 3300009545 | Bacteria | 5930 |
| 86 | Ga0105238_10922108 | 3300009551 | Bacteria | 892 |
| 87 | Ga0105249_10131900 | 3300009553 | Bacteria | 2386 |
| 88 | Ga0105239_10165522 | 3300010375 | Bacteria | 2472 |
| 89 | Ga0105239_10314478 | 3300010375 | Bacteria | 1765 |
| 90 | Ga0105246_10113326 | 3300011119 | Bacteria | 1996 |
| 91 | Ga0105246_10502471 | 3300011119 | Bacteria | 1030 |
| 92 | Ga0157378_10167904 | 3300013297 | Bacteria | 2056 |
| 93 | Ga0157378_10923827 | 3300013297 | Bacteria | 904 |
| 94 | Ga0157375_10159070 | 3300013308 | Bacteria | 2400 |
| 95 | Ga0163163_10381814 | 3300014325 | Bacteria | 1466 |
| 96 | Ga0157380_10124994 | 3300014326 | Bacteria | 2185 |
| 97 | Ga0157376_10036665 | 3300014969 | Bacteria | 3974 |
| 98 | Ga0163161_10170391 | 3300017792 | Bacteria | 1664 |
| 99 | Ga0163161_10328294 | 3300017792 | Bacteria | 1211 |
| 100 | Ga0213872_10006949 | 3300021361 | Bacteria | 5624 |
| 101 | Ga0209673_1021783 | 3300025273 | Bacteria | 2231 |
| 102 | Ga0209673_1061473 | 3300025273 | Bacteria | 936 |
| 103 | Ga0209130_1003855 | 3300025284 | Bacteria | 6056 |
| 104 | Ga0209675_1009058 | 3300025291 | Bacteria | 3561 |
| 105 | Ga0209676_1022171 | 3300025292 | Bacteria | 2110 |
| 106 | Ga0209256_1032560 | 3300025299 | Bacteria | 1412 |
| 107 | Ga0209051_1010699 | 3300025303 | Bacteria | 4598 |
| 108 | Ga0209257_1010069 | 3300025304 | Bacteria | 4890 |
| 109 | Ga0207682_10042471 | 3300025893 | Bacteria | 1858 |
| 110 | Ga0207645_10136557 | 3300025907 | Bacteria | 1597 |
| 111 | Ga0207643_10056377 | 3300025908 | Bacteria | 2235 |
| 112 | Ga0207684_10018036 | 3300025910 | Bacteria | 6050 |
| 113 | Ga0207654_10012244 | 3300025911 | Bacteria | 4392 |
| 114 | Ga0207654_10125864 | 3300025911 | Bacteria | 1615 |
| 115 | Ga0207671_10020453 | 3300025914 | Bacteria | 5037 |
| 116 | Ga0207681_10045033 | 3300025923 | Bacteria | 2960 |
| 117 | Ga0207650_10258255 | 3300025925 | Bacteria | 1412 |
| 118 | Ga0207650_10635553 | 3300025925 | Bacteria | 899 |
| 119 | Ga0207659_10023849 | 3300025926 | Bacteria | 4091 |
| 120 | Ga0207659_10202392 | 3300025926 | Bacteria | 1587 |
| 121 | Ga0207687_10368897 | 3300025927 | Bacteria | 1173 |
| 122 | Ga0207644_10033631 | 3300025931 | Bacteria | 3585 |
| 123 | Ga0207644_10563207 | 3300025931 | Bacteria | 944 |
| 124 | Ga0207706_10004061 | 3300025933 | Bacteria | 13836 |
| 125 | Ga0207706_10056290 | 3300025933 | Bacteria | 3468 |
| 126 | Ga0207706_10287821 | 3300025933 | Bacteria | 1432 |
| 127 | Ga0207669_10055588 | 3300025937 | Bacteria | 2398 |
| 128 | Ga0207669_10277157 | 3300025937 | Bacteria | 1263 |
| 129 | Ga0207704_10215010 | 3300025938 | Bacteria | 1418 |
| 130 | Ga0207691_10061139 | 3300025940 | Bacteria | 3422 |
| 131 | Ga0207689_10397926 | 3300025942 | Bacteria | 1148 |
| 132 | Ga0207667_10137410 | 3300025949 | Bacteria | 2517 |
| 133 | Ga0207651_10088441 | 3300025960 | Bacteria | 2258 |
| 134 | Ga0207712_10129949 | 3300025961 | Bacteria | 1918 |
| 135 | Ga0207668_10103233 | 3300025972 | Bacteria | 2123 |
| 136 | Ga0207658_10000968 | 3300025986 | Bacteria | 23705 |
| 137 | Ga0207658_10284933 | 3300025986 | Bacteria | 1418 |
| 138 | Ga0207677_10022994 | 3300026023 | Bacteria | 3841 |
| 139 | Ga0207677_10066199 | 3300026023 | Bacteria | 2525 |
| 140 | Ga0207677_10094389 | 3300026023 | Bacteria | 2184 |
| 141 | Ga0207677_10408008 | 3300026023 | Bacteria | 1154 |
| 142 | Ga0207641_10105723 | 3300026088 | Bacteria | 2486 |
| 143 | Ga0207648_10007326 | 3300026089 | Bacteria | 10868 |
| 144 | Ga0207648_10305735 | 3300026089 | Bacteria | 1427 |
| 145 | Ga0207676_10046391 | 3300026095 | Bacteria | 3362 |
| 146 | Ga0207674_10041528 | 3300026116 | Bacteria | 4756 |
| 147 | Ga0207674_10127087 | 3300026116 | Bacteria | 2515 |
| 148 | Ga0207674_10137753 | 3300026116 | Bacteria | 2402 |
| 149 | Ga0207674_10597104 | 3300026116 | Bacteria | 1066 |
| 150 | Ga0207675_100363134 | 3300026118 | Bacteria | 1421 |
| 151 | Ga0207683_10234558 | 3300026121 | Bacteria | 1673 |
| 152 | Ga0207698_10281107 | 3300026142 | Bacteria | 1539 |
| 153 | Ga0268266_10015567 | 3300028379 | Bacteria | 6521 |
| 154 | Ga0268266_10637052 | 3300028379 | Bacteria | 1025 |
