F388435

General Info

Members Datasets Scaffolds Average Seq Length
288 178 576 130

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100283605|Ga0070714_1002836052
Length 140
Sequence MIRTTAQAKRKARQLFRFCLVNGNVDRGRVFGVVSVVLKFRQRGHLLLLKEFRRLVTLEVKARTAKIESAAALSNFLQSKVREKVETAYGAGTTTLFEADPVLIGGMRVSIGSDVYDGTVRGKLLALKKSLGVLENGERV

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
138 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
143 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
144 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
145 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
146 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
147 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
148 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
155 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
177 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 0.35
Rhizosphere 98.26
Stem 0
Stem Tuber 0
Unclassified 19.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100283605 3300005435 Bacteria 1540
2 JGI24034J26672_10082719 3300002239 Bacteria 588
3 rootH2_10043455 3300003320 Bacteria 5565
4 rootH1_10038553 3300003323 Bacteria 3218
5 Ga0065715_10010919 3300005293 Bacteria 2531
6 Ga0065707_10132878 3300005295 Bacteria 1890
7 Ga0065707_11003032 3300005295 Bacteria 538
8 Ga0070676_10104808 3300005328 Bacteria 1753
9 Ga0070676_10337501 3300005328 Bacteria 1032
10 Ga0070676_10564092 3300005328 Bacteria 816
11 Ga0070690_100309737 3300005330 Bacteria 1135
12 Ga0070690_101023732 3300005330 Unclassified 652
13 Ga0070670_100122060 3300005331 Bacteria 2247
14 Ga0070670_101524979 3300005331 Bacteria 614
15 Ga0070677_10036449 3300005333 Bacteria 1913
16 Ga0068869_100014942 3300005334 Bacteria 5191
17 Ga0070682_101398841 3300005337 Unclassified 598
18 Ga0068868_100096496 3300005338 Bacteria 2388
19 Ga0070689_100109992 3300005340 Bacteria 2190
20 Ga0070689_100311473 3300005340 Bacteria 1312
21 Ga0070689_100653555 3300005340 Bacteria 915
22 Ga0070689_100816504 3300005340 Bacteria 821
23 Ga0070689_101003949 3300005340 Bacteria 742
24 Ga0070691_10149418 3300005341 Bacteria 1197
25 Ga0070687_100162049 3300005343 Bacteria 1323
26 Ga0070661_100001743 3300005344 Bacteria 15093
27 Ga0070669_100014700 3300005353 Bacteria 5572
28 Ga0070669_100023835 3300005353 Bacteria 4385
29 Ga0070669_100559615 3300005353 Bacteria 954
30 Ga0070675_100008834 3300005354 Bacteria 7831
31 Ga0070674_100152982 3300005356 Bacteria 1742
32 Ga0070674_100211156 3300005356 Bacteria 1504
33 Ga0070673_100041074 3300005364 Bacteria 3553
34 Ga0070673_100045032 3300005364 Bacteria 3419
35 Ga0070688_100010166 3300005365 Bacteria 5178
36 Ga0070688_100284766 3300005365 Bacteria 1189
37 Ga0070688_100541411 3300005365 Bacteria 884
38 Ga0070659_100712030 3300005366 Bacteria 869
39 Ga0070703_10543326 3300005406 Bacteria 529
40 Ga0070713_100375269 3300005436 Unclassified 1324
41 Ga0070713_100378601 3300005436 Unclassified 1318
