F388481

General Info

Members Datasets Scaffolds Average Seq Length
288 184 574 406

Family's Representative Sequence

Representative Sequence 3300005718|Ga0068866_10012614|Ga0068866_100126143
Length 439
Sequence MARWTGGLPFCNVPPITSGDVHMTKVAKTALLVALLSGGAYAPVAAQVNAGDQKPEANVPFNMTSVTTFNLPWRLAFLPDGRMLVTEKVGPIWLVTQQGMKRPVLNYPASLYGGQGGMLGIYTSPNFATDNTVYLTYSEPGTIGGISGSSLALAKAKLVLNDSATPATASLENLQVIWRDGARGRGGQFGAAVVFAQDGKSLFLTVGDRQRFWPAQDPNQPLGKILHLTLDGKPAADNPNFGKTGTASVGIINPPSDTEAGKTAPVVYTYKFPGKNETPSEVWSTGHRTPYGMAMAPDGRLWEMEHGPKGGDELNLIEKGKNYGWPLVRFATNYNGVPIPGFDTRPDLQKPVIYWTPIIAPGSITFYKGNVFPQWNGSILMGGMATMTINRIVVDGAQAHPAERWSVGHRIRDIEVAPDGSVWALEDSTTGGLFKITPK

Samples

Sample ID Description Type Environment
1 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
114 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
115 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
116 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
117 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
118 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
119 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
120 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
121 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
122 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
125 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
139 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
180 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
181 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
182 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0
Rhizoplane 3.82
Rhizosphere 94.1
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068866_10012614 3300005718 Bacteria 3686
2 Ga0065714_10009773 3300005288 Bacteria 2559
3 Ga0065704_10107247 3300005289 Bacteria 2060
4 Ga0065712_10068924 3300005290 Bacteria 8569
5 Ga0065712_10075531 3300005290 Bacteria 3841
6 Ga0065712_10086331 3300005290 Bacteria 2642
7 Ga0065715_10090572 3300005293 Bacteria 6810
8 Ga0065715_10114933 3300005293 Bacteria 2413
9 Ga0065715_10125559 3300005293 Bacteria 2128
10 Ga0065715_10148064 3300005293 Bacteria 1763
11 Ga0065707_10100031 3300005295 Bacteria 2961
12 Ga0070676_10007338 3300005328 Bacteria 5914
13 Ga0070683_100014110 3300005329 Bacteria 6977
14 Ga0070683_100038129 3300005329 Bacteria 4402
15 Ga0070683_100067324 3300005329 Bacteria 3336
16 Ga0070690_100042151 3300005330 Bacteria 2891
17 Ga0070690_100204803 3300005330 Bacteria 1375
18 Ga0070670_100017511 3300005331 Bacteria 6148
19 Ga0070670_100062644 3300005331 Bacteria 3193
20 Ga0070670_100253970 3300005331 Bacteria 1532
21 Ga0070666_10028878 3300005335 Bacteria 3643
22 Ga0070680_100002842 3300005336 Bacteria 12871
23 Ga0068868_100017704 3300005338 Bacteria 5313
24 Ga0070689_100044089 3300005340 Bacteria 3431
25 Ga0070691_10031842 3300005341 Bacteria 2475
26 Ga0070661_100029325 3300005344 Bacteria 3971
27 Ga0070668_100087417 3300005347 Bacteria 2453
28 Ga0070669_100000996 3300005353 Bacteria 20632
29 Ga0070669_100060668 3300005353 Bacteria 2778
30 Ga0070669_100153108 3300005353 Bacteria 1786
31 Ga0070675_100009403 3300005354 Bacteria 7605
32 Ga0070675_100040931 3300005354 Bacteria 3785