| 155 | Ga0268264_10291478 | 3300028381 | Bacteria | 1533 |
| 156 | Ga0268264_10758023 | 3300028381 | Bacteria | 967 |
| 157 | Ga0307517_10170927 | 3300028786 | Bacteria | 1429 |
| 158 | Ga0307515_10038558 | 3300028794 | Bacteria | 7637 |
| 159 | Ga0307515_10050900 | 3300028794 | Bacteria | 6190 |
| 160 | Ga0307515_10106481 | 3300028794 | Bacteria | 3326 |
| 161 | Ga0307513_10161899 | 3300031456 | Bacteria | 2129 |
| 162 | Ga0307509_10201271 | 3300031507 | Bacteria | 1828 |
| 163 | Ga0307509_10391914 | 3300031507 | Bacteria | 1098 |
| 164 | Ga0307408_100205539 | 3300031548 | Bacteria | 1597 |
| 165 | Ga0307514_10047634 | 3300031649 | Bacteria | 3345 |
| 166 | Ga0307516_10025523 | 3300031730 | Bacteria | 6016 |
| 167 | Ga0307516_10145775 | 3300031730 | Bacteria | 2133 |
| 168 | Ga0307516_10436849 | 3300031730 | Bacteria | 966 |
| 169 | Ga0307412_10198827 | 3300031911 | Bacteria | 1521 |
| 170 | Ga0307412_10501186 | 3300031911 | Bacteria | 1011 |
| 171 | Ga0307412_10676649 | 3300031911 | Bacteria | 883 |
| 172 | Ga0307416_101079668 | 3300032002 | Bacteria | 907 |
| 173 | Ga0307507_10144590 | 3300033179 | Bacteria | 1810 |
| 174 | Ga0307510_10067163 | 3300033180 | Bacteria | 3612 |
| 175 | Ga0307510_10135657 | 3300033180 | Bacteria | 2119 |
| 176 | Ga0373948_0009909 | 3300034817 | Bacteria | 1653 |
| 177 | Ga0373950_0053631 | 3300034818 | Bacteria | 796 |
| 178 | Ga0373949_0164253 | 3300035090 | Bacteria | 649 |
| 179 | Ga0373951_0018243 | 3300035091 | Bacteria | 1593 |
| 180 | Ga0373932_0005873 | 3300035112 | Bacteria | 2891 |
| 181 | Ga0373939_0000820 | 3300035114 | Bacteria | 7682 |
| 182 | Ga0373960_0000664 | 3300035121 | Bacteria | 7081 |
| 183 | Ga0373960_0121165 | 3300035121 | Bacteria | 868 |
| 184 | Ga0373962_0116696 | 3300035242 | Bacteria | 847 |
| 185 | Ga0373931_0000400 | 3300035691 | Bacteria | 17756 |
| 186 | Ga0373931_0072407 | 3300035691 | Bacteria | 1884 |
| 187 | Ga0373927_0359966 | 3300035695 | Bacteria | 959 |
| 188 | Ga0373925_0066461 | 3300037068 | Bacteria | 2718 |
| 189 | Ga0395905_0000071 | 3300037471 | Bacteria | 174580 |
| 190 | Ga0436361_0334210 | 3300039447 | Bacteria | 17596 |
| 191 | Ga0439436_0006509 | 3300041404 | Bacteria | 3585 |
| 192 | Ga0439461_0008859 | 3300041410 | Bacteria | 1814 |
| 193 | Ga0439466_0030929 | 3300041411 | Bacteria | 1833 |
| 194 | Ga0439465_0000677 | 3300041413 | Bacteria | 10423 |
| 195 | Ga0439465_0114067 | 3300041413 | Bacteria | 943 |
| 196 | Ga0451807_1230910 | 3300041486 | Bacteria | 1316 |
| 197 | Ga0451851_0950883 | 3300041507 | Bacteria | 1006 |
| 198 | Ga0451843_0154138 | 3300041509 | Bacteria | 610 |
| 199 | Ga0451853_1029036 | 3300041512 | Bacteria | 1427 |
| 200 | Ga0451853_3952381 | 3300041512 | Bacteria | 1099 |
| 201 | Ga0439431_0012935 | 3300041997 | Bacteria | 1922 |
| 202 | Ga0439433_0000297 | 3300041999 | Bacteria | 8590 |
| 203 | Ga0439432_000674 | 3300042006 | Bacteria | 12782 |
| 204 | Ga0439449_0004068 | 3300042007 | Bacteria | 5660 |
| 205 | Ga0439455_0029709 | 3300042012 | Bacteria | 1352 |
| 206 | Ga0439457_011672 | 3300042014 | Bacteria | 1992 |
| 207 | Ga0439462_0006984 | 3300042015 | Bacteria | 2819 |
| 208 | Ga0439446_0027186 | 3300042156 | Bacteria | 1641 |
| 209 | Ga0439434_0006337 | 3300042435 | Bacteria | 3450 |
| 210 | Ga0439459_0049783 | 3300042438 | Bacteria | 916 |
| 211 | Ga0466972_0000828 | 3300044658 | Bacteria | 14809 |
| 212 | Ga0466965_0052829 | 3300044683 | Bacteria | 2019 |
| 213 | Ga0466966_0337555 | 3300044684 | Bacteria | 905 |
| 214 | Ga0466961_0048056 | 3300044693 | Bacteria | 2727 |
| 215 | Ga0466964_0017252 | 3300044706 | Bacteria | 2763 |
| 216 | Ga0466964_0218956 | 3300044706 | Bacteria | 923 |
| 217 | Ga0453684_0134527 | 3300044712 | Bacteria | 2962 |
| 218 | Ga0466971_0005612 | 3300044719 | Bacteria | 5456 |
| 219 | Ga0466957_0124533 | 3300044842 | Bacteria | 1646 |
| 220 | Ga0466959_0012248 | 3300045049 | Bacteria | 6189 |
| 221 | Ga0451576_0006110 | 3300045051 | Bacteria | 14839 |
| 222 | Ga0451576_0167234 | 3300045051 | Bacteria | 2295 |
| 223 | Ga0495590_0027037 | 3300046457 | Bacteria | 2014 |