42 Ga0070701_10123613 3300005438 Bacteria 1461
43 Ga0070701_10165297 3300005438 Bacteria 1285
44 Ga0070705_100343943 3300005440 Bacteria 1085
45 Ga0070705_100552926 3300005440 Unclassified 883
46 Ga0070700_100003187 3300005441 Bacteria 8428
47 Ga0070700_100125426 3300005441 Bacteria 1726
48 Ga0070700_100731891 3300005441 Bacteria 790
49 Ga0070694_100005311 3300005444 Bacteria 7789
50 Ga0070678_100468268 3300005456 Unclassified 1107
51 Ga0070678_100493149 3300005456 Bacteria 1080
52 Ga0070678_102063155 3300005456 Unclassified 540
53 Ga0070662_100877368 3300005457 Unclassified 765
54 Ga0068867_100000188 3300005459 Bacteria 40704
55 Ga0068867_100301768 3300005459 Bacteria 1320
56 Ga0068867_100440767 3300005459 Unclassified 1107
57 Ga0070706_100640062 3300005467 Bacteria 987
58 Ga0070707_100042457 3300005468 Bacteria 4354
59 Ga0070698_101187531 3300005471 Bacteria 712
60 Ga0070699_100006001 3300005518 Bacteria 10619
61 Ga0070697_100014376 3300005536 Bacteria 6217
62 Ga0070672_100035039 3300005543 Bacteria 3812
63 Ga0070686_100824785 3300005544 Bacteria 749
64 Ga0070695_100033374 3300005545 Bacteria 3220
65 Ga0070696_100007345 3300005546 Bacteria 7359
66 Ga0070696_100017539 3300005546 Bacteria 4833
67 Ga0070704_100068088 3300005549 Bacteria 2574
68 Ga0070704_100353100 3300005549 Bacteria 1242
69 Ga0070664_100000048 3300005564 Bacteria 72617
70 Ga0068857_100703251 3300005577 Bacteria 960
71 Ga0068854_100274452 3300005578 Bacteria 1355
72 Ga0068854_100780479 3300005578 Unclassified 831
73 Ga0070702_100000083 3300005615 Bacteria 27572
74 Ga0070702_100687339 3300005615 Unclassified 778
75 Ga0068852_100452673 3300005616 Bacteria 1271
76 Ga0068859_100445605 3300005617 Bacteria 1391
77 Ga0068859_100653884 3300005617 Unclassified 1143
78 Ga0068864_101143688 3300005618 Unclassified 776
79 Ga0068866_10588852 3300005718 Unclassified 749
80 Ga0068861_100010804 3300005719 Bacteria 6346
81 Ga0068861_101400616 3300005719 Bacteria 683
82 Ga0068870_10098314 3300005840 Bacteria 1649
83 Ga0068870_10152910 3300005840 Bacteria 1361
84 Ga0070717_10856377 3300006028 Unclassified 827
85 Ga0075428_100043158 3300006844 Bacteria 4958
86 Ga0075430_100123554 3300006846 Unclassified 2157
87 Ga0075431_101015823 3300006847 Bacteria 796
88 Ga0075431_101189853 3300006847 Unclassified 725
89 Ga0075433_10050280 3300006852 Bacteria 3628
90 Ga0075434_100096370 3300006871 Unclassified 2963
91 Ga0068865_100708053 3300006881 Bacteria 861
92 Ga0075436_101180565 3300006914 Bacteria 577
93 Ga0097620_100445563 3300006931 Bacteria 1391
94 Ga0097620_100654038 3300006931 Unclassified 1143
95 Ga0075435_100026767 3300007076 Bacteria 4505
96 Ga0111539_10004380 3300009094 Bacteria 18469
97 Ga0111539_10012574 3300009094 Bacteria 10607
98 Ga0111539_10041726 3300009094 Bacteria 5514
99 Ga0111539_10202102 3300009094 Bacteria 2317
100 Ga0111539_10262434 3300009094 Bacteria 2010
101 Ga0111539_10651499 3300009094 Bacteria 1226
