F388373

General Info

Members Datasets Scaffolds Average Seq Length
288 153 576 97

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10110540|Ga0065704_101105402
Length 117
Sequence VNGRFARPVFTPPDASGKLASMFVIELTYKAPLKDIDASMPAHMKFLKKYYAAGKFLVSGRKIPRDGGIILAVGDSREQIEAIAREDPFYARGLADVRVIEFRASQRSDAIQQLIDR

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
115 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
119 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
125 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
126 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
131 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
138 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
141 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.04
Rhizosphere 98.61
Stem 0
Stem Tuber 0
Unclassified 23.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10110540 3300005289 Bacteria 1973
2 rootH1_10135733 3300003323 Bacteria 3272
3 Ga0065715_10188965 3300005293 Bacteria 1427
4 Ga0065715_10571735 3300005293 Bacteria 694
5 Ga0065715_10972193 3300005293 Unclassified 553
6 Ga0065715_11062010 3300005293 Unclassified 529
7 Ga0065707_10009120 3300005295 Unclassified 2350
8 Ga0065707_10206491 3300005295 Bacteria 1281
9 Ga0070676_10056807 3300005328 Bacteria 2314
10 Ga0070690_100053887 3300005330 Bacteria 2574
11 Ga0070670_101258952 3300005331 Bacteria 677
12 Ga0070677_10925235 3300005333 Bacteria 505
13 Ga0070680_100617050 3300005336 Bacteria 931
14 Ga0070680_101109446 3300005336 Bacteria 684
15 Ga0070689_100003859 3300005340 Bacteria 10045
16 Ga0070691_10072058 3300005341 Bacteria 1678
17 Ga0070687_100004489 3300005343 Bacteria 5572
18 Ga0070661_100288729 3300005344 Bacteria 1274
19 Ga0070661_101636295 3300005344 Bacteria 545
20 Ga0070692_10012191 3300005345 Unclassified 3969
21 Ga0070692_10292527 3300005345 Unclassified 991
22 Ga0070692_11296313 3300005345 Unclassified 522
23 Ga0070668_100182444 3300005347 Unclassified 1715
24 Ga0070669_100763663 3300005353 Bacteria 820
25 Ga0070669_101966068 3300005353 Unclassified 511
26 Ga0070675_100038890 3300005354 Bacteria 3880
27 Ga0070675_100102901 3300005354 Unclassified 2407
28 Ga0070675_100621379 3300005354 Bacteria 981
29 Ga0070671_100008758 3300005355 Bacteria 8118
30 Ga0070671_100123778 3300005355 Bacteria 2177
31 Ga0070673_100884111 3300005364 Bacteria 828
32 Ga0070673_101352767 3300005364 Bacteria 669
33 Ga0070688_100011096 3300005365 Bacteria 5002
34 Ga0070709_10122907 3300005434 Bacteria 1762
35 Ga0070713_101102313 3300005436 Bacteria 767
36 Ga0070701_10071109 3300005438 Unclassified 1860
37 Ga0070711_100127586 3300005439 Bacteria 1890
38 Ga0070705_100000087 3300005440 Bacteria 51657
39 Ga0070705_100035122 3300005440 Viruses 2808
40 Ga0070705_100147626 3300005440 Unclassified 1556
41 Ga0070700_100054151 3300005441 Unclassified 2506
42 Ga0070700_100092233 3300005441 Bacteria 1979