| 224 | Ga0495650_0087464 | 3300046471 | Bacteria | 1191 |
| 225 | Ga0495605_0162870 | 3300046474 | Bacteria | 989 |
| 226 | Ga0495583_0058798 | 3300046506 | Bacteria | 1725 |
| 227 | Ga0495610_0162346 | 3300046512 | Bacteria | 943 |
| 228 | Ga0495632_0079150 | 3300046519 | Bacteria | 1569 |
| 229 | Ga0495643_0109876 | 3300046522 | Bacteria | 1403 |
| 230 | Ga0495666_0216814 | 3300046526 | Bacteria | 877 |
| 231 | Ga0495621_0092295 | 3300046539 | Bacteria | 1142 |
| 232 | Ga0495597_0066742 | 3300046542 | Bacteria | 1558 |
| 233 | Ga0495597_0111863 | 3300046542 | Bacteria | 1144 |
| 234 | Ga0495611_0147396 | 3300046648 | Bacteria | 1099 |
| 235 | Ga0495625_0248465 | 3300046660 | Bacteria | 1155 |
| 236 | Ga0495659_0102851 | 3300046664 | Bacteria | 1108 |
| 237 | Ga0495624_0174588 | 3300046690 | Bacteria | 1310 |
| 238 | Ga0495649_0002161 | 3300046694 | Bacteria | 14071 |
| 239 | Ga0495687_001027 | 3300047443 | Bacteria | 27802 |
| 240 | Ga0495687_012737 | 3300047443 | Bacteria | 4430 |
| 241 | Ga0495679_073335 | 3300047446 | Bacteria | 982 |
| 242 | Ga0496102_0001594 | 3300048905 | Bacteria | 20010 |
| 243 | Ga0496102_1256820 | 3300048905 | Bacteria | 660 |
| 244 | Ga0496122_0142706 | 3300048925 | Bacteria | 1495 |
| 245 | Ga0501034_0258741 | 3300049571 | Bacteria | 1684 |
| 246 | Ga0501198_000001 | 3300049649 | Bacteria | 234552 |
| 247 | Ga0501222_000004 | 3300049662 | Bacteria | 136139 |
| 248 | nmdc:mga03683_41214_c1 | 3300050489 | Bacteria | 1896 |
| 249 | nmdc:mga03683_9751_c1 | 3300050489 | Bacteria | 2301 |
| 250 | nmdc:mga03n38_117295_c1 | 3300050490 | Bacteria | 1304 |
| 251 | nmdc:mga03n38_192775_c1 | 3300050490 | Bacteria | 1051 |
| 252 | nmdc:mga00v17_163685_c1 | 3300050491 | Bacteria | 1433 |
| 253 | nmdc:mga00v17_588910_c1 | 3300050491 | Bacteria | 718 |
| 254 | nmdc:mga0yw44_208621_c1 | 3300050492 | Bacteria | 1292 |
| 255 | nmdc:mga0k408_112526_c1 | 3300050493 | Bacteria | 1610 |
| 256 | nmdc:mga0k408_191030_c1 | 3300050493 | Bacteria | 1222 |
| 257 | nmdc:mga0k408_214782_c1 | 3300050493 | Bacteria | 1149 |
| 258 | nmdc:mga0k408_28233_c1 | 3300050493 | Bacteria | 3191 |
| 259 | nmdc:mga0k408_288662_c1 | 3300050493 | Bacteria | 979 |
| 260 | nmdc:mga0k408_565_c1 | 3300050493 | Bacteria | 20434 |
| 261 | nmdc:mga0k408_61278_c1 | 3300050493 | Bacteria | 2187 |
| 262 | nmdc:mga0k408_82129_c1 | 3300050493 | Bacteria | 1888 |
| 263 | nmdc:mga0k408_83755_c1 | 3300050493 | Bacteria | 1870 |
| 264 | nmdc:mga0k408_88978_c1 | 3300050493 | Bacteria | 1813 |
| 265 | nmdc:mga0k408_96999_c1 | 3300050493 | Bacteria | 1736 |
| 266 | nmdc:mga06z11_142983_c1 | 3300050494 | Bacteria | 1354 |
| 267 | nmdc:mga06z11_26746_c1 | 3300050494 | Bacteria | 2750 |
| 268 | nmdc:mga06z11_75830_c1 | 3300050494 | Bacteria | 1792 |
| 269 | nmdc:mga07m45_109271_c1 | 3300050496 | Bacteria | 1592 |
| 270 | nmdc:mga07m45_15044_c1 | 3300050496 | Bacteria | 4132 |
| 271 | nmdc:mga07m45_186498_c1 | 3300050496 | Bacteria | 1206 |
| 272 | nmdc:mga07m45_24515_c1 | 3300050496 | Bacteria | 3306 |
| 273 | nmdc:mga07m45_5077_c1 | 3300050496 | Bacteria | 6512 |
| 274 | nmdc:mga07m45_9342_c1 | 3300050496 | Bacteria | 5083 |
| 275 | nmdc:mga08y16_854343_c1 | 3300050511 | Bacteria | 899 |
| 276 | nmdc:mga0sz30_33107_c1 | 3300050516 | Bacteria | 2147 |
| 277 | Ga0500578_0056364 | 3300053086 | Bacteria | 2513 |
| 278 | Ga0500658_0001020 | 3300053134 | Bacteria | 11428 |
| 279 | Ga0500568_0001863 | 3300053139 | Bacteria | 12976 |
| 280 | Ga0500568_0043971 | 3300053139 | Bacteria | 1783 |
| 281 | Ga0500616_0220446 | 3300053153 | Bacteria | 828 |
| 282 | Ga0500645_030325 | 3300053730 | Bacteria | 1627 |
| 283 | Ga0590071_000228 | 3300059421 | Bacteria | 16440 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041509 | Ga0451843_0154138 | Ga0451843_0154138_36_593 | 171 |
| 2 | 3300050511 | nmdc:mga08y16_854343_c1 | nmdc:mga08y16_854343_c1_102_698 | 176 |
| 3 | 3300006195 | Ga0075366_10420153 | Ga0075366_104201532 | 177 |
| 4 | 3300005356 | Ga0070674_100147377 | Ga0070674_1001473773 | 178 |
| 5 | 3300025937 | Ga0207669_10055588 | Ga0207669_100555883 | 178 |
| 6 | 3300031730 | Ga0307516_10025523 | Ga0307516_100255237 | 178 |