102 Ga0105245_10528517 3300009098 Bacteria 1199
103 Ga0105245_13014775 3300009098 Unclassified 522
104 Ga0114129_10001082 3300009147 Bacteria 35738
105 Ga0114129_10450299 3300009147 Bacteria 1688
106 Ga0105243_10000023 3300009148 Bacteria 202230
107 Ga0105243_10027919 3300009148 Bacteria 4329
108 Ga0105243_11082467 3300009148 Unclassified 809
109 Ga0105243_13093055 3300009148 Unclassified 504
110 Ga0105241_10865067 3300009174 Unclassified 837
111 Ga0105242_11603412 3300009176 Unclassified 684
112 Ga0105248_10388029 3300009177 Bacteria 1572
113 Ga0157371_10261117 3300013102 Bacteria 1249
114 Ga0157374_11120070 3300013296 Unclassified 808
115 Ga0163162_12756911 3300013306 Unclassified 566
116 Ga0157375_10118901 3300013308 Bacteria 2749
117 Ga0163163_10281531 3300014325 Bacteria 1714
118 Ga0157380_10056681 3300014326 Unclassified 3118
119 Ga0157380_11314818 3300014326 Bacteria 771
120 Ga0157377_11496087 3300014745 Bacteria 536
121 Ga0157376_11451321 3300014969 Unclassified 718
122 Ga0157376_12621311 3300014969 Unclassified 544
123 Ga0163161_10622457 3300017792 Bacteria 892
124 Ga0207653_10405302 3300025885 Bacteria 535
125 Ga0207682_10045052 3300025893 Bacteria 1809
126 Ga0207682_10359925 3300025893 Unclassified 686
127 Ga0207642_10067540 3300025899 Bacteria 1688
128 Ga0207688_10055341 3300025901 Unclassified 2226
129 Ga0207680_10154268 3300025903 Bacteria 1534
130 Ga0207645_10171673 3300025907 Bacteria 1421
131 Ga0207645_10286565 3300025907 Bacteria 1095
132 Ga0207645_10354298 3300025907 Unclassified 983
133 Ga0207645_10403581 3300025907 Bacteria 919
134 Ga0207643_10037398 3300025908 Bacteria 2724
135 Ga0207643_10038777 3300025908 Bacteria 2677
136 Ga0207643_10354246 3300025908 Bacteria 922
137 Ga0207684_10477014 3300025910 Bacteria 1070
138 Ga0207662_10142899 3300025918 Bacteria 1517
139 Ga0207649_10002334 3300025920 Bacteria 10644
140 Ga0207646_10245287 3300025922 Bacteria 1618
141 Ga0207681_10006713 3300025923 Bacteria 7061
142 Ga0207681_10056637 3300025923 Bacteria 2674
143 Ga0207681_10363759 3300025923 Bacteria 1161
144 Ga0207681_11851243 3300025923 Bacteria 503
145 Ga0207650_10005429 3300025925 Bacteria 8700
146 Ga0207650_11220719 3300025925 Bacteria 640
147 Ga0207659_10011029 3300025926 Bacteria 5695
148 Ga0207659_10072997 3300025926 Bacteria 2511
149 Ga0207687_10541872 3300025927 Bacteria 975
150 Ga0207700_10075167 3300025928 Bacteria 2617
151 Ga0207664_10230043 3300025929 Bacteria 1611
152 Ga0207690_10452192 3300025932 Bacteria 1032
153 Ga0207706_10081872 3300025933 Bacteria 2837
154 Ga0207706_10763181 3300025933 Bacteria 823
155 Ga0207709_10000106 3300025935 Bacteria 129977
156 Ga0207670_10262697 3300025936 Unclassified 1339
157 Ga0207670_10418684 3300025936 Bacteria 1074
158 Ga0207670_11118698 3300025936 Unclassified 665
159 Ga0207669_10007039 3300025937 Bacteria 5175
160 Ga0207669_10937914 3300025937 Unclassified 725
161 Ga0207669_11105261 3300025937 Bacteria 669
162 Ga0207704_10581012 3300025938 Bacteria 915