33 Ga0070675_100060114 3300005354 Bacteria 3137
34 Ga0070673_100168380 3300005364 Bacteria 1869
35 Ga0070688_100016871 3300005365 Bacteria 4182
36 Ga0070688_100101983 3300005365 Bacteria 1894
37 Ga0070663_100202682 3300005455 Bacteria 1549
38 Ga0070678_100295075 3300005456 Bacteria 1376
39 Ga0070681_10000196 3300005458 Bacteria 47237
40 Ga0070681_10033509 3300005458 Bacteria 5157
41 Ga0068867_100009911 3300005459 Bacteria 6714
42 Ga0068867_100025484 3300005459 Bacteria 4243
43 Ga0070685_10150187 3300005466 Bacteria 1476
44 Ga0070699_100058086 3300005518 Bacteria 3351
45 Ga0070679_100002592 3300005530 Bacteria 16431
46 Ga0070679_100098313 3300005530 Bacteria 2914
47 Ga0070679_100150882 3300005530 Bacteria 2301
48 Ga0070684_100000791 3300005535 Bacteria 21972
49 Ga0070684_100083505 3300005535 Bacteria 2830
50 Ga0070695_100015085 3300005545 Bacteria 4664
51 Ga0070665_100030034 3300005548 Bacteria 5469
52 Ga0070704_100180522 3300005549 Bacteria 1688
53 Ga0070664_100000260 3300005564 Bacteria 38073
54 Ga0068857_100001599 3300005577 Bacteria 18186
55 Ga0068857_100078385 3300005577 Bacteria 2949
56 Ga0068854_100090266 3300005578 Bacteria 2278
57 Ga0068856_100114929 3300005614 Bacteria 2690
58 Ga0070702_100094796 3300005615 Bacteria 1818
59 Ga0068852_100076836 3300005616 Bacteria 2949
60 Ga0068859_100149503 3300005617 Bacteria 2411
61 Ga0068859_100226699 3300005617 Bacteria 1957
62 Ga0068864_100016616 3300005618 Bacteria 6129
63 Ga0068864_100024241 3300005618 Bacteria 5103
64 Ga0068864_100045125 3300005618 Bacteria 3780
65 Ga0068870_10075502 3300005840 Bacteria 1849
66 Ga0068863_100003325 3300005841 Bacteria 15881
67 Ga0068863_100160233 3300005841 Bacteria 2155
68 Ga0068863_100197724 3300005841 Bacteria 1933
69 Ga0068858_100005254 3300005842 Bacteria 12688
70 Ga0068858_100167997 3300005842 Bacteria 2068
71 Ga0068858_100190288 3300005842 Bacteria 1939
72 Ga0068860_100029327 3300005843 Bacteria 5292
73 Ga0068862_100002473 3300005844 Bacteria 16357
74 Ga0068862_100194157 3300005844 Bacteria 1828
75 Ga0081455_10168975 3300005937 Bacteria 1668
76 Ga0075432_10027895 3300006058 Bacteria 1946
77 Ga0097621_100000230 3300006237 Bacteria 37430
78 Ga0097621_100013409 3300006237 Bacteria 6110
79 Ga0097621_100068409 3300006237 Bacteria 2929
80 Ga0097621_100080380 3300006237 Bacteria 2711
81 Ga0068871_100000019 3300006358 Bacteria 86487
82 Ga0068871_100016899 3300006358 Bacteria 5508
83 Ga0068871_100047132 3300006358 Bacteria 3474
84 Ga0068871_100135656 3300006358 Bacteria 2090
85 Ga0075428_100018120 3300006844 Bacteria 7780
86 Ga0075428_100057330 3300006844 Bacteria 4264
87 Ga0075428_100084946 3300006844 Bacteria 3452
88 Ga0075433_10008323 3300006852 Bacteria 8270
89 Ga0075433_10026993 3300006852 Bacteria 4867
90 Ga0075433_10047340 3300006852 Bacteria 3740
91 Ga0075434_100012480 3300006871 Bacteria 8057
92 Ga0075434_100187266 3300006871 Bacteria 2090
93 Ga0075436_100000687 3300006914 Bacteria 22291
94 Ga0097620_100149512 3300006931 Bacteria 2411
95 Ga0097620_100226709 3300006931 Bacteria 1957
96 Ga0075435_100000063 3300007076 Bacteria 54855
97 Ga0075435_100012774 3300007076 Bacteria 6221