| 7 | 3300041486 | Ga0451807_1230910 | Ga0451807_1230910_611_1213 | 179 |
| 8 | 3300025933 | Ga0207706_10004061 | Ga0207706_1000406117 | 180 |
| 9 | 3300046471 | Ga0495650_0087464 | Ga0495650_0087464_606_1172 | 182 |
| 10 | 3300048905 | Ga0496102_0001594 | Ga0496102_0001594_18889_19494 | 183 |
| 11 | 3300053139 | Ga0500568_0001863 | Ga0500568_0001863_4204_4755 | 183 |
| 12 | iso_pu_bacteria | 2932422444 | 2932424898 | 184 |
| 13 | 3300006051 | Ga0075364_10560764 | Ga0075364_105607641 | 185 |
| 14 | iso_pu_bacteria | 2643221639 | 2644217172 | 186 |
| 15 | iso_pu_bacteria | 2643221646 | 2644259055 | 186 |
| 16 | 3300035090 | Ga0373949_0164253 | Ga0373949_0164253_30_635 | 187 |
| 17 | 3300059421 | Ga0590071_000228 | Ga0590071_000228_12141_12794 | 188 |
| 18 | 3300006048 | Ga0075363_100540295 | Ga0075363_1005402951 | 189 |
| 19 | 3300003322 | rootL2_10014091 | rootL2_100140913 | 190 |
| 20 | 3300005577 | Ga0068857_100276548 | Ga0068857_1002765482 | 190 |
| 21 | 3300005614 | Ga0068856_100449837 | Ga0068856_1004498372 | 190 |
| 22 | 3300006195 | Ga0075366_10040158 | Ga0075366_100401584 | 190 |
| 23 | 3300006353 | Ga0075370_10142117 | Ga0075370_101421173 | 190 |
| 24 | 3300009174 | Ga0105241_10188932 | Ga0105241_101889321 | 190 |
| 25 | 3300009551 | Ga0105238_10922108 | Ga0105238_109221082 | 190 |
| 26 | 3300010375 | Ga0105239_10314478 | Ga0105239_103144783 | 190 |
| 27 | 3300014969 | Ga0157376_10036665 | Ga0157376_100366654 | 190 |
| 28 | 3300021361 | Ga0213872_10006949 | Ga0213872_100069495 | 190 |
| 29 | 3300025299 | Ga0209256_1032560 | Ga0209256_10325603 | 190 |
| 30 | 3300025911 | Ga0207654_10012244 | Ga0207654_100122445 | 190 |
| 31 | 3300025949 | Ga0207667_10137410 | Ga0207667_101374105 | 190 |
| 32 | 3300026023 | Ga0207677_10066199 | Ga0207677_100661993 | 190 |
| 33 | 3300026023 | Ga0207677_10408008 | Ga0207677_104080082 | 190 |
| 34 | 3300026116 | Ga0207674_10127087 | Ga0207674_101270873 | 190 |
| 35 | 3300034817 | Ga0373948_0009909 | Ga0373948_0009909_860_1471 | 190 |
| 36 | 3300034818 | Ga0373950_0053631 | Ga0373950_0053631_82_693 | 190 |
| 37 | 3300035091 | Ga0373951_0018243 | Ga0373951_0018243_838_1449 | 190 |
| 38 | 3300035114 | Ga0373939_0000820 | Ga0373939_0000820_5569_6180 | 190 |
| 39 | 3300035121 | Ga0373960_0000664 | Ga0373960_0000664_1238_1849 | 190 |
| 40 | 3300035242 | Ga0373962_0116696 | Ga0373962_0116696_10_621 | 190 |
| 41 | 3300035691 | Ga0373931_0000400 | Ga0373931_0000400_15732_16343 | 190 |
| 42 | 3300037471 | Ga0395905_0000071 | Ga0395905_0000071_84856_85470 | 190 |
| 43 | 3300039447 | Ga0436361_0334210 | Ga0436361_0334210_2762_3382 | 190 |
| 44 | 3300042438 | Ga0439459_0049783 | Ga0439459_0049783_236_841 | 190 |
| 45 | 3300045051 | Ga0451576_0167234 | Ga0451576_0167234_1300_1914 | 190 |
| 46 | 3300005331 | Ga0070670_100736486 | Ga0070670_1007364861 | 191 |
| 47 | 3300005333 | Ga0070677_10152164 | Ga0070677_101521642 | 191 |
| 48 | 3300005353 | Ga0070669_100065800 | Ga0070669_1000658002 | 191 |
| 49 | 3300005354 | Ga0070675_100075717 | Ga0070675_1000757175 | 191 |
| 50 | 3300005364 | Ga0070673_100074896 | Ga0070673_1000748965 | 191 |
| 51 | 3300005367 | Ga0070667_100482425 | Ga0070667_1004824252 | 191 |
| 52 | 3300005456 | Ga0070678_100120148 | Ga0070678_1001201483 | 191 |
| 53 | 3300006051 | Ga0075364_10186930 | Ga0075364_101869302 | 191 |
| 54 | 3300009177 | Ga0105248_10652537 | Ga0105248_106525373 | 191 |
| 55 | 3300014326 | Ga0157380_10124994 | Ga0157380_101249943 | 191 |
| 56 | 3300025893 | Ga0207682_10042471 | Ga0207682_100424712 | 191 |
| 57 | 3300025923 | Ga0207681_10045033 | Ga0207681_100450333 | 191 |
| 58 | 3300025925 | Ga0207650_10635553 | Ga0207650_106355532 | 191 |
| 59 | 3300025926 | Ga0207659_10202392 | Ga0207659_102023922 | 191 |
| 60 | 3300025933 | Ga0207706_10287821 | Ga0207706_102878213 | 191 |
| 61 | 3300028794 | Ga0307515_10106481 | Ga0307515_101064815 | 191 |
| 62 | 3300031456 | Ga0307513_10161899 | Ga0307513_101618993 | 191 |
| 63 | 3300031548 | Ga0307408_100205539 | Ga0307408_1002055393 | 191 |
| 64 | 3300031911 | Ga0307412_10501186 | Ga0307412_105011862 | 191 |
| 65 | 3300046539 | Ga0495621_0092295 | Ga0495621_0092295_211_828 | 191 |