163 Ga0207704_10623246 3300025938 Bacteria 886
164 Ga0207691_10008306 3300025940 Bacteria 9971
165 Ga0207689_10063006 3300025942 Bacteria 3049
166 Ga0207689_10120273 3300025942 Unclassified 2161
167 Ga0207679_10001671 3300025945 Bacteria 13824
168 Ga0207679_10621936 3300025945 Bacteria 975
169 Ga0207668_10756885 3300025972 Bacteria 857
170 Ga0207640_10475826 3300025981 Bacteria 1035
171 Ga0207677_10369824 3300026023 Bacteria 1207
172 Ga0207708_10004860 3300026075 Bacteria 9906
173 Ga0207708_10352546 3300026075 Bacteria 1207
174 Ga0207648_10000050 3300026089 Bacteria 108716
175 Ga0207648_10056940 3300026089 Bacteria 3411
176 Ga0207648_10062946 3300026089 Bacteria 3234
177 Ga0207676_10129660 3300026095 Bacteria 2142
178 Ga0207674_10280742 3300026116 Unclassified 1613
179 Ga0207674_10312646 3300026116 Bacteria 1520
180 Ga0207674_10358734 3300026116 Bacteria 1409
181 Ga0207675_100001671 3300026118 Bacteria 22194
182 Ga0207675_100048289 3300026118 Bacteria 3973
183 Ga0207675_100258744 3300026118 Bacteria 1686
184 Ga0207675_101225648 3300026118 Bacteria 771
185 Ga0207683_10339106 3300026121 Unclassified 1378
186 Ga0207683_10603857 3300026121 Bacteria 1016
187 Ga0207698_10216393 3300026142 Bacteria 1728
188 Ga0209971_1123391 3300027682 Bacteria 637
189 Ga0209974_10392330 3300027876 Unclassified 544
190 Ga0207428_10008313 3300027907 Bacteria 9379
191 Ga0207428_10023927 3300027907 Bacteria 5130
192 Ga0207428_10809830 3300027907 Unclassified 665
193 Ga0265326_10028817 3300028558 Bacteria 1581
194 Ga0265338_10000032 3300028800 Bacteria 257580
195 Ga0265338_10004439 3300028800 Bacteria 18945
196 Ga0265338_10011197 3300028800 Bacteria 10396
197 Ga0265338_10452938 3300028800 Unclassified 908
198 Ga0265324_10004282 3300029957 Bacteria 6512
199 Ga0265324_10149697 3300029957 Unclassified 792
200 Ga0265330_10421563 3300031235 Unclassified 565
201 Ga0265339_10103107 3300031249 Bacteria 1482
202 Ga0265339_10198001 3300031249 Bacteria 992
203 Ga0307408_100000014 3300031548 Bacteria 377369
204 Ga0307408_100225266 3300031548 Bacteria 1532
205 Ga0265314_10297707 3300031711 Unclassified 906
206 Ga0265342_10064666 3300031712 Bacteria 2146
207 Ga0307405_10065658 3300031731 Bacteria 2311
208 Ga0307413_10034810 3300031824 Bacteria 2882
209 Ga0307410_10060178 3300031852 Bacteria 2595
210 Ga0307410_10104467 3300031852 Bacteria 2037
211 Ga0307410_10267711 3300031852 Bacteria 1335
212 Ga0307406_10067305 3300031901 Bacteria 2335
213 Ga0307406_10074997 3300031901 Bacteria 2230
214 Ga0307406_10640262 3300031901 Bacteria 881
215 Ga0307407_10000128 3300031903 Bacteria 23340
216 Ga0307407_10111045 3300031903 Bacteria 1721
217 Ga0307407_10191955 3300031903 Unclassified 1362
218 Ga0307407_10276556 3300031903 Bacteria 1161
219 Ga0307412_10000020 3300031911 Bacteria 258377
220 Ga0307412_10082623 3300031911 Bacteria 2225
221 Ga0307412_10612783 3300031911 Bacteria 924
222 Ga0307412_11623627 3300031911 Unclassified 591
223 Ga0307409_100083671 3300031995 Bacteria 2588
224 Ga0307409_101158879 3300031995 Unclassified 795
225 Ga0307409_102140816 3300031995 Bacteria 589
226 Ga0307416_100024762 3300032002 Bacteria 4387
227 Ga0307416_100043382 3300032002 Bacteria 3521
228 Ga0307416_100168696 3300032002 Bacteria 2034
229 Ga0307414_10000045 3300032004 Bacteria 136797
230 Ga0307414_10146951 3300032004 Bacteria 1854
231 Ga0307414_10779504 3300032004 Bacteria 871
232 Ga0307411_10069473 3300032005 Bacteria 2379
233 Ga0307411_10294517 3300032005 Bacteria 1298
234 Ga0307411_10334474 3300032005 Bacteria 1228
235 Ga0307415_100095199 3300032126 Bacteria 2167
236 Ga0307415_100614559 3300032126 Bacteria 969
237 Ga0373944_0353028 3300035089 Unclassified 560
238 Ga0373941_0005367 3300035115 Bacteria 3012
239 Ga0373927_0065839 3300035695 Bacteria 2344
240 Ga0373933_0132887 3300035724 Bacteria 1566
241 Ga0395898_1065511 3300037466 Unclassified 743
242 Ga0439453_0015641 3300041408 Bacteria 1314
243 Ga0450923_030949 3300042125 Bacteria 1091
244 Ga0450890_000004 3300042127 Bacteria 97616
245 Ga0450890_012289 3300042127 Bacteria 1110
246 Ga0450891_001342 3300042129 Bacteria 2549
247 Ga0450891_006203 3300042129 Bacteria 1102
248 Ga0450892_000333 3300042130 Bacteria 5576
249 Ga0439458_0074128 3300042157 Bacteria 862
250 Ga0439435_0347833 3300042436 Unclassified 514
251 Ga0439460_0023995 3300042461 Bacteria 1686
252 Ga0450893_0001460 3300042532 Bacteria 3628
253 Ga0451576_0024158 3300045051 Bacteria 6568
254 Ga0495603_0052704 3300046455 Unclassified 2415
255 Ga0495629_0004018 3300046459 Bacteria 11053
256 Ga0495663_0196618 3300046525 Bacteria 703
257 Ga0495598_0034380 3300046537 Bacteria 1445
258 Ga0495621_0213754 3300046539 Bacteria 779
259 Ga0495633_0431291 3300046558 Bacteria 596
260 Ga0495659_0195348 3300046664 Unclassified 828
261 Ga0495599_0011584 3300046678 Bacteria 5423
262 Ga0496110_0871400 3300048913 Bacteria 806
263 Ga0501032_0126442 3300049569 Bacteria 1688
264 Ga0501034_1066368 3300049571 Bacteria 690
265 Ga0501039_0298036 3300049575 Bacteria 1267
266 Ga0501042_0110541 3300049578 Bacteria 1979
267 Ga0501048_0426495 3300049582 Bacteria 949
268 Ga0501070_0274867 3300049586 Bacteria 1375
269 Ga0501071_0145871 3300049587 Bacteria 1764
270 Ga0501073_0205024 3300049589 Bacteria 1363
271 nmdc:mga05p37_26827_c1 3300050507 Bacteria 7008
272 nmdc:mga0qj67_116382_c1 3300050509 Unclassified 2160
273 nmdc:mga0qj67_517735_c1 3300050509 Bacteria 958
274 nmdc:mga06r32_1042179_c1 3300050510 Unclassified 769
275 nmdc:mga06r32_53539_c1 3300050510 Bacteria 3866
276 nmdc:mga06r32_936472_c1 3300050510 Bacteria 821
277 nmdc:mga08y16_15183_c1 3300050511 Bacteria 8099
278 nmdc:mga08y16_1653175_c1 3300050511 Unclassified 597
279 nmdc:mga08y16_23667_c1 3300050511 Bacteria 6485
280 nmdc:mga08y16_286634_c1 3300050511 Bacteria 1698
281 nmdc:mga08y16_4958_c1 3300050511 Bacteria 13914
282 nmdc:mga08y16_662658_c1 3300050511 Unclassified 1047
283 nmdc:mga0n895_1465837_c1 3300050512 Bacteria 650
284 nmdc:mga0rr50_662537_c1 3300050513 Bacteria 891
285 nmdc:mga0a205_76650_c1 3300050515 Bacteria 3232
286 Ga0500643_114571 3300053087 Bacteria 727
287 Ga0500627_0102351 3300053158 Bacteria 1286
288 Ga0501084_1094783 3300054114 Unclassified 669
289 Ga0070714_100283605
290 JGI24034J26672_10082719
291 rootH2_10043455
292 rootH1_10038553
293 Ga0065715_10010919
294 Ga0065707_10132878
295 Ga0065707_11003032
296 Ga0070676_10104808
297 Ga0070676_10337501
298 Ga0070676_10564092
299 Ga0070690_100309737
300 Ga0070690_101023732
301 Ga0070670_100122060
302 Ga0070670_101524979
303 Ga0070677_10036449
304 Ga0068869_100014942
305 Ga0070682_101398841
306 Ga0068868_100096496
307 Ga0070689_100109992
308 Ga0070689_100311473
309 Ga0070689_100653555
310 Ga0070689_100816504
311 Ga0070689_101003949
312 Ga0070691_10149418
313 Ga0070687_100162049
314 Ga0070661_100001743
315 Ga0070669_100014700
316 Ga0070669_100023835
317 Ga0070669_100559615
318 Ga0070675_100008834
319 Ga0070674_100152982
320 Ga0070674_100211156
321 Ga0070673_100041074
322 Ga0070673_100045032
323 Ga0070688_100010166
324 Ga0070688_100284766
325 Ga0070688_100541411
326 Ga0070659_100712030
327 Ga0070703_10543326
328 Ga0070713_100375269
329 Ga0070713_100378601
330 Ga0070701_10123613
331 Ga0070701_10165297
332 Ga0070705_100343943
333 Ga0070705_100552926
334 Ga0070700_100003187
335 Ga0070700_100125426
336 Ga0070700_100731891
337 Ga0070694_100005311
338 Ga0070678_100468268
339 Ga0070678_100493149
340 Ga0070678_102063155
341 Ga0070662_100877368
342 Ga0068867_100000188
343 Ga0068867_100301768
344 Ga0068867_100440767
345 Ga0070706_100640062
346 Ga0070707_100042457
347 Ga0070698_101187531
348 Ga0070699_100006001
349 Ga0070697_100014376
350 Ga0070672_100035039
351 Ga0070686_100824785
352 Ga0070695_100033374
353 Ga0070696_100007345
354 Ga0070696_100017539
355 Ga0070704_100068088
356 Ga0070704_100353100
357 Ga0070664_100000048
358 Ga0068857_100703251
359 Ga0068854_100274452
360 Ga0068854_100780479
361 Ga0070702_100000083
362 Ga0070702_100687339
363 Ga0068852_100452673
364 Ga0068859_100445605
365 Ga0068859_100653884
366 Ga0068864_101143688
367 Ga0068866_10588852
368 Ga0068861_100010804
369 Ga0068861_101400616
370 Ga0068870_10098314
371 Ga0068870_10152910
372 Ga0070717_10856377
373 Ga0075428_100043158
374 Ga0075430_100123554
375 Ga0075431_101015823
376 Ga0075431_101189853
377 Ga0075433_10050280
378 Ga0075434_100096370
379 Ga0068865_100708053
380 Ga0075436_101180565
381 Ga0097620_100445563
382 Ga0097620_100654038
383 Ga0075435_100026767
384 Ga0111539_10004380
385 Ga0111539_10012574
386 Ga0111539_10041726
387 Ga0111539_10202102
388 Ga0111539_10262434
389 Ga0111539_10651499
390 Ga0105245_10528517
391 Ga0105245_13014775
392 Ga0114129_10001082
393 Ga0114129_10450299
394 Ga0105243_10000023
395 Ga0105243_10027919
396 Ga0105243_11082467
397 Ga0105243_13093055
398 Ga0105241_10865067
399 Ga0105242_11603412
400 Ga0105248_10388029
401 Ga0157371_10261117
402 Ga0157374_11120070
403 Ga0163162_12756911
404 Ga0157375_10118901
405 Ga0163163_10281531
406 Ga0157380_10056681
407 Ga0157380_11314818
408 Ga0157377_11496087
409 Ga0157376_11451321
410 Ga0157376_12621311
411 Ga0163161_10622457
412 Ga0207653_10405302
413 Ga0207682_10045052
414 Ga0207682_10359925
415 Ga0207642_10067540
416 Ga0207688_10055341
417 Ga0207680_10154268
418 Ga0207645_10171673
419 Ga0207645_10286565
420 Ga0207645_10354298
421 Ga0207645_10403581
422 Ga0207643_10037398
423 Ga0207643_10038777
424 Ga0207643_10354246
425 Ga0207684_10477014
426 Ga0207662_10142899
427 Ga0207649_10002334
428 Ga0207646_10245287
429 Ga0207681_10006713
430 Ga0207681_10056637
431 Ga0207681_10363759
432 Ga0207681_11851243
433 Ga0207650_10005429
434 Ga0207650_11220719
435 Ga0207659_10011029
436 Ga0207659_10072997
437 Ga0207687_10541872
438 Ga0207700_10075167
439 Ga0207664_10230043
440 Ga0207690_10452192
441 Ga0207706_10081872
442 Ga0207706_10763181
443 Ga0207709_10000106
444 Ga0207670_10262697
445 Ga0207670_10418684
446 Ga0207670_11118698
447 Ga0207669_10007039
448 Ga0207669_10937914
449 Ga0207669_11105261
450 Ga0207704_10581012
451 Ga0207704_10623246
452 Ga0207691_10008306
453 Ga0207689_10063006
454 Ga0207689_10120273
455 Ga0207679_10001671
456 Ga0207679_10621936
457 Ga0207668_10756885
458 Ga0207640_10475826
459 Ga0207677_10369824
460 Ga0207708_10004860
461 Ga0207708_10352546
462 Ga0207648_10000050
463 Ga0207648_10056940
464 Ga0207648_10062946
465 Ga0207676_10129660
466 Ga0207674_10280742
467 Ga0207674_10312646
468 Ga0207674_10358734
469 Ga0207675_100001671
470 Ga0207675_100048289
471 Ga0207675_100258744
472 Ga0207675_101225648
473 Ga0207683_10339106
474 Ga0207683_10603857
475 Ga0207698_10216393
476 Ga0209971_1123391
477 Ga0209974_10392330
478 Ga0207428_10008313
479 Ga0207428_10023927
480 Ga0207428_10809830
481 Ga0265326_10028817
482 Ga0265338_10000032
483 Ga0265338_10004439
484 Ga0265338_10011197
485 Ga0265338_10452938
486 Ga0265324_10004282
487 Ga0265324_10149697
488 Ga0265330_10421563
489 Ga0265339_10103107
490 Ga0265339_10198001
491 Ga0307408_100000014
492 Ga0307408_100225266
493 Ga0265314_10297707
494 Ga0265342_10064666
495 Ga0307405_10065658
496 Ga0307413_10034810
497 Ga0307410_10060178
498 Ga0307410_10104467
499 Ga0307410_10267711
500 Ga0307406_10067305
501 Ga0307406_10074997
502 Ga0307406_10640262
503 Ga0307407_10000128
504 Ga0307407_10111045
505 Ga0307407_10191955
506 Ga0307407_10276556
507 Ga0307412_10000020
508 Ga0307412_10082623
509 Ga0307412_10612783
510 Ga0307412_11623627
511 Ga0307409_100083671
512 Ga0307409_101158879
513 Ga0307409_102140816
514 Ga0307416_100024762
515 Ga0307416_100043382
516 Ga0307416_100168696
517 Ga0307414_10000045
518 Ga0307414_10146951
519 Ga0307414_10779504
520 Ga0307411_10069473
521 Ga0307411_10294517
522 Ga0307411_10334474
523 Ga0307415_100095199
524 Ga0307415_100614559
525 Ga0373944_0353028
526 Ga0373941_0005367
527 Ga0373927_0065839
528 Ga0373933_0132887
529 Ga0395898_1065511
530 Ga0439453_0015641
531 Ga0450923_030949
532 Ga0450890_000004
533 Ga0450890_012289
534 Ga0450891_001342
535 Ga0450891_006203
536 Ga0450892_000333
537 Ga0439458_0074128
538 Ga0439435_0347833
539 Ga0439460_0023995
540 Ga0450893_0001460
541 Ga0451576_0024158
542 Ga0495603_0052704
543 Ga0495629_0004018
544 Ga0495663_0196618
545 Ga0495598_0034380
546 Ga0495621_0213754
547 Ga0495633_0431291
548 Ga0495659_0195348
549 Ga0495599_0011584
550 Ga0496110_0871400
551 Ga0501032_0126442
552 Ga0501034_1066368
553 Ga0501039_0298036
554 Ga0501042_0110541
555 Ga0501048_0426495
556 Ga0501070_0274867
557 Ga0501071_0145871
558 Ga0501073_0205024
559 nmdc:mga05p37_26827_c1
560 nmdc:mga0qj67_116382_c1
561 nmdc:mga0qj67_517735_c1
562 nmdc:mga06r32_1042179_c1
563 nmdc:mga06r32_53539_c1
564 nmdc:mga06r32_936472_c1
565 nmdc:mga08y16_15183_c1
566 nmdc:mga08y16_1653175_c1
567 nmdc:mga08y16_23667_c1
568 nmdc:mga08y16_286634_c1
569 nmdc:mga08y16_4958_c1
570 nmdc:mga08y16_662658_c1
571 nmdc:mga0n895_1465837_c1
572 nmdc:mga0rr50_662537_c1
573 nmdc:mga0a205_76650_c1
574 Ga0500643_114571
575 Ga0500627_0102351
576 Ga0501084_1094783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00213

OSCP

ATP synthase delta (OSCP) subunit

9

131

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q1x-assembly1.cif.gz_B crystal structure of cell division protein ftsz from mycobacterium tuberculosis in complex with citrate. 0.8196 63 108
1rq2-assembly1.cif.gz_B mycobacterium tuberculosis ftsz in complex with citrate 0.8167 63 108
6ym9-assembly1.cif.gz_B mycobacterium tuberculosis ftsz in complex with gtp-gamma-s 0.8151 63 108
6rdf-assembly1.cif.gz_P cryoem structure of polytomella f-atp synthase, primary rotary state 3, monomer-masked refinement 0.7797 63 129
5v68-assembly2.cif.gz_D crystal structure of cell division protein ftsz from mycobacterium tuberculosis bounded via the t9 loop 0.7614 63 108
ID Description Score Start End Superfamily
af_P0ABA4_107_177_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.9571 63 129 3.30.2320.30
af_P0ABA4_107_177_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.8933 63 129 3.30.2320.30
af_Q84R40_123_196_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.8814 63 129 3.30.2320.30
af_Q7JNG1_146_228_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.8413 57 129 3.30.2320.30
af_Q6DRD1_127_209_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.8155 63 129 3.30.2320.30
ID Description Score Start End GO Terms
AF-A0A7V6ECB0-F1-model_v4 F-type ATPase subunit delta 0.9612 1 130 GO:0016020
GO:0046933
AF-A0A2A2PVH1-F1-model_v4 ATP synthase F1 subunit delta 0.9417 1 130 GO:0016020
GO:0046933
AF-A0A7V7BST4-F1-model_v4 F0F1 ATP synthase subunit delta 0.9414 1 130 GO:0016020
GO:0046933
AF-A0A2A2PVH1-F1-model_v4 ATP synthase F1 subunit delta 0.9348 1 130 GO:0016020
GO:0046933
AF-A0A7V7BST4-F1-model_v4 F0F1 ATP synthase subunit delta 0.9344 1 130 GO:0016020
GO:0046933

Map