98 Ga0111539_10001064 3300009094 Bacteria 36182
99 Ga0111539_10049272 3300009094 Bacteria 5024
100 Ga0111539_10081597 3300009094 Bacteria 3804
101 Ga0111539_10348382 3300009094 Bacteria 1724
102 Ga0105245_10034877 3300009098 Bacteria 4464
103 Ga0114129_10005180 3300009147 Bacteria 18354
104 Ga0114129_10026356 3300009147 Bacteria 8230
105 Ga0114129_10052749 3300009147 Bacteria 5707
106 Ga0114129_10247524 3300009147 Bacteria 2394
107 Ga0114129_10248051 3300009147 Bacteria 2391
108 Ga0105243_10002319 3300009148 Bacteria 15944
109 Ga0105241_10002438 3300009174 Bacteria 13963
110 Ga0105242_10014962 3300009176 Bacteria 6015
111 Ga0105242_10063282 3300009176 Bacteria 3047
112 Ga0105248_10008829 3300009177 Bacteria 11070
113 Ga0105248_10130543 3300009177 Bacteria 2835
114 Ga0105248_10216096 3300009177 Bacteria 2159
115 Ga0105237_10144432 3300009545 Bacteria 2374
116 Ga0105237_10181902 3300009545 Bacteria 2102
117 Ga0105238_10006238 3300009551 Bacteria 11846
118 Ga0105238_10053016 3300009551 Bacteria 4077
119 Ga0105238_10105416 3300009551 Bacteria 2801
120 Ga0105249_10235386 3300009553 Bacteria 1808
121 Ga0105249_10286607 3300009553 Bacteria 1647
122 Ga0105246_10053435 3300011119 Bacteria 2780
123 Ga0105246_10094567 3300011119 Bacteria 2162
124 Ga0105246_10243531 3300011119 Bacteria 1423
125 Ga0157371_10006858 3300013102 Bacteria 9300
126 Ga0157369_10078957 3300013105 Bacteria 3525
127 Ga0157374_10012119 3300013296 Bacteria 7488
128 Ga0157378_10044885 3300013297 Bacteria 3925
129 Ga0163162_10006253 3300013306 Bacteria 11543
130 Ga0163162_10029778 3300013306 Bacteria 5404
131 Ga0163162_10036242 3300013306 Bacteria 4915
132 Ga0157375_10002159 3300013308 Bacteria 17008
133 Ga0157375_10128873 3300013308 Bacteria 2648
134 Ga0163163_10048413 3300014325 Bacteria 4180
135 Ga0163163_10061081 3300014325 Bacteria 3733
136 Ga0163163_10122934 3300014325 Bacteria 2630
137 Ga0163163_10197762 3300014325 Bacteria 2058
138 Ga0157379_10065523 3300014968 Bacteria 3247
139 Ga0157376_10016012 3300014969 Bacteria 5682
140 Ga0163161_10006419 3300017792 Bacteria 8143
141 Ga0207642_10020134 3300025899 Bacteria 2599
142 Ga0207680_10020280 3300025903 Bacteria 3574
143 Ga0207680_10063448 3300025903 Bacteria 2261
144 Ga0207645_10003436 3300025907 Bacteria 12041
145 Ga0207705_10017601 3300025909 Bacteria 5114
146 Ga0207695_10018072 3300025913 Bacteria 8162
147 Ga0207671_10160917 3300025914 Bacteria 1738
148 Ga0207681_10014791 3300025923 Bacteria 4858
149 Ga0207681_10132843 3300025923 Bacteria 1843
150 Ga0207650_10096089 3300025925 Bacteria 2272
151 Ga0207650_10215654 3300025925 Bacteria 1543
152 Ga0207687_10022689 3300025927 Bacteria 4179
153 Ga0207687_10093321 3300025927 Bacteria 2200
154 Ga0207706_10042206 3300025933 Bacteria 4043
155 Ga0207686_10020057 3300025934 Bacteria 3814
156 Ga0207670_10005424 3300025936 Bacteria 6996
157 Ga0207670_10007036 3300025936 Bacteria 6264
158 Ga0207669_10098177 3300025937 Bacteria 1928
159 Ga0207691_10008982 3300025940 Bacteria 9586
160 Ga0207691_10070710 3300025940 Bacteria 3151
161 Ga0207691_10132336 3300025940 Bacteria 2202
162 Ga0207711_10019077 3300025941 Bacteria 5706
163 Ga0207711_10129473 3300025941 Bacteria 2261