| 66 | 3300050491 | nmdc:mga00v17_163685_c1 | nmdc:mga00v17_163685_c1_614_1231 | 191 |
| 67 | 3300032002 | Ga0307416_101079668 | Ga0307416_1010796682 | 192 |
| 68 | 3300044658 | Ga0466972_0000828 | Ga0466972_0000828_13029_13622 | 192 |
| 69 | 3300044683 | Ga0466965_0052829 | Ga0466965_0052829_358_951 | 192 |
| 70 | 3300044684 | Ga0466966_0337555 | Ga0466966_0337555_283_873 | 192 |
| 71 | 3300044693 | Ga0466961_0048056 | Ga0466961_0048056_1351_1941 | 192 |
| 72 | 3300044706 | Ga0466964_0017252 | Ga0466964_0017252_492_1082 | 192 |
| 73 | 3300044706 | Ga0466964_0218956 | Ga0466964_0218956_201_794 | 192 |
| 74 | 3300044719 | Ga0466971_0005612 | Ga0466971_0005612_548_1138 | 192 |
| 75 | 3300044842 | Ga0466957_0124533 | Ga0466957_0124533_610_1200 | 192 |
| 76 | 3300045049 | Ga0466959_0012248 | Ga0466959_0012248_527_1117 | 192 |
| 77 | 3300048905 | Ga0496102_1256820 | Ga0496102_1256820_27_632 | 192 |
| 78 | 3300050493 | nmdc:mga0k408_82129_c1 | nmdc:mga0k408_82129_c1_456_1070 | 192 |
| 79 | 3300031911 | Ga0307412_10676649 | Ga0307412_106766492 | 193 |
| 80 | 3300003784 | Ga0055534_1004816 | Ga0055534_10048165 | 194 |
| 81 | 3300011119 | Ga0105246_10502471 | Ga0105246_105024712 | 194 |
| 82 | 3300017792 | Ga0163161_10170391 | Ga0163161_101703913 | 194 |
| 83 | 3300025273 | Ga0209673_1021783 | Ga0209673_10217833 | 194 |
| 84 | 3300025273 | Ga0209673_1061473 | Ga0209673_10614731 | 194 |
| 85 | 3300025284 | Ga0209130_1003855 | Ga0209130_10038553 | 194 |
| 86 | 3300025291 | Ga0209675_1009058 | Ga0209675_10090585 | 194 |
| 87 | 3300025292 | Ga0209676_1022171 | Ga0209676_10221713 | 194 |
| 88 | 3300025303 | Ga0209051_1010699 | Ga0209051_10106993 | 194 |
| 89 | 3300025304 | Ga0209257_1010069 | Ga0209257_10100693 | 194 |
| 90 | 3300041997 | Ga0439431_0012935 | Ga0439431_0012935_1079_1699 | 194 |
| 91 | 3300044712 | Ga0453684_0134527 | Ga0453684_0134527_513_1106 | 194 |
| 92 | 3300045051 | Ga0451576_0006110 | Ga0451576_0006110_680_1273 | 194 |
| 93 | 3300046664 | Ga0495659_0102851 | Ga0495659_0102851_55_669 | 194 |
| 94 | 3300006048 | Ga0075363_100081544 | Ga0075363_1000815443 | 195 |
| 95 | 3300006195 | Ga0075366_10002896 | Ga0075366_1000289611 | 195 |
| 96 | 3300041404 | Ga0439436_0006509 | Ga0439436_0006509_647_1273 | 195 |
| 97 | 3300041410 | Ga0439461_0008859 | Ga0439461_0008859_495_1121 | 195 |
| 98 | 3300041411 | Ga0439466_0030929 | Ga0439466_0030929_712_1338 | 195 |
| 99 | 3300041413 | Ga0439465_0000677 | Ga0439465_0000677_9784_10410 | 195 |
| 100 | 3300041999 | Ga0439433_0000297 | Ga0439433_0000297_7201_7827 | 195 |
| 101 | 3300042006 | Ga0439432_000674 | Ga0439432_000674_1241_1867 | 195 |
| 102 | 3300042007 | Ga0439449_0004068 | Ga0439449_0004068_4205_4831 | 195 |
| 103 | 3300042014 | Ga0439457_011672 | Ga0439457_011672_965_1591 | 195 |
| 104 | 3300042015 | Ga0439462_0006984 | Ga0439462_0006984_1742_2368 | 195 |
| 105 | 3300042156 | Ga0439446_0027186 | Ga0439446_0027186_871_1497 | 195 |
| 106 | 3300042435 | Ga0439434_0006337 | Ga0439434_0006337_1001_1627 | 195 |
| 107 | 3300049571 | Ga0501034_0258741 | Ga0501034_0258741_314_934 | 195 |
| 108 | 3300049649 | Ga0501198_000001 | Ga0501198_000001_77162_77782 | 195 |
| 109 | 3300049662 | Ga0501222_000004 | Ga0501222_000004_66138_66758 | 195 |
| 110 | 3300050489 | nmdc:mga03683_41214_c1 | nmdc:mga03683_41214_c1_402_1025 | 195 |
| 111 | 3300050490 | nmdc:mga03n38_117295_c1 | nmdc:mga03n38_117295_c1_127_750 | 195 |
| 112 | 3300050496 | nmdc:mga07m45_15044_c1 | nmdc:mga07m45_15044_c1_2337_2960 | 195 |
| 113 | iso_pu_bacteria | 2643221654 | 2644302997 | 195 |
| 114 | 3300031730 | Ga0307516_10145775 | Ga0307516_101457753 | 196 |
| 115 | 3300005356 | Ga0070674_100342428 | Ga0070674_1003424282 | 197 |
| 116 | 3300005367 | Ga0070667_100000849 | Ga0070667_1000008492 | 197 |
| 117 | 3300006195 | Ga0075366_10130191 | Ga0075366_101301912 | 197 |
| 118 | 3300006353 | Ga0075370_10096275 | Ga0075370_100962753 | 197 |
| 119 | 3300013308 | Ga0157375_10159070 | Ga0157375_101590703 | 197 |
| 120 | 3300025937 | Ga0207669_10277157 | Ga0207669_102771571 | 197 |
| 121 | 3300025986 | Ga0207658_10000968 | Ga0207658_1000096816 | 197 |