43 Ga0070694_100004261 3300005444 Bacteria 8607
44 Ga0070694_100089084 3300005444 Bacteria 2162
45 Ga0070694_100909337 3300005444 Bacteria 727
46 Ga0070662_100094721 3300005457 Unclassified 2249
47 Ga0070662_100288958 3300005457 Archaea 1329
48 Ga0068867_100006981 3300005459 Bacteria 7982
49 Ga0068867_100351469 3300005459 Unclassified 1230
50 Ga0070685_11037721 3300005466 Unclassified 617
51 Ga0070706_100610932 3300005467 Bacteria 1013
52 Ga0070707_100994731 3300005468 Bacteria 804
53 Ga0070698_100185310 3300005471 Bacteria 2019
54 Ga0070698_100215313 3300005471 Bacteria 1855
55 Ga0070699_100145109 3300005518 Unclassified 2097
56 Ga0070699_100677505 3300005518 Bacteria 942
57 Ga0070697_100895366 3300005536 Bacteria 787
58 Ga0068853_101273284 3300005539 Unclassified 710
59 Ga0070672_100052978 3300005543 Bacteria 3171
60 Ga0070686_100086244 3300005544 Unclassified 2090
61 Ga0070695_100000080 3300005545 Bacteria 39880
62 Ga0070696_100004586 3300005546 Bacteria 9226
63 Ga0070696_101316175 3300005546 Bacteria 614
64 Ga0070704_100000411 3300005549 Bacteria 19832
65 Ga0070704_100048818 3300005549 Bacteria 2965
66 Ga0070704_100421112 3300005549 Bacteria 1144
67 Ga0070664_100519775 3300005564 Bacteria 1099
68 Ga0068857_100022725 3300005577 Bacteria 5517
69 Ga0068857_100036796 3300005577 Bacteria 4336
70 Ga0068857_101321616 3300005577 Bacteria 700
71 Ga0068857_101349504 3300005577 Unclassified 693
72 Ga0070702_100002035 3300005615 Bacteria 8546
73 Ga0070702_100126198 3300005615 Unclassified 1609
74 Ga0070702_100159821 3300005615 Bacteria 1455
75 Ga0068859_100042977 3300005617 Bacteria 4541
76 Ga0068859_100343186 3300005617 Bacteria 1588
77 Ga0068859_100500075 3300005617 Archaea 1311
78 Ga0068859_102943723 3300005617 Unclassified 521
79 Ga0068864_100048335 3300005618 Bacteria 3657
80 Ga0068864_100101847 3300005618 Viruses 2548
81 Ga0068864_100242142 3300005618 Bacteria 1672
82 Ga0068861_100002996 3300005719 Bacteria 11145
83 Ga0068861_102442328 3300005719 Bacteria 526
84 Ga0068870_10012661 3300005840 Bacteria 3947
85 Ga0068870_10035564 3300005840 Bacteria 2557
86 Ga0068870_10256097 3300005840 Bacteria 1087
87 Ga0068858_100131177 3300005842 Bacteria 2350
88 Ga0068860_100027753 3300005843 Bacteria 5452
89 Ga0068862_100001229 3300005844 Bacteria 24156
90 Ga0081455_10486582 3300005937 Bacteria 833
91 Ga0070717_10151832 3300006028 Bacteria 2004
92 Ga0075432_10088521 3300006058 Unclassified 1131
93 Ga0097621_100637676 3300006237 Bacteria 977
94 Ga0068871_100130283 3300006358 Bacteria 2132
95 Ga0075428_100070934 3300006844 Unclassified 3808
96 Ga0075431_100052496 3300006847 Bacteria 4205
97 Ga0075431_101003124 3300006847 Bacteria 802
98 Ga0075431_101903007 3300006847 Unclassified 550
99 Ga0075433_10008556 3300006852 Bacteria 8163
100 Ga0075433_10104855 3300006852 Bacteria 2505
101 Ga0075433_10113116 3300006852 Bacteria 2408