164 Ga0207689_10075586 3300025942 Bacteria 2769
165 Ga0207689_10094559 3300025942 Bacteria 2454
166 Ga0207661_10004633 3300025944 Bacteria 9634
167 Ga0207661_10011809 3300025944 Bacteria 6343
168 Ga0207679_10001884 3300025945 Bacteria 13030
169 Ga0207679_10074671 3300025945 Bacteria 2570
170 Ga0207667_10032805 3300025949 Bacteria 5590
171 Ga0207667_10168749 3300025949 Bacteria 2249
172 Ga0207712_10061789 3300025961 Bacteria 2660
173 Ga0207712_10182137 3300025961 Bacteria 1651
174 Ga0207668_10062697 3300025972 Bacteria 2619
175 Ga0207658_10058015 3300025986 Bacteria 2879
176 Ga0207677_10086689 3300026023 Bacteria 2264
177 Ga0207703_10282435 3300026035 Bacteria 1508
178 Ga0207678_10079459 3300026067 Bacteria 2808
179 Ga0207641_10000433 3300026088 Bacteria 47984
180 Ga0207648_10013293 3300026089 Bacteria 7667
181 Ga0207648_10014104 3300026089 Bacteria 7392
182 Ga0207676_10072306 3300026095 Bacteria 2772
183 Ga0207676_10102576 3300026095 Bacteria 2375
184 Ga0207676_10118929 3300026095 Bacteria 2224
185 Ga0207676_10134657 3300026095 Bacteria 2106
186 Ga0207674_10040134 3300026116 Bacteria 4851
187 Ga0207674_10056797 3300026116 Bacteria 3972
188 Ga0207675_100085930 3300026118 Bacteria 2953
189 Ga0207683_10053353 3300026121 Bacteria 3545
190 Ga0207683_10152428 3300026121 Bacteria 2086
191 Ga0207428_10011163 3300027907 Bacteria 7967
192 Ga0268266_10061856 3300028379 Bacteria 3229
193 Ga0268265_10042864 3300028380 Bacteria 3360
194 Ga0268264_10026607 3300028381 Bacteria 4727
195 Ga0307416_100298189 3300032002 Bacteria 1600
196 Ga0373948_0001398 3300034817 Bacteria 3330
197 Ga0373958_0004576 3300034819 Bacteria 2054
198 Ga0373928_0007664 3300035084 Bacteria 2085
199 Ga0373929_0000588 3300035085 Bacteria 7028
200 Ga0373949_0001428 3300035090 Bacteria 6827
201 Ga0373951_0003565 3300035091 Bacteria 3757
202 Ga0373952_0003086 3300035092 Bacteria 3006
203 Ga0373939_0002652 3300035114 Bacteria 4199
204 Ga0373941_0001048 3300035115 Bacteria 5735
205 Ga0373945_0030451 3300035116 Bacteria 1903
206 Ga0373956_0030340 3300035119 Bacteria 2363
207 Ga0373960_0002705 3300035121 Bacteria 4009
208 Ga0373962_0000427 3300035242 Bacteria 9199
209 Ga0373962_0002173 3300035242 Bacteria 4676
210 Ga0373931_0056575 3300035691 Bacteria 2102
211 Ga0373927_0100324 3300035695 Bacteria 1883
212 Ga0373937_0067959 3300036401 Bacteria 3285
213 Ga0373937_0090398 3300036401 Bacteria 2835
214 Ga0373925_0194817 3300037068 Bacteria 1609
215 Ga0436365_0255936 3300039437 Bacteria 1825
216 Ga0450916_006272 3300042530 Bacteria 1396
217 Ga0453684_0184414 3300044712 Bacteria 2447
218 Ga0451576_0007237 3300045051 Bacteria 13361
219 Ga0495653_0193532 3300046463 Bacteria 1386
220 Ga0495606_0106979 3300046507 Bacteria 1693
221 Ga0495630_0119583 3300046517 Unclassified 1998
222 Ga0495644_0051643 3300046523 Bacteria 1544
223 Ga0495642_0013468 3300046528 Bacteria 3163
224 Ga0495609_0047798 3300046538 Bacteria 1914
225 Ga0495645_0140163 3300046543 Bacteria 1688
226 Ga0495622_0019782 3300046557 Bacteria 3134
227 Ga0495588_0129699 3300046674 Bacteria 1330
228 Ga0495647_0018231 3300046681 Bacteria 2496
229 Ga0495604_0266692 3300047317 Bacteria 1162
230 Ga0495683_0121670 3300047323 Bacteria 1238
231 Ga0495684_0170104 3300047471 Bacteria 1621
232 Ga0495602_0144373 3300048088 Bacteria 1880
233 Ga0496104_0248391 3300048907 Bacteria 1692
234 Ga0496105_0125163 3300048908 Bacteria 2119
235 Ga0496106_0099713 3300048909 Bacteria 2252
236 Ga0496108_0017656 3300048911 Bacteria 5838
237 Ga0496109_0000429 3300048912 Bacteria 36860
238 Ga0496109_0233326 3300048912 Bacteria 1731
239 Ga0496109_0407392 3300048912 Bacteria 1285
240 Ga0496110_0007743 3300048913 Bacteria 8598
241 Ga0496111_0003863 3300048914 Bacteria 9365
242 Ga0496112_0008039 3300048915 Bacteria 9413
243 Ga0496112_0033893 3300048915 Bacteria 4967
244 Ga0501031_0259951 3300049568 Bacteria 1128
245 Ga0501034_0028522 3300049571 Bacteria 5681
246 Ga0501036_0061640 3300049572 Bacteria 3177
247 Ga0501040_0141409 3300049576 Bacteria 1696
248 Ga0501046_0082648 3300049580 Bacteria 2480
249 Ga0501047_0000648 3300049581 Bacteria 36506
250 Ga0501076_0010421 3300049592 Bacteria 6901
251 Ga0501227_015008 3300049665 Bacteria 1727
252 Ga0501080_0039706 3300049742 Bacteria 4393
253 Ga0501080_0070902 3300049742 Bacteria 3241
254 Ga0501081_0043007 3300049743 Bacteria 3098
255 Ga0501083_0010330 3300049744 Bacteria 6574
256 Ga0501035_0001577 3300049822 Bacteria 23179
257 Ga0501035_0051562 3300049822 Bacteria 3684
258 Ga0501044_0005121 3300049823 Bacteria 14621
259 Ga0501044_0019201 3300049823 Bacteria 7317
260 Ga0501045_0031652 3300049824 Bacteria 3831
261 nmdc:mga05p37_2998_c1 3300050507 Bacteria 19603
262 nmdc:mga05p37_367425_c1 3300050507 Bacteria 1689
263 nmdc:mga05p37_677778_c1 3300050507 Bacteria 1150
264 nmdc:mga08y16_297374_c1 3300050511 Bacteria 1664
265 nmdc:mga08y16_415335_c1 3300050511 Unclassified 1376
266 nmdc:mga08y16_5796_c1 3300050511 Bacteria 12941
267 nmdc:mga0n895_131_c1 3300050512 Bacteria 44684
268 nmdc:mga0n895_1582_c1 3300050512 Bacteria 17128
269 nmdc:mga0rr50_19285_c1 3300050513 Bacteria 4600
270 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
271 nmdc:mga0rr50_68432_c1 3300050513 Bacteria 2700
272 nmdc:mga08x19_30312_c1 3300050514 Bacteria 3398
273 nmdc:mga08x19_92_c1 3300050514 Bacteria 80986
274 nmdc:mga0a205_22768_c1 3300050515 Bacteria 5939
275 nmdc:mga0a205_389779_c1 3300050515 Bacteria 1257
276 nmdc:mga0a205_46243_c1 3300050515 Bacteria 4197
277 Ga0495601_0058529 3300053077 Bacteria 2442
278 Ga0495595_0060965 3300053084 Bacteria 1766
279 Ga0495619_0091424 3300053085 Bacteria 2060
280 Ga0495619_0221119 3300053085 Bacteria 1312
281 Ga0500643_000003 3300053087 Bacteria 876659
282 Ga0500595_001483 3300053119 Bacteria 12469
283 Ga0500595_010268 3300053119 Bacteria 3729
284 Ga0500568_0007701 3300053139 Bacteria 5257
285 Ga0500573_0000002 3300053140 Bacteria 407088
286 Ga0501084_0047131 3300054114 Bacteria 3610
287 Ga0501082_0111128 3300060353 Bacteria 2372
288 Ga0068866_10012614
289 Ga0065714_10009773
290 Ga0065704_10107247
291 Ga0065712_10068924
292 Ga0065712_10075531
293 Ga0065712_10086331
294 Ga0065715_10090572
295 Ga0065715_10114933
296 Ga0065715_10125559
297 Ga0065715_10148064
298 Ga0065707_10100031
299 Ga0070676_10007338
300 Ga0070683_100014110
301 Ga0070683_100038129
302 Ga0070683_100067324
303 Ga0070690_100042151
304 Ga0070690_100204803
305 Ga0070670_100017511
306 Ga0070670_100062644
307 Ga0070670_100253970
308 Ga0070666_10028878
309 Ga0070680_100002842
310 Ga0068868_100017704
311 Ga0070689_100044089
312 Ga0070691_10031842
313 Ga0070661_100029325
314 Ga0070668_100087417
315 Ga0070669_100000996
316 Ga0070669_100060668
317 Ga0070669_100153108
318 Ga0070675_100009403
319 Ga0070675_100040931
320 Ga0070675_100060114
321 Ga0070673_100168380
322 Ga0070688_100016871
323 Ga0070688_100101983
324 Ga0070663_100202682
325 Ga0070678_100295075
326 Ga0070681_10000196
327 Ga0070681_10033509
328 Ga0068867_100009911
329 Ga0068867_100025484
330 Ga0070685_10150187
331 Ga0070699_100058086
332 Ga0070679_100002592
333 Ga0070679_100098313
334 Ga0070679_100150882
335 Ga0070684_100000791
336 Ga0070684_100083505
337 Ga0070695_100015085
338 Ga0070665_100030034
339 Ga0070704_100180522
340 Ga0070664_100000260
341 Ga0068857_100001599
342 Ga0068857_100078385
343 Ga0068854_100090266
344 Ga0068856_100114929
345 Ga0070702_100094796
346 Ga0068852_100076836
347 Ga0068859_100149503
348 Ga0068859_100226699
349 Ga0068864_100016616
350 Ga0068864_100024241
351 Ga0068864_100045125
352 Ga0068870_10075502
353 Ga0068863_100003325
354 Ga0068863_100160233
355 Ga0068863_100197724
356 Ga0068858_100005254
357 Ga0068858_100167997
358 Ga0068858_100190288
359 Ga0068860_100029327
360 Ga0068862_100002473
361 Ga0068862_100194157
362 Ga0081455_10168975
363 Ga0075432_10027895
364 Ga0097621_100000230
365 Ga0097621_100013409
366 Ga0097621_100068409
367 Ga0097621_100080380
368 Ga0068871_100000019
369 Ga0068871_100016899
370 Ga0068871_100047132
371 Ga0068871_100135656
372 Ga0075428_100018120
373 Ga0075428_100057330
374 Ga0075428_100084946
375 Ga0075433_10008323
376 Ga0075433_10026993
377 Ga0075433_10047340
378 Ga0075434_100012480
379 Ga0075434_100187266
380 Ga0075436_100000687
381 Ga0097620_100149512
382 Ga0097620_100226709
383 Ga0075435_100000063
384 Ga0075435_100012774
385 Ga0111539_10001064
386 Ga0111539_10049272
387 Ga0111539_10081597
388 Ga0111539_10348382
389 Ga0105245_10034877
390 Ga0114129_10005180
391 Ga0114129_10026356
392 Ga0114129_10052749
393 Ga0114129_10247524
394 Ga0114129_10248051
395 Ga0105243_10002319
396 Ga0105241_10002438
397 Ga0105242_10014962
398 Ga0105242_10063282
399 Ga0105248_10008829
400 Ga0105248_10130543
401 Ga0105248_10216096
402 Ga0105237_10144432
403 Ga0105237_10181902
404 Ga0105238_10006238
405 Ga0105238_10053016
406 Ga0105238_10105416
407 Ga0105249_10235386
408 Ga0105249_10286607
409 Ga0105246_10053435
410 Ga0105246_10094567
411 Ga0105246_10243531
412 Ga0157371_10006858
413 Ga0157369_10078957
414 Ga0157374_10012119
415 Ga0157378_10044885
416 Ga0163162_10006253
417 Ga0163162_10029778
418 Ga0163162_10036242
419 Ga0157375_10002159
420 Ga0157375_10128873
421 Ga0163163_10048413
422 Ga0163163_10061081
423 Ga0163163_10122934
424 Ga0163163_10197762
425 Ga0157379_10065523
426 Ga0157376_10016012
427 Ga0163161_10006419
428 Ga0207642_10020134
429 Ga0207680_10020280
430 Ga0207680_10063448
431 Ga0207645_10003436
432 Ga0207705_10017601
433 Ga0207695_10018072
434 Ga0207671_10160917
435 Ga0207681_10014791
436 Ga0207681_10132843
437 Ga0207650_10096089
438 Ga0207650_10215654
439 Ga0207687_10022689
440 Ga0207687_10093321
441 Ga0207706_10042206
442 Ga0207686_10020057
443 Ga0207670_10005424
444 Ga0207670_10007036
445 Ga0207669_10098177
446 Ga0207691_10008982
447 Ga0207691_10070710
448 Ga0207691_10132336
449 Ga0207711_10019077
450 Ga0207711_10129473
451 Ga0207689_10075586
452 Ga0207689_10094559
453 Ga0207661_10004633
454 Ga0207661_10011809
455 Ga0207679_10001884
456 Ga0207679_10074671
457 Ga0207667_10032805
458 Ga0207667_10168749
459 Ga0207712_10061789
460 Ga0207712_10182137
461 Ga0207668_10062697
462 Ga0207658_10058015
463 Ga0207677_10086689
464 Ga0207703_10282435
465 Ga0207678_10079459
466 Ga0207641_10000433
467 Ga0207648_10013293
468 Ga0207648_10014104
469 Ga0207676_10072306
470 Ga0207676_10102576
471 Ga0207676_10118929
472 Ga0207676_10134657
473 Ga0207674_10040134
474 Ga0207674_10056797
475 Ga0207675_100085930
476 Ga0207683_10053353
477 Ga0207683_10152428
478 Ga0207428_10011163
479 Ga0268266_10061856
480 Ga0268265_10042864
481 Ga0268264_10026607
482 Ga0307416_100298189
483 Ga0373948_0001398
484 Ga0373958_0004576
485 Ga0373928_0007664
486 Ga0373929_0000588
487 Ga0373949_0001428
488 Ga0373951_0003565
489 Ga0373952_0003086
490 Ga0373939_0002652
491 Ga0373941_0001048
492 Ga0373945_0030451
493 Ga0373956_0030340
494 Ga0373960_0002705
495 Ga0373962_0000427
496 Ga0373962_0002173
497 Ga0373931_0056575
498 Ga0373927_0100324
499 Ga0373937_0067959
500 Ga0373937_0090398
501 Ga0373925_0194817
502 Ga0436365_0255936
503 Ga0450916_006272
504 Ga0453684_0184414
505 Ga0451576_0007237
506 Ga0495653_0193532
507 Ga0495606_0106979
508 Ga0495630_0119583
509 Ga0495644_0051643
510 Ga0495642_0013468
511 Ga0495609_0047798
512 Ga0495645_0140163
513 Ga0495622_0019782
514 Ga0495588_0129699
515 Ga0495647_0018231
516 Ga0495604_0266692
517 Ga0495683_0121670
518 Ga0495684_0170104
519 Ga0495602_0144373
520 Ga0496104_0248391
521 Ga0496105_0125163
522 Ga0496106_0099713
523 Ga0496108_0017656
524 Ga0496109_0000429
525 Ga0496109_0233326
526 Ga0496109_0407392
527 Ga0496110_0007743
528 Ga0496111_0003863
529 Ga0496112_0008039
530 Ga0496112_0033893
531 Ga0501031_0259951
532 Ga0501034_0028522
533 Ga0501036_0061640
534 Ga0501040_0141409
535 Ga0501046_0082648
536 Ga0501047_0000648
537 Ga0501076_0010421
538 Ga0501227_015008
539 Ga0501080_0039706
540 Ga0501080_0070902
541 Ga0501081_0043007
542 Ga0501083_0010330
543 Ga0501035_0001577
544 Ga0501035_0051562
545 Ga0501044_0005121
546 Ga0501044_0019201
547 Ga0501045_0031652
548 nmdc:mga05p37_2998_c1
549 nmdc:mga05p37_367425_c1
550 nmdc:mga05p37_677778_c1
551 nmdc:mga08y16_297374_c1
552 nmdc:mga08y16_415335_c1
553 nmdc:mga08y16_5796_c1
554 nmdc:mga0n895_131_c1
555 nmdc:mga0n895_1582_c1
556 nmdc:mga0rr50_19285_c1
557 nmdc:mga0rr50_1_c1
558 nmdc:mga0rr50_68432_c1
559 nmdc:mga08x19_30312_c1
560 nmdc:mga08x19_92_c1
561 nmdc:mga0a205_22768_c1
562 nmdc:mga0a205_389779_c1
563 nmdc:mga0a205_46243_c1
564 Ga0495601_0058529
565 Ga0495595_0060965
566 Ga0495619_0091424
567 Ga0495619_0221119
568 Ga0500643_000003
569 Ga0500595_001483
570 Ga0500595_010268
571 Ga0500568_0007701
572 Ga0500573_0000002
573 Ga0501084_0047131
574 Ga0501082_0111128

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07995

GSDH

Glucose / Sorbosone dehydrogenase

262

435

0.96

PF07995

GSDH

Glucose / Sorbosone dehydrogenase

69

253

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cgz-assembly1.cif.gz_A glucose dehydrogenase 0.9235 36 409
7cgz-assembly1.cif.gz_A glucose dehydrogenase 0.9179 36 409
7cdy-assembly1.cif.gz_A crystal structure of glucose dehydrogenase 0.9168 36 405
7cgz-assembly1.cif.gz_B glucose dehydrogenase 0.9139 36 409
7cgz-assembly1.cif.gz_B glucose dehydrogenase 0.9062 36 409
ID Description Score Start End Superfamily
af_P75804_19_370_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9127 30 409 2.120.10.30
af_P75804_19_370_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9077 30 409 2.120.10.30
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8778 32 409 2.120.10.30
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8704 32 409 2.120.10.30
2ismB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8292 35 406 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A653XSF3-F1-model_v4 Dehydrogenase 0.9831 18 409
AF-A4YM71-F1-model_v4 Putative glucose dehydrogenase (EC 1.1.-.-) 0.9819 14 409 GO:0016491
AF-A0A031I3X8-F1-model_v4 Putative glucose/sorbosone dehydrogenase 0.9807 38 407
AF-A0A2V8EX76-F1-model_v4 Dehydrogenase 0.9754 38 409
AF-A0A4Q3KLT7-F1-model_v4 deleted 0.9744 259 407

Map