| 122 | 3300028381 | Ga0268264_10291478 | Ga0268264_102914781 | 197 |
| 123 | 3300035695 | Ga0373927_0359966 | Ga0373927_0359966_173_823 | 197 |
| 124 | 3300037068 | Ga0373925_0066461 | Ga0373925_0066461_924_1574 | 197 |
| 125 | 3300050493 | nmdc:mga0k408_191030_c1 | nmdc:mga0k408_191030_c1_251_844 | 197 |
| 126 | 3300005458 | Ga0070681_10742049 | Ga0070681_107420492 | 198 |
| 127 | 3300005577 | Ga0068857_100473080 | Ga0068857_1004730802 | 198 |
| 128 | 3300006038 | Ga0075365_10085342 | Ga0075365_100853422 | 198 |
| 129 | 3300006048 | Ga0075363_100010995 | Ga0075363_1000109953 | 198 |
| 130 | 3300006051 | Ga0075364_10132666 | Ga0075364_101326663 | 198 |
| 131 | 3300006177 | Ga0075362_10031183 | Ga0075362_100311833 | 198 |
| 132 | 3300006178 | Ga0075367_10064695 | Ga0075367_100646953 | 198 |
| 133 | 3300006186 | Ga0075369_10019440 | Ga0075369_100194403 | 198 |
| 134 | 3300006195 | Ga0075366_10102003 | Ga0075366_101020032 | 198 |
| 135 | 3300026116 | Ga0207674_10597104 | Ga0207674_105971043 | 198 |
| 136 | 3300026118 | Ga0207675_100363134 | Ga0207675_1003631343 | 198 |
| 137 | 3300028794 | Ga0307515_10050900 | Ga0307515_100509008 | 198 |
| 138 | 3300046660 | Ga0495625_0248465 | Ga0495625_0248465_141_737 | 198 |
| 139 | 3300050489 | nmdc:mga03683_9751_c1 | nmdc:mga03683_9751_c1_889_1485 | 198 |
| 140 | 3300050490 | nmdc:mga03n38_192775_c1 | nmdc:mga03n38_192775_c1_37_633 | 198 |
| 141 | 3300050491 | nmdc:mga00v17_588910_c1 | nmdc:mga00v17_588910_c1_71_667 | 198 |
| 142 | 3300050492 | nmdc:mga0yw44_208621_c1 | nmdc:mga0yw44_208621_c1_462_1058 | 198 |
| 143 | 3300050493 | nmdc:mga0k408_565_c1 | nmdc:mga0k408_565_c1_15374_15970 | 198 |
| 144 | 3300050493 | nmdc:mga0k408_565_c1 | nmdc:mga0k408_565_c1_17605_18201 | 198 |
| 145 | 3300050493 | nmdc:mga0k408_61278_c1 | nmdc:mga0k408_61278_c1_909_1505 | 198 |
| 146 | 3300050493 | nmdc:mga0k408_96999_c1 | nmdc:mga0k408_96999_c1_806_1402 | 198 |
| 147 | 3300050494 | nmdc:mga06z11_26746_c1 | nmdc:mga06z11_26746_c1_660_1256 | 198 |
| 148 | 3300050496 | nmdc:mga07m45_9342_c1 | nmdc:mga07m45_9342_c1_692_1288 | 198 |
| 149 | 3300050516 | nmdc:mga0sz30_33107_c1 | nmdc:mga0sz30_33107_c1_616_1212 | 198 |
| 150 | 3300005457 | Ga0070662_100434591 | Ga0070662_1004345912 | 199 |
| 151 | 3300005459 | Ga0068867_100441640 | Ga0068867_1004416401 | 199 |
| 152 | 3300005548 | Ga0070665_100015847 | Ga0070665_10001584710 | 199 |
| 153 | 3300005842 | Ga0068858_100604392 | Ga0068858_1006043923 | 199 |
| 154 | 3300006237 | Ga0097621_100294142 | Ga0097621_1002941423 | 199 |
| 155 | 3300013297 | Ga0157378_10167904 | Ga0157378_101679043 | 199 |
| 156 | 3300026089 | Ga0207648_10305735 | Ga0207648_103057352 | 199 |
| 157 | 3300026121 | Ga0207683_10234558 | Ga0207683_102345583 | 199 |
| 158 | 3300028379 | Ga0268266_10015567 | Ga0268266_100155673 | 199 |
| 159 | 3300031507 | Ga0307509_10201271 | Ga0307509_102012713 | 199 |
| 160 | 3300031507 | Ga0307509_10391914 | Ga0307509_103919142 | 199 |
| 161 | 3300031649 | Ga0307514_10047634 | Ga0307514_100476341 | 199 |
| 162 | 3300031730 | Ga0307516_10436849 | Ga0307516_104368492 | 199 |
| 163 | 3300033179 | Ga0307507_10144590 | Ga0307507_101445903 | 199 |
| 164 | 3300033180 | Ga0307510_10067163 | Ga0307510_100671633 | 199 |
| 165 | 3300033180 | Ga0307510_10135657 | Ga0307510_101356572 | 199 |
| 166 | 3300035112 | Ga0373932_0005873 | Ga0373932_0005873_1115_1729 | 199 |
| 167 | 3300035121 | Ga0373960_0121165 | Ga0373960_0121165_177_791 | 199 |
| 168 | 3300035691 | Ga0373931_0072407 | Ga0373931_0072407_324_938 | 199 |
| 169 | 3300046522 | Ga0495643_0109876 | Ga0495643_0109876_424_1029 | 199 |
| 170 | 3300046526 | Ga0495666_0216814 | Ga0495666_0216814_65_679 | 199 |
| 171 | 3300046542 | Ga0495597_0066742 | Ga0495597_0066742_419_1024 | 199 |
| 172 | 3300046690 | Ga0495624_0174588 | Ga0495624_0174588_31_645 | 199 |
| 173 | 3300050496 | nmdc:mga07m45_109271_c1 | nmdc:mga07m45_109271_c1_547_1149 | 199 |
| 174 | 3300053086 | Ga0500578_0056364 | Ga0500578_0056364_1159_1812 | 199 |
| 175 | 3300053153 | Ga0500616_0220446 | Ga0500616_0220446_49_666 | 199 |
| 176 | 3300053730 | Ga0500645_030325 | Ga0500645_030325_765_1418 | 199 |