102 Ga0075433_10167628 3300006852 Bacteria 1954
103 Ga0075433_10566338 3300006852 Bacteria 998
104 Ga0075434_100118265 3300006871 Bacteria 2664
105 Ga0075434_100128101 3300006871 Unclassified 2556
106 Ga0075434_100331740 3300006871 Bacteria 1542
107 Ga0075429_100010286 3300006880 Bacteria 8096
108 Ga0075429_100142045 3300006880 Bacteria 2102
109 Ga0075429_100153283 3300006880 Bacteria 2018
110 Ga0075429_100217474 3300006880 Unclassified 1674
111 Ga0075429_100549823 3300006880 Bacteria 1012
112 Ga0097620_100042977 3300006931 Bacteria 4541
113 Ga0097620_100343187 3300006931 Bacteria 1588
114 Ga0097620_100500065 3300006931 Archaea 1311
115 Ga0097620_102942716 3300006931 Unclassified 521
116 Ga0111539_10004695 3300009094 Bacteria 17858
117 Ga0111539_10063688 3300009094 Bacteria 4363
118 Ga0111539_10118460 3300009094 Bacteria 3103
119 Ga0111539_10440674 3300009094 Bacteria 1517
120 Ga0111539_10926237 3300009094 Unclassified 1013
121 Ga0111539_11893515 3300009094 Bacteria 692
122 Ga0111539_12217656 3300009094 Bacteria 637
123 Ga0114129_10001076 3300009147 Bacteria 35909
124 Ga0114129_10001260 3300009147 Bacteria 33797
125 Ga0114129_10001748 3300009147 Bacteria 29570
126 Ga0114129_10011965 3300009147 Bacteria 12343
127 Ga0114129_10035893 3300009147 Bacteria 7001
128 Ga0114129_10258005 3300009147 Bacteria 2338
129 Ga0114129_10515823 3300009147 Bacteria 1559
130 Ga0114129_10852373 3300009147 Unclassified 1158
131 Ga0114129_10921680 3300009147 Bacteria 1106
132 Ga0114129_11344070 3300009147 Unclassified 884
133 Ga0105243_10011178 3300009148 Bacteria 6790
134 Ga0105243_10180660 3300009148 Bacteria 1835
135 Ga0105243_10722769 3300009148 Bacteria 973
136 Ga0105243_11536288 3300009148 Bacteria 690
137 Ga0105243_11718237 3300009148 Unclassified 657
138 Ga0105242_11220839 3300009176 Bacteria 772
139 Ga0105249_10511672 3300009553 Bacteria 1247
140 Ga0105249_11020348 3300009553 Bacteria 896
141 Ga0105249_13031151 3300009553 Unclassified 539
142 Ga0105246_10396942 3300011119 Bacteria 1144
143 Ga0157327_1055879 3300012512 Unclassified 575
144 Ga0157373_11400412 3300013100 Unclassified 532
145 Ga0157378_12803697 3300013297 Bacteria 540
146 Ga0163162_10060162 3300013306 Bacteria 3832
147 Ga0157375_10011951 3300013308 Bacteria 7685
148 Ga0157380_10054356 3300014326 Bacteria 3177
149 Ga0157377_10025152 3300014745 Bacteria 3173
150 Ga0157377_10241398 3300014745 Bacteria 1166
151 Ga0157376_10077785 3300014969 Bacteria 2838
152 Ga0157376_10736251 3300014969 Bacteria 994
153 Ga0207642_10608891 3300025899 Bacteria 681
154 Ga0207699_10003066 3300025906 Bacteria 7937
155 Ga0207645_10097932 3300025907 Bacteria 1890
156 Ga0207643_10005310 3300025908 Bacteria 6893
157 Ga0207643_10008343 3300025908 Bacteria 5558
158 Ga0207643_10337527 3300025908 Bacteria 944
159 Ga0207663_10085181 3300025916 Bacteria 2080
160 Ga0207663_10255825 3300025916 Unclassified 1291
161 Ga0207660_10260699 3300025917 Unclassified 1371
162 Ga0207660_10654871 3300025917 Bacteria 856
163 Ga0207662_10008080 3300025918 Bacteria 5745
164 Ga0207662_10368926 3300025918 Bacteria 968
165 Ga0207649_11552018 3300025920 Archaea 524
166 Ga0207681_10257089 3300025923 Bacteria 1366
167 Ga0207650_10241106 3300025925 Archaea 1461
168 Ga0207659_11150142 3300025926 Archaea 667
169 Ga0207659_11288157 3300025926 Unclassified 628
170 Ga0207687_11403039 3300025927 Unclassified 600
171 Ga0207700_10936409 3300025928 Bacteria 775
172 Ga0207644_10100643 3300025931 Bacteria 2170
173 Ga0207706_10018291 3300025933 Bacteria 6306
174 Ga0207706_10178979 3300025933 Bacteria 1862
175 Ga0207709_10007170 3300025935 Bacteria 6221
176 Ga0207709_10048792 3300025935 Bacteria 2581
177 Ga0207670_10229116 3300025936 Bacteria 1426
178 Ga0207670_10277761 3300025936 Bacteria 1304
179 Ga0207704_11069888 3300025938 Unclassified 684
180 Ga0207691_10079071 3300025940 Bacteria 2960
181 Ga0207689_11328666 3300025942 Unclassified 604
182 Ga0207689_11647074 3300025942 Unclassified 533
183 Ga0207679_10631630 3300025945 Bacteria 967
184 Ga0207651_10145314 3300025960 Unclassified 1838
185 Ga0207712_10247432 3300025961 Bacteria 1439
186 Ga0207712_10405340 3300025961 Bacteria 1147
187 Ga0207712_10600589 3300025961 Unclassified 952
188 Ga0207668_10038292 3300025972 Bacteria 3217
189 Ga0207640_11984639 3300025981 Unclassified 527
190 Ga0207677_10678166 3300026023 Bacteria 912
191 Ga0207703_10862537 3300026035 Bacteria 866
192 Ga0207639_11574252 3300026041 Unclassified 617
193 Ga0207708_10022085 3300026075 Bacteria 4805
194 Ga0207708_10424067 3300026075 Bacteria 1104
195 Ga0207708_10721149 3300026075 Bacteria 854
196 Ga0207648_10007891 3300026089 Bacteria 10383
197 Ga0207648_10574089 3300026089 Bacteria 1038
198 Ga0207676_10017881 3300026095 Bacteria 5144
199 Ga0207676_10414851 3300026095 Unclassified 1261
200 Ga0207674_10008914 3300026116 Bacteria 11529
201 Ga0207674_10025043 3300026116 Bacteria 6368
202 Ga0207674_10365317 3300026116 Bacteria 1395
203 Ga0207674_11001291 3300026116 Unclassified 805
204 Ga0207675_100004443 3300026118 Bacteria 13555
205 Ga0207675_100880438 3300026118 Bacteria 911
206 Ga0207428_10000329 3300027907 Bacteria 61608
207 Ga0207428_10017091 3300027907 Bacteria 6232
208 Ga0207428_10276089 3300027907 Bacteria 1248
209 Ga0207428_10391654 3300027907 Unclassified 1018
210 Ga0268265_10000211 3300028380 Bacteria 68076
211 Ga0268264_10029160 3300028381 Bacteria 4519
212 Ga0307411_11056917 3300032005 Bacteria 730
213 Ga0373950_0029922 3300034818 Bacteria 1004
214 Ga0373949_0004809 3300035090 Bacteria 3064
215 Ga0373936_0056277 3300035113 Unclassified 1598
216 Ga0373939_0079202 3300035114 Bacteria 1088
217 Ga0373939_0525451 3300035114 Unclassified 508
218 Ga0373941_0047213 3300035115 Bacteria 1356
219 Ga0373954_0376768 3300035118 Bacteria 701
220 Ga0373956_0545961 3300035119 Bacteria 553
221 Ga0373960_0011119 3300035121 Bacteria 2211
222 Ga0373946_0043260 3300035171 Unclassified 1855
223 Ga0373955_0175164 3300035172 Unclassified 1271
224 Ga0373961_0216590 3300035241 Bacteria 681
225 Ga0373962_0214691 3300035242 Bacteria 656
226 Ga0373924_0100920 3300035410 Bacteria 1241
227 Ga0373931_0530994 3300035691 Bacteria 762
228 Ga0373935_0253435 3300035692 Bacteria 1232
229 Ga0373947_0076890 3300035725 Bacteria 2058
230 Ga0439441_016557 3300042001 Bacteria 1316
231 Ga0439435_0023373 3300042436 Bacteria 1623
232 Ga0439435_0227133 3300042436 Bacteria 623
233 Ga0451577_1823143 3300042876 Unclassified 534
234 Ga0451576_0016336 3300045051 Bacteria 8197
235 Ga0451576_0038773 3300045051 Bacteria 5043
236 Ga0451576_0241303 3300045051 Bacteria 1888
237 Ga0451576_0362139 3300045051 Bacteria 1519
238 Ga0451576_0460134 3300045051 Bacteria 1336
239 Ga0495580_0224214 3300046472 Bacteria 1291
240 Ga0495639_0194944 3300046475 Bacteria 990
241 Ga0495586_0057281 3300046535 Bacteria 2114
242 Ga0495659_0019116 3300046664 Bacteria 2290
243 Ga0495659_0028164 3300046664 Unclassified 1943
244 Ga0495647_0629967 3300046681 Unclassified 504
245 Ga0495658_0165318 3300046683 Unclassified 1367
246 Ga0495669_0003192 3300046684 Bacteria 6749
247 Ga0495670_0077471 3300046691 Unclassified 1690
248 Ga0496109_0885983 3300048912 Bacteria 830
249 Ga0496114_0013215 3300048917 Bacteria 6617
250 Ga0496114_1301624 3300048917 Bacteria 614
251 Ga0501068_0325950 3300049584 Bacteria 985
252 Ga0501068_0476624 3300049584 Unclassified 808
253 Ga0501261_114038 3300049690 Bacteria 528
254 nmdc:mga05p37_1007272_c1 3300050507 Unclassified 884
255 nmdc:mga05p37_14019_c1 3300050507 Bacteria 9614
256 nmdc:mga05p37_141276_c1 3300050507 Bacteria 2950
257 nmdc:mga05p37_2235736_c1 3300050507 Unclassified 506
258 nmdc:mga05p37_3214_c1 3300050507 Bacteria 19029
259 nmdc:mga05p37_355_c1 3300050507 Bacteria 49150
260 nmdc:mga05p37_502066_c1 3300050507 Bacteria 1392
261 nmdc:mga05p37_558625_c1 3300050507 Unclassified 1301
262 nmdc:mga05p37_61738_c1 3300050507 Bacteria 4613
263 nmdc:mga05p37_629_c1 3300050507 Bacteria 39005
264 nmdc:mga05p37_818006_c1 3300050507 Bacteria 1017
265 nmdc:mga09592_110415_c1 3300050508 Bacteria 2359
266 nmdc:mga09592_254563_c1 3300050508 Unclassified 1522
267 nmdc:mga09592_4260_c1 3300050508 Bacteria 11553
268 nmdc:mga09592_47646_c1 3300050508 Unclassified 3612
269 nmdc:mga09592_806321_c1 3300050508 Bacteria 794
270 nmdc:mga09592_84358_c1 3300050508 Bacteria 2709
271 nmdc:mga0qj67_256213_c1 3300050509 Bacteria 1420
272 nmdc:mga06r32_20102_c1 3300050510 Bacteria 6141
273 nmdc:mga08y16_1287741_c1 3300050511 Unclassified 698
274 nmdc:mga08y16_15577_c1 3300050511 Bacteria 7995
275 nmdc:mga08y16_1741_c1 3300050511 Bacteria 22071
276 nmdc:mga08y16_461904_c1 3300050511 Unclassified 1294
277 nmdc:mga08y16_50929_c1 3300050511 Bacteria 4333
278 nmdc:mga08y16_851423_c1 3300050511 Bacteria 901
279 nmdc:mga0n895_148074_c1 3300050512 Bacteria 2377
280 nmdc:mga0n895_167626_c1 3300050512 Bacteria 2228
281 nmdc:mga0n895_184582_c1 3300050512 Bacteria 2117
282 nmdc:mga0n895_704170_c1 3300050512 Unclassified 1006
283 nmdc:mga0a205_118911_c1 3300050515 Bacteria 2541
284 nmdc:mga0a205_1248934_c1 3300050515 Unclassified 591
285 nmdc:mga0a205_26761_c1 3300050515 Bacteria 5503
286 nmdc:mga0a205_37689_c1 3300050515 Bacteria 4649
287 nmdc:mga0a205_87320_c1 3300050515 Unclassified 3013
288 Ga0495619_0165970 3300053085 Unclassified 1526
289 Ga0065704_10110540
290 rootH1_10135733
291 Ga0065715_10188965
292 Ga0065715_10571735
293 Ga0065715_10972193
294 Ga0065715_11062010
295 Ga0065707_10009120
296 Ga0065707_10206491
297 Ga0070676_10056807
298 Ga0070690_100053887
299 Ga0070670_101258952
300 Ga0070677_10925235
301 Ga0070680_100617050
302 Ga0070680_101109446
303 Ga0070689_100003859
304 Ga0070691_10072058
305 Ga0070687_100004489
306 Ga0070661_100288729
307 Ga0070661_101636295
308 Ga0070692_10012191
309 Ga0070692_10292527
310 Ga0070692_11296313
311 Ga0070668_100182444
312 Ga0070669_100763663
313 Ga0070669_101966068
314 Ga0070675_100038890
315 Ga0070675_100102901
316 Ga0070675_100621379
317 Ga0070671_100008758
318 Ga0070671_100123778
319 Ga0070673_100884111
320 Ga0070673_101352767
321 Ga0070688_100011096
322 Ga0070709_10122907
323 Ga0070713_101102313
324 Ga0070701_10071109
325 Ga0070711_100127586
326 Ga0070705_100000087
327 Ga0070705_100035122
328 Ga0070705_100147626
329 Ga0070700_100054151
330 Ga0070700_100092233
331 Ga0070694_100004261
332 Ga0070694_100089084
333 Ga0070694_100909337
334 Ga0070662_100094721
335 Ga0070662_100288958
336 Ga0068867_100006981
337 Ga0068867_100351469
338 Ga0070685_11037721
339 Ga0070706_100610932
340 Ga0070707_100994731
341 Ga0070698_100185310
342 Ga0070698_100215313
343 Ga0070699_100145109
344 Ga0070699_100677505
345 Ga0070697_100895366
346 Ga0068853_101273284
347 Ga0070672_100052978
348 Ga0070686_100086244
349 Ga0070695_100000080
350 Ga0070696_100004586
351 Ga0070696_101316175
352 Ga0070704_100000411
353 Ga0070704_100048818
354 Ga0070704_100421112
355 Ga0070664_100519775
356 Ga0068857_100022725
357 Ga0068857_100036796
358 Ga0068857_101321616
359 Ga0068857_101349504
360 Ga0070702_100002035
361 Ga0070702_100126198
362 Ga0070702_100159821
363 Ga0068859_100042977
364 Ga0068859_100343186
365 Ga0068859_100500075
366 Ga0068859_102943723
367 Ga0068864_100048335
368 Ga0068864_100101847
369 Ga0068864_100242142
370 Ga0068861_100002996
371 Ga0068861_102442328
372 Ga0068870_10012661
373 Ga0068870_10035564
374 Ga0068870_10256097
375 Ga0068858_100131177
376 Ga0068860_100027753
377 Ga0068862_100001229
378 Ga0081455_10486582
379 Ga0070717_10151832
380 Ga0075432_10088521
381 Ga0097621_100637676
382 Ga0068871_100130283
383 Ga0075428_100070934
384 Ga0075431_100052496
385 Ga0075431_101003124
386 Ga0075431_101903007
387 Ga0075433_10008556
388 Ga0075433_10104855
389 Ga0075433_10113116
390 Ga0075433_10167628
391 Ga0075433_10566338
392 Ga0075434_100118265
393 Ga0075434_100128101
394 Ga0075434_100331740
395 Ga0075429_100010286
396 Ga0075429_100142045
397 Ga0075429_100153283
398 Ga0075429_100217474
399 Ga0075429_100549823
400 Ga0097620_100042977
401 Ga0097620_100343187
402 Ga0097620_100500065
403 Ga0097620_102942716
404 Ga0111539_10004695
405 Ga0111539_10063688
406 Ga0111539_10118460
407 Ga0111539_10440674
408 Ga0111539_10926237
409 Ga0111539_11893515
410 Ga0111539_12217656
411 Ga0114129_10001076
412 Ga0114129_10001260
413 Ga0114129_10001748
414 Ga0114129_10011965
415 Ga0114129_10035893
416 Ga0114129_10258005
417 Ga0114129_10515823
418 Ga0114129_10852373
419 Ga0114129_10921680
420 Ga0114129_11344070
421 Ga0105243_10011178
422 Ga0105243_10180660
423 Ga0105243_10722769
424 Ga0105243_11536288
425 Ga0105243_11718237
426 Ga0105242_11220839
427 Ga0105249_10511672
428 Ga0105249_11020348
429 Ga0105249_13031151
430 Ga0105246_10396942
431 Ga0157327_1055879
432 Ga0157373_11400412
433 Ga0157378_12803697
434 Ga0163162_10060162
435 Ga0157375_10011951
436 Ga0157380_10054356
437 Ga0157377_10025152
438 Ga0157377_10241398
439 Ga0157376_10077785
440 Ga0157376_10736251
441 Ga0207642_10608891
442 Ga0207699_10003066
443 Ga0207645_10097932
444 Ga0207643_10005310
445 Ga0207643_10008343
446 Ga0207643_10337527
447 Ga0207663_10085181
448 Ga0207663_10255825
449 Ga0207660_10260699
450 Ga0207660_10654871
451 Ga0207662_10008080
452 Ga0207662_10368926
453 Ga0207649_11552018
454 Ga0207681_10257089
455 Ga0207650_10241106
456 Ga0207659_11150142
457 Ga0207659_11288157
458 Ga0207687_11403039
459 Ga0207700_10936409
460 Ga0207644_10100643
461 Ga0207706_10018291
462 Ga0207706_10178979
463 Ga0207709_10007170
464 Ga0207709_10048792
465 Ga0207670_10229116
466 Ga0207670_10277761
467 Ga0207704_11069888
468 Ga0207691_10079071
469 Ga0207689_11328666
470 Ga0207689_11647074
471 Ga0207679_10631630
472 Ga0207651_10145314
473 Ga0207712_10247432
474 Ga0207712_10405340
475 Ga0207712_10600589
476 Ga0207668_10038292
477 Ga0207640_11984639
478 Ga0207677_10678166
479 Ga0207703_10862537
480 Ga0207639_11574252
481 Ga0207708_10022085
482 Ga0207708_10424067
483 Ga0207708_10721149
484 Ga0207648_10007891
485 Ga0207648_10574089
486 Ga0207676_10017881
487 Ga0207676_10414851
488 Ga0207674_10008914
489 Ga0207674_10025043
490 Ga0207674_10365317
491 Ga0207674_11001291
492 Ga0207675_100004443
493 Ga0207675_100880438
494 Ga0207428_10000329
495 Ga0207428_10017091
496 Ga0207428_10276089
497 Ga0207428_10391654
498 Ga0268265_10000211
499 Ga0268264_10029160
500 Ga0307411_11056917
501 Ga0373950_0029922
502 Ga0373949_0004809
503 Ga0373936_0056277
504 Ga0373939_0079202
505 Ga0373939_0525451
506 Ga0373941_0047213
507 Ga0373954_0376768
508 Ga0373956_0545961
509 Ga0373960_0011119
510 Ga0373946_0043260
511 Ga0373955_0175164
512 Ga0373961_0216590
513 Ga0373962_0214691
514 Ga0373924_0100920
515 Ga0373931_0530994
516 Ga0373935_0253435
517 Ga0373947_0076890
518 Ga0439441_016557
519 Ga0439435_0023373
520 Ga0439435_0227133
521 Ga0451577_1823143
522 Ga0451576_0016336
523 Ga0451576_0038773
524 Ga0451576_0241303
525 Ga0451576_0362139
526 Ga0451576_0460134
527 Ga0495580_0224214
528 Ga0495639_0194944
529 Ga0495586_0057281
530 Ga0495659_0019116
531 Ga0495659_0028164
532 Ga0495647_0629967
533 Ga0495658_0165318
534 Ga0495669_0003192
535 Ga0495670_0077471
536 Ga0496109_0885983
537 Ga0496114_0013215
538 Ga0496114_1301624
539 Ga0501068_0325950
540 Ga0501068_0476624
541 Ga0501261_114038
542 nmdc:mga05p37_1007272_c1
543 nmdc:mga05p37_14019_c1
544 nmdc:mga05p37_141276_c1
545 nmdc:mga05p37_2235736_c1
546 nmdc:mga05p37_3214_c1
547 nmdc:mga05p37_355_c1
548 nmdc:mga05p37_502066_c1
549 nmdc:mga05p37_558625_c1
550 nmdc:mga05p37_61738_c1
551 nmdc:mga05p37_629_c1
552 nmdc:mga05p37_818006_c1
553 nmdc:mga09592_110415_c1
554 nmdc:mga09592_254563_c1
555 nmdc:mga09592_4260_c1
556 nmdc:mga09592_47646_c1
557 nmdc:mga09592_806321_c1
558 nmdc:mga09592_84358_c1
559 nmdc:mga0qj67_256213_c1
560 nmdc:mga06r32_20102_c1
561 nmdc:mga08y16_1287741_c1
562 nmdc:mga08y16_15577_c1
563 nmdc:mga08y16_1741_c1
564 nmdc:mga08y16_461904_c1
565 nmdc:mga08y16_50929_c1
566 nmdc:mga08y16_851423_c1
567 nmdc:mga0n895_148074_c1
568 nmdc:mga0n895_167626_c1
569 nmdc:mga0n895_184582_c1
570 nmdc:mga0n895_704170_c1
571 nmdc:mga0a205_118911_c1
572 nmdc:mga0a205_1248934_c1
573 nmdc:mga0a205_26761_c1
574 nmdc:mga0a205_37689_c1
575 nmdc:mga0a205_87320_c1
576 Ga0495619_0165970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

22

103

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.8201 1 83
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.8141 1 82
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.7828 2 87
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.7722 2 87
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.7635 2 88
ID Description Score Start End Superfamily
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8153 1 83 3.30.70.1060
4lbiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7814 1 82 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7723 2 88 3.30.70.1060
af_I1L029_2_64_3.30.310.20 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;DNA-3-methyladenine glycosylase AlkA, N-terminal domain 0.7675 3 63 3.30.310.20
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7512 1 88 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A6B3IRT7-F1-model_v4 YCII-related domain-containing protein 0.9963 1 73
AF-A0A7Z0ALV2-F1-model_v4 deleted 0.9927 2 81
AF-A0A6B3IRT7-F1-model_v4 YCII-related domain-containing protein 0.9829 1 73
AF-A0A0Q7JZF1-F1-model_v4 YCII-related domain-containing protein 0.982 2 82
AF-A0A7U2WN07-F1-model_v4 deleted 0.9781 1 81

Map