| 177 | 3300005331 | Ga0070670_100161802 | Ga0070670_1001618023 | 200 |
| 178 | 3300005334 | Ga0068869_100076606 | Ga0068869_1000766062 | 200 |
| 179 | 3300005338 | Ga0068868_100031382 | Ga0068868_1000313826 | 200 |
| 180 | 3300005338 | Ga0068868_100238822 | Ga0068868_1002388221 | 200 |
| 181 | 3300005354 | Ga0070675_100026794 | Ga0070675_1000267942 | 200 |
| 182 | 3300005355 | Ga0070671_100022927 | Ga0070671_1000229273 | 200 |
| 183 | 3300005355 | Ga0070671_100032504 | Ga0070671_1000325046 | 200 |
| 184 | 3300005364 | Ga0070673_100057388 | Ga0070673_1000573883 | 200 |
| 185 | 3300005457 | Ga0070662_100394636 | Ga0070662_1003946362 | 200 |
| 186 | 3300005543 | Ga0070672_100045399 | Ga0070672_1000453994 | 200 |
| 187 | 3300005548 | Ga0070665_100529000 | Ga0070665_1005290001 | 200 |
| 188 | 3300005618 | Ga0068864_100216749 | Ga0068864_1002167492 | 200 |
| 189 | 3300005841 | Ga0068863_100057481 | Ga0068863_1000574813 | 200 |
| 190 | 3300005843 | Ga0068860_100206781 | Ga0068860_1002067813 | 200 |
| 191 | 3300005843 | Ga0068860_100217301 | Ga0068860_1002173012 | 200 |
| 192 | 3300006195 | Ga0075366_10052045 | Ga0075366_100520453 | 200 |
| 193 | 3300006195 | Ga0075366_10376523 | Ga0075366_103765232 | 200 |
| 194 | 3300006353 | Ga0075370_10003402 | Ga0075370_100034028 | 200 |
| 195 | 3300009101 | Ga0105247_10347159 | Ga0105247_103471593 | 200 |
| 196 | 3300009174 | Ga0105241_10218303 | Ga0105241_102183032 | 200 |
| 197 | 3300009553 | Ga0105249_10131900 | Ga0105249_101319003 | 200 |
| 198 | 3300011119 | Ga0105246_10113326 | Ga0105246_101133263 | 200 |
| 199 | 3300013297 | Ga0157378_10923827 | Ga0157378_109238271 | 200 |
| 200 | 3300014325 | Ga0163163_10381814 | Ga0163163_103818142 | 200 |
| 201 | 3300025907 | Ga0207645_10136557 | Ga0207645_101365573 | 200 |
| 202 | 3300025908 | Ga0207643_10056377 | Ga0207643_100563773 | 200 |
| 203 | 3300025911 | Ga0207654_10125864 | Ga0207654_101258641 | 200 |
| 204 | 3300025925 | Ga0207650_10258255 | Ga0207650_102582552 | 200 |
| 205 | 3300025926 | Ga0207659_10023849 | Ga0207659_100238497 | 200 |
| 206 | 3300025927 | Ga0207687_10368897 | Ga0207687_103688971 | 200 |
| 207 | 3300025931 | Ga0207644_10033631 | Ga0207644_100336313 | 200 |
| 208 | 3300025931 | Ga0207644_10563207 | Ga0207644_105632071 | 200 |
| 209 | 3300025938 | Ga0207704_10215010 | Ga0207704_102150103 | 200 |
| 210 | 3300025940 | Ga0207691_10061139 | Ga0207691_100611394 | 200 |
| 211 | 3300025942 | Ga0207689_10397926 | Ga0207689_103979262 | 200 |
| 212 | 3300025961 | Ga0207712_10129949 | Ga0207712_101299493 | 200 |
| 213 | 3300025986 | Ga0207658_10284933 | Ga0207658_102849333 | 200 |
| 214 | 3300026023 | Ga0207677_10022994 | Ga0207677_100229946 | 200 |
| 215 | 3300026023 | Ga0207677_10094389 | Ga0207677_100943893 | 200 |
| 216 | 3300026088 | Ga0207641_10105723 | Ga0207641_101057235 | 200 |
| 217 | 3300026089 | Ga0207648_10007326 | Ga0207648_100073267 | 200 |
| 218 | 3300026095 | Ga0207676_10046391 | Ga0207676_100463915 | 200 |
| 219 | 3300026116 | Ga0207674_10041528 | Ga0207674_100415283 | 200 |
| 220 | 3300028379 | Ga0268266_10637052 | Ga0268266_106370521 | 200 |
| 221 | 3300028381 | Ga0268264_10758023 | Ga0268264_107580233 | 200 |
| 222 | 3300028786 | Ga0307517_10170927 | Ga0307517_101709272 | 200 |
| 223 | 3300028794 | Ga0307515_10038558 | Ga0307515_100385583 | 200 |
| 224 | 3300041507 | Ga0451851_0950883 | Ga0451851_0950883_339_992 | 200 |
| 225 | 3300041512 | Ga0451853_1029036 | Ga0451853_1029036_603_1247 | 200 |
| 226 | 3300041512 | Ga0451853_3952381 | Ga0451853_3952381_387_1013 | 200 |
| 227 | 3300048925 | Ga0496122_0142706 | Ga0496122_0142706_426_1082 | 200 |
| 228 | 3300050493 | nmdc:mga0k408_288662_c1 | nmdc:mga0k408_288662_c1_272_895 | 200 |
| 229 | 3300050493 | nmdc:mga0k408_83755_c1 | nmdc:mga0k408_83755_c1_618_1262 | 200 |
| 230 | 3300050493 | nmdc:mga0k408_88978_c1 | nmdc:mga0k408_88978_c1_537_1139 | 200 |
| 231 | 3300050496 | nmdc:mga07m45_24515_c1 | nmdc:mga07m45_24515_c1_2421_3023 | 200 |
| 232 | 3300006178 | Ga0075367_10385674 | Ga0075367_103856741 | 201 |
| 233 | 3300006353 | Ga0075370_10020265 | Ga0075370_100202655 | 201 |
| 234 | 3300031911 | Ga0307412_10198827 | Ga0307412_101988272 | 201 |
| 235 | 3300041413 | Ga0439465_0114067 | Ga0439465_0114067_57_698 | 201 |
| 236 | 3300047443 | Ga0495687_001027 | Ga0495687_001027_550_1155 | 201 |
| 237 | 3300050493 | nmdc:mga0k408_28233_c1 | nmdc:mga0k408_28233_c1_1204_1809 | 201 |
| 238 | 3300050496 | nmdc:mga07m45_186498_c1 | nmdc:mga07m45_186498_c1_252_890 | 201 |
| 239 | 3300050496 | nmdc:mga07m45_5077_c1 | nmdc:mga07m45_5077_c1_5083_5688 | 201 |
| 240 | 3300017792 | Ga0163161_10328294 | Ga0163161_103282942 | 202 |
| 241 | 3300046457 | Ga0495590_0027037 | Ga0495590_0027037_783_1391 | 202 |
| 242 | 3300046474 | Ga0495605_0162870 | Ga0495605_0162870_272_880 | 202 |
| 243 | 3300046506 | Ga0495583_0058798 | Ga0495583_0058798_586_1194 | 202 |
| 244 | 3300046512 | Ga0495610_0162346 | Ga0495610_0162346_242_850 | 202 |
| 245 | 3300046519 | Ga0495632_0079150 | Ga0495632_0079150_924_1532 | 202 |
| 246 | 3300046542 | Ga0495597_0111863 | Ga0495597_0111863_79_687 | 202 |
| 247 | 3300046648 | Ga0495611_0147396 | Ga0495611_0147396_436_1044 | 202 |
| 248 | 3300046694 | Ga0495649_0002161 | Ga0495649_0002161_12905_13513 | 202 |
| 249 | 3300047443 | Ga0495687_012737 | Ga0495687_012737_2264_2872 | 202 |
| 250 | 3300047446 | Ga0495679_073335 | Ga0495679_073335_87_695 | 202 |
| 251 | 3300053134 | Ga0500658_0001020 | Ga0500658_0001020_5395_6003 | 202 |
| 252 | 3300053139 | Ga0500568_0043971 | Ga0500568_0043971_801_1409 | 202 |
| 253 | 3300005335 | Ga0070666_10704224 | Ga0070666_107042241 | 204 |
| 254 | 3300005339 | Ga0070660_100195911 | Ga0070660_1001959113 | 204 |
| 255 | 3300005457 | Ga0070662_100035242 | Ga0070662_1000352425 | 204 |
| 256 | 3300005577 | Ga0068857_100006256 | Ga0068857_10000625611 | 204 |
| 257 | 3300005578 | Ga0068854_100088737 | Ga0068854_1000887373 | 204 |
| 258 | 3300005617 | Ga0068859_100292956 | Ga0068859_1002929563 | 204 |
| 259 | 3300006042 | Ga0075368_10064428 | Ga0075368_100644283 | 204 |
| 260 | 3300006051 | Ga0075364_10086015 | Ga0075364_100860153 | 204 |
| 261 | 3300006186 | Ga0075369_10173978 | Ga0075369_101739782 | 204 |
| 262 | 3300006931 | Ga0097620_100292949 | Ga0097620_1002929493 | 204 |
| 263 | 3300009098 | Ga0105245_10259217 | Ga0105245_102592173 | 204 |
| 264 | 3300009174 | Ga0105241_11090679 | Ga0105241_110906791 | 204 |
| 265 | 3300009545 | Ga0105237_10026456 | Ga0105237_100264568 | 204 |
| 266 | 3300010375 | Ga0105239_10165522 | Ga0105239_101655223 | 204 |
| 267 | 3300025914 | Ga0207671_10020453 | Ga0207671_100204537 | 204 |
| 268 | 3300025933 | Ga0207706_10056290 | Ga0207706_100562905 | 204 |
| 269 | 3300025960 | Ga0207651_10088441 | Ga0207651_100884413 | 204 |
| 270 | 3300025972 | Ga0207668_10103233 | Ga0207668_101032333 | 204 |
| 271 | 3300026116 | Ga0207674_10137753 | Ga0207674_101377533 | 204 |
| 272 | 3300026142 | Ga0207698_10281107 | Ga0207698_102811072 | 204 |
| 273 | 3300042012 | Ga0439455_0029709 | Ga0439455_0029709_496_1110 | 204 |
| 274 | 3300050493 | nmdc:mga0k408_112526_c1 | nmdc:mga0k408_112526_c1_353_967 | 204 |
| 275 | 3300050494 | nmdc:mga06z11_75830_c1 | nmdc:mga06z11_75830_c1_537_1151 | 204 |
| 276 | 3300005445 | Ga0070708_100457523 | Ga0070708_1004575232 | 205 |
| 277 | 3300005467 | Ga0070706_100135767 | Ga0070706_1001357673 | 205 |
| 278 | 3300005468 | Ga0070707_100007656 | Ga0070707_1000076563 | 205 |
| 279 | 3300005471 | Ga0070698_100217278 | Ga0070698_1002172783 | 205 |
| 280 | 3300005518 | Ga0070699_101060953 | Ga0070699_1010609531 | 205 |
| 281 | 3300005841 | Ga0068863_100708363 | Ga0068863_1007083632 | 205 |
| 282 | 3300006178 | Ga0075367_10006801 | Ga0075367_100068013 | 205 |
| 283 | 3300006186 | Ga0075369_10080316 | Ga0075369_100803162 | 205 |
| 284 | 3300006353 | Ga0075370_10031870 | Ga0075370_100318703 | 205 |
| 285 | 3300025910 | Ga0207684_10018036 | Ga0207684_100180368 | 205 |
| 286 | 3300050493 | nmdc:mga0k408_214782_c1 | nmdc:mga0k408_214782_c1_92_709 | 205 |
| 287 | 3300050494 | nmdc:mga06z11_142983_c1 | nmdc:mga06z11_142983_c1_359_976 | 205 |
| 288 | 3300003316 | rootH1_10036704 | rootH1_100367042 | 206 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar