F388249

General Info

Members Datasets Scaffolds Average Seq Length
287 173 574 144

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0076037|Ga0501071_0076037_831_1331
Length 166
Sequence MLSTVLPVSLPLQENLVIVPRMEQPPVDDVIEIQQLLARYAVGMTKDDVEAVMEVFTPDGSYSAFGDTYPLADFPTLVAAAPKGLFMVGPPALSLDGDTGTGEQPLCFVEQTSHAMRIGWYTDTYRRTDGGWRLHTRKMTFLRKSGARDSGREHDPSRPQPTASST

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
70 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
71 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
72 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
73 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
74 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
75 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
76 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
77 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
78 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
79 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
80 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
81 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
82 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
83 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
84 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
85 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
91 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
98 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
99 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
104 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
105 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
106 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
107 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
110 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
111 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
115 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
116 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
153 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
165 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
168 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
173 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.35
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.01
Nodule 0
Rhizoplane 5.23
Rhizosphere 83.28
Stem 0
Stem Tuber 0
Unclassified 2.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0076037 3300049587 Bacteria 2452
2 JGI24735J21928_10120637 3300002067 Bacteria 755
3 Ga0070690_100915325 3300005330 Unclassified 687
4 Ga0070690_101176001 3300005330 Bacteria 611
5 Ga0068868_101948772 3300005338 Bacteria 557
6 Ga0070668_100391544 3300005347 Bacteria 1185
7 Ga0070675_100460155 3300005354 Bacteria 1142
8 Ga0070659_100986042 3300005366 Bacteria 739
9 Ga0070667_101184062 3300005367 Bacteria 715
10 Ga0070713_100099653 3300005436 Bacteria 2514
11 Ga0070700_101623367 3300005441 Bacteria 553
12 Ga0070681_10209300 3300005458 Bacteria 1867
13 Ga0070697_101953671 3300005536 Unclassified 525
14 Ga0070665_101418577 3300005548 Bacteria 703
15 Ga0070702_100269686 3300005615 Bacteria 1163
16 Ga0068864_101019590 3300005618 Bacteria 821
17 Ga0068858_100285137 3300005842 Bacteria 1573
18 Ga0081455_10014071 3300005937 Bacteria 7864
19 Ga0081455_10043105 3300005937 Bacteria 3952
20 Ga0081455_10171119 3300005937 Bacteria 1654
21 Ga0081538_10032782 3300005981 Bacteria 3472
22 Ga0081538_10038771 3300005981 Bacteria 3067
23 Ga0070717_11127698 3300006028 Bacteria 714
24 Ga0075365_10105249 3300006038 Bacteria 1935
25 Ga0075365_10152634 3300006038 Bacteria 1607
26 Ga0075365_10159124 3300006038 Unclassified 1573
27 Ga0075365_10330910 3300006038 Bacteria 1073
28 Ga0075365_10401129 3300006038 Bacteria 968
29 Ga0075363_100726285 3300006048 Bacteria 601
30 Ga0075364_10052221 3300006051 Bacteria 2671
31 Ga0075362_10509062 3300006177 Unclassified 616
32 Ga0075367_10152538 3300006178 Bacteria 1434
33 Ga0075367_10156480 3300006178 Bacteria 1416
34 Ga0075367_10207109 3300006178 Bacteria 1226
35 Ga0075428_100000955 3300006844 Bacteria 30623
36 Ga0075428_100071359 3300006844 Bacteria 3795
37 Ga0075428_100158672 3300006844 Bacteria 2456
38 Ga0075430_100002600 3300006846 Bacteria 15070
39 Ga0075430_100172528 3300006846 Bacteria 1799
40 Ga0075430_100396849 3300006846 Bacteria 1138
41 Ga0075431_100000463 3300006847 Bacteria 33500
42 Ga0075431_101066218 3300006847 Bacteria 773
43 Ga0075433_11021598 3300006852 Bacteria 720
44 Ga0075429_100000747 3300006880 Bacteria 25547
45 Ga0075429_100251548 3300006880 Bacteria 1547
46 Ga0075435_100969912 3300007076 Bacteria 742
47 Ga0105240_11309612 3300009093 Bacteria 764
48 Ga0111539_10024442 3300009094 Bacteria 7412
49 Ga0111539_10029279 3300009094 Bacteria 6709
50 Ga0111539_10055310 3300009094 Bacteria 4717
51 Ga0111539_12873612 3300009094 Bacteria 557
52 Ga0105245_10557675 3300009098 Bacteria 1168
53 Ga0105245_10580590 3300009098 Bacteria 1145
54 Ga0114129_10000160 3300009147 Bacteria 72462
55 Ga0114129_10093428 3300009147 Bacteria 4167
56 Ga0114129_10245145 3300009147 Bacteria 2407
57 Ga0114129_10824177 3300009147 Bacteria 1182
58 Ga0114129_11268764 3300009147 Bacteria 914
59 Ga0105243_10039507 3300009148 Bacteria 3679
60 Ga0105243_10590522 3300009148 Bacteria 1068
61 Ga0105237_11019186 3300009545 Bacteria 835
62 Ga0105249_10160178 3300009553 Bacteria 2174
63 Ga0105239_11556286 3300010375 Bacteria 764
64 Ga0157374_10990712 3300013296 Unclassified 859
65 Ga0157372_10270295 3300013307 Bacteria 1975
66 Ga0163163_10048483 3300014325 Bacteria 4177
67 Ga0157380_11520531 3300014326 Unclassified 723
68 Ga0207647_10040311 3300025904 Bacteria 2942
69 Ga0207657_10788578 3300025919 Bacteria 735
70 Ga0207659_11264353 3300025926 Bacteria 634
71 Ga0207709_10530998 3300025935 Bacteria 922
72 Ga0207691_10810392 3300025940 Bacteria 786
73 Ga0207711_11547026 3300025941 Bacteria 606
74 Ga0207712_10320715 3300025961 Bacteria 1278
75 Ga0207703_10313393 3300026035 Bacteria 1435
76 Ga0207702_11749430 3300026078 Bacteria 614
77 Ga0207676_11415691 3300026095 Bacteria 691
78 Ga0207675_100446784 3300026118 Bacteria 1280
79 Ga0207683_10628171 3300026121 Bacteria 995
80 Ga0207428_10005918 3300027907 Bacteria 11324
81 Ga0207428_10040094 3300027907 Bacteria 3801
82 Ga0207428_10461822 3300027907 Bacteria 925
83 Ga0268266_11249510 3300028379 Bacteria 718
84 Ga0268266_11516802 3300028379 Bacteria 646
85 Ga0265762_1057525 3300030760 Bacteria 793
86 Ga0265327_10007948 3300031251 Bacteria 8027
87 Ga0265327_10085098 3300031251 Bacteria 1553
88 Ga0265342_10568112 3300031712 Bacteria 574
89 Ga0307405_10651596 3300031731 Bacteria 866
90 Ga0307407_10565734 3300031903 Bacteria 842
91 Ga0307409_100185511 3300031995 Bacteria 1846
92 Ga0307409_100842822 3300031995 Bacteria 927
93 Ga0307416_100367564 3300032002 Bacteria 1463
94 Ga0307416_101015438 3300032002 Bacteria 933
95 Ga0307415_100088615 3300032126 Bacteria 2233
96 Ga0307415_101346728 3300032126 Bacteria 678
97 Ga0373933_0803245 3300035724 Bacteria 619
98 Ga0373937_0031953 3300036401 Bacteria 4772
99 Ga0436364_0629708 3300037853 Bacteria 1568
100 Ga0436365_0547336 3300039437 Bacteria 4534
101 Ga0436365_1145501 3300039437 Bacteria 860
102 Ga0436365_1473034 3300039437 Bacteria 8516
103 Ga0436360_0894723 3300039438 Bacteria 767
104 Ga0436363_0993347 3300039450 Bacteria 816
105 Ga0436362_1035204 3300039453 Bacteria 1716
106 Ga0451791_0990291 3300041451 Bacteria 561
107 Ga0451791_1330563 3300041451 Bacteria 938
108 Ga0451847_0202929 3300041503 Bacteria 616
109 Ga0451851_1117202 3300041507 Bacteria 1057
110 Ga0451855_1745287 3300041511 Bacteria 545
111 Ga0439443_018683 3300042003 Bacteria 1075
112 Ga0439445_0109719 3300042004 Bacteria 787
113 Ga0439450_001545 3300042008 Bacteria 3389
114 Ga0439456_140827 3300042013 Bacteria 559
115 Ga0450923_013029 3300042125 Bacteria 1523
116 Ga0439464_0012758 3300042439 Bacteria 2241
117 Ga0439440_0031760 3300042993 Bacteria 1250
118 Ga0439440_0267915 3300042993 Bacteria 524
119 Ga0466966_0142992 3300044684 Bacteria 1461
120 Ga0466961_0090055 3300044693 Bacteria 1937
121 Ga0466961_0605232 3300044693 Bacteria 659
122 Ga0466963_0941841 3300044694 Bacteria 608
123 Ga0466957_0563440 3300044842 Bacteria 795
124 Ga0466967_0006300 3300045976 Bacteria 8374
125 Ga0466967_0156488 3300045976 Unclassified 2135
126 Ga0466967_0184834 3300045976 Bacteria 1968
127 Ga0495629_0553436 3300046459 Bacteria 772
128 Ga0495651_0082041 3300046462 Bacteria 2433
129 Ga0495651_0745023 3300046462 Bacteria 608
130 Ga0495653_0152152 3300046463 Bacteria 1615
131 Ga0495662_0320871 3300046476 Bacteria 762
132 Ga0495664_0623976 3300046477 Bacteria 640
133 Ga0495608_0014064 3300046511 Bacteria 5554
134 Ga0495608_0026459 3300046511 Bacteria 3955
135 Ga0495618_0231901 3300046514 Bacteria 1162
136 Ga0495618_0510037 3300046514 Bacteria 724
137 Ga0495628_0008999 3300046516 Bacteria 8544
138 Ga0495630_0180009 3300046517 Bacteria 1612
139 Ga0495630_0203777 3300046517 Bacteria 1510
140 Ga0495652_0711150 3300046529 Bacteria 675
141 Ga0495640_0059352 3300046533 Bacteria 2606
142 Ga0495587_0006043 3300046536 Bacteria 7894
143 Ga0495645_0249261 3300046543 Bacteria 1181
144 Ga0495667_0027491 3300046559 Bacteria 3833
145 Ga0495667_0051955 3300046559 Bacteria 2702
146 Ga0495634_0517516 3300046642 Bacteria 698
147 Ga0495635_0191536 3300046663 Bacteria 1388
148 Ga0495635_0298261 3300046663 Bacteria 1081
149 Ga0495657_0009212 3300046675 Bacteria 7492
150 Ga0495599_0843218 3300046678 Bacteria 522
151 Ga0495646_0370877 3300046680 Bacteria 747
152 Ga0495647_0171146 3300046681 Bacteria 941
153 Ga0495658_0169575 3300046683 Bacteria 1350
154 Ga0495658_0528731 3300046683 Bacteria 755
155 Ga0495613_0000365 3300046689 Bacteria 39454
156 Ga0495613_0284458 3300046689 Bacteria 1148
157 Ga0495613_0439468 3300046689 Bacteria 885
158 Ga0495624_0337568 3300046690 Bacteria 907
159 Ga0495604_0350571 3300047317 Bacteria 981
160 Ga0495676_0201672 3300047321 Bacteria 1382
161 Ga0495680_0005985 3300047322 Bacteria 11373
162 Ga0495680_0143030 3300047322 Bacteria 1749
163 Ga0495679_183511 3300047446 Bacteria 554
164 Ga0495602_0093948 3300048088 Bacteria 2480
165 Ga0495614_0152758 3300048089 Bacteria 1030
166 Ga0496100_0561587 3300048903 Bacteria 884
167 Ga0496102_0233770 3300048905 Bacteria 1733
168 Ga0496103_0220802 3300048906 Bacteria 1219
169 Ga0496104_0387336 3300048907 Bacteria 1310
170 Ga0496104_0392006 3300048907 Bacteria 1301
171 Ga0496109_0941473 3300048912 Bacteria 802
172 Ga0496110_0257472 3300048913 Bacteria 1588
173 Ga0496111_0536785 3300048914 Bacteria 859
174 Ga0496113_0363538 3300048916 Bacteria 1161
175 Ga0496114_0217058 3300048917 Bacteria 1678
176 Ga0496114_0384723 3300048917 Bacteria 1242
177 Ga0496114_0812928 3300048917 Bacteria 814
178 Ga0496115_0234354 3300048918 Bacteria 1513
179 Ga0496126_0000104 3300048929 Bacteria 200735
180 Ga0501031_0415241 3300049568 Bacteria 870
181 Ga0501032_0016877 3300049569 Bacteria 5132
182 Ga0501033_0007631 3300049570 Bacteria 8408
183 Ga0501034_0726875 3300049571 Bacteria 890
184 Ga0501034_0974039 3300049571 Bacteria 733
185 Ga0501036_0142938 3300049572 Bacteria 2019
186 Ga0501036_0160940 3300049572 Bacteria 1893
187 Ga0501036_0174661 3300049572 Bacteria 1809
188 Ga0501038_0180262 3300049574 Bacteria 1705
189 Ga0501038_0426350 3300049574 Bacteria 1023
190 Ga0501038_0949484 3300049574 Bacteria 633
191 Ga0501039_0144135 3300049575 Bacteria 1872
192 Ga0501039_0258524 3300049575 Bacteria 1369
193 Ga0501041_0061640 3300049577 Bacteria 2296
194 Ga0501042_0300037 3300049578 Bacteria 1161
195 Ga0501047_1047880 3300049581 Bacteria 629
196 Ga0501067_0017153 3300049583 Bacteria 4002
197 Ga0501068_0312148 3300049584 Bacteria 1007
198 Ga0501069_0000043 3300049585 Bacteria 77795
199 Ga0501069_0045285 3300049585 Bacteria 2437
200 Ga0501069_0103065 3300049585 Bacteria 1621
201 Ga0501069_0982573 3300049585 Bacteria 515
202 Ga0501070_0000298 3300049586 Bacteria 46144
203 Ga0501070_0022594 3300049586 Bacteria 5267
204 Ga0501070_0074883 3300049586 Bacteria 2802
205 Ga0501070_0114051 3300049586 Bacteria 2232
206 Ga0501070_0227136 3300049586 Bacteria 1530
207 Ga0501070_0595220 3300049586 Bacteria 882
208 Ga0501070_0613032 3300049586 Bacteria 867
209 Ga0501070_1389625 3300049586 Bacteria 534
210 Ga0501071_0033176 3300049587 Bacteria 3669
211 Ga0501071_0131978 3300049587 Bacteria 1856
212 Ga0501071_0315264 3300049587 Bacteria 1187
213 Ga0501071_0693685 3300049587 Archaea 784
214 Ga0501072_0030586 3300049588 Bacteria 4212
215 Ga0501072_0182078 3300049588 Bacteria 1676
216 Ga0501072_0355391 3300049588 Bacteria 1163
217 Ga0501073_0131670 3300049589 Bacteria 1733
218 Ga0501073_0276749 3300049589 Bacteria 1158
219 Ga0501073_0287268 3300049589 Bacteria 1135
220 Ga0501073_0731596 3300049589 Bacteria 682
221 Ga0501074_0007279 3300049590 Bacteria 8001
222 Ga0501074_0048507 3300049590 Bacteria 3068
223 Ga0501074_0176843 3300049590 Bacteria 1523
224 Ga0501074_0589593 3300049590 Bacteria 786
225 Ga0501075_0174195 3300049591 Bacteria 1642
226 Ga0501077_0028922 3300049593 Bacteria 3523
227 Ga0501079_0000222 3300049741 Bacteria 33858
228 Ga0501079_0021976 3300049741 Bacteria 4887
229 Ga0501080_0045107 3300049742 Bacteria 4103
230 Ga0501080_0050965 3300049742 Bacteria 3851
231 Ga0501080_0072785 3300049742 Bacteria 3197
232 Ga0501080_0880869 3300049742 Unclassified 781
233 Ga0501080_1161661 3300049742 Bacteria 665
234 Ga0501081_0070710 3300049743 Bacteria 2432
235 Ga0501044_0154032 3300049823 Bacteria 2279
236 Ga0501044_0391254 3300049823 Bacteria 1304
237 Ga0501045_0199261 3300049824 Bacteria 1492
238 Ga0501045_1019695 3300049824 Bacteria 606
239 nmdc:mga03n38_68782_c1 3300050490 Bacteria 1633
240 nmdc:mga00v17_33693_c1 3300050491 Bacteria 3036
241 nmdc:mga0yw44_1036920_c1 3300050492 Bacteria 555
242 nmdc:mga0yw44_166631_c1 3300050492 Bacteria 1445
243 nmdc:mga0yw44_213679_c1 3300050492 Bacteria 1276
244 nmdc:mga0yw44_232287_c1 3300050492 Bacteria 1224
245 nmdc:mga0yw44_808740_c1 3300050492 Bacteria 636
246 nmdc:mga06z11_200306_c1 3300050494 Bacteria 1159
247 nmdc:mga06z11_281887_c1 3300050494 Bacteria 984
248 nmdc:mga06z11_65696_c1 3300050494 Bacteria 1904
249 nmdc:mga05p37_1049210_c1 3300050507 Bacteria 860
250 nmdc:mga05p37_211929_c1 3300050507 Bacteria 2341
251 nmdc:mga05p37_3605_c1 3300050507 Bacteria 18090
252 nmdc:mga05p37_647787_c1 3300050507 Bacteria 1184
253 nmdc:mga09592_1137_c1 3300050508 Bacteria 21197
254 nmdc:mga09592_1401128_c1 3300050508 Bacteria 572
255 nmdc:mga0qj67_18056_c1 3300050509 Bacteria 5374
256 nmdc:mga0qj67_213072_c1 3300050509 Bacteria 1568
257 nmdc:mga0qj67_75944_c1 3300050509 Bacteria 2686
258 nmdc:mga06r32_1071685_c1 3300050510 Bacteria 756
259 nmdc:mga06r32_130175_c1 3300050510 Bacteria 2488
260 nmdc:mga06r32_27497_c1 3300050510 Bacteria 5315
261 nmdc:mga06r32_6827_c1 3300050510 Bacteria 10259
262 nmdc:mga06r32_82086_c1 3300050510 Bacteria 3140
263 nmdc:mga08y16_29479_c1 3300050511 Bacteria 5782
264 nmdc:mga08y16_438398_c1 3300050511 Bacteria 1334
265 nmdc:mga08y16_5749_c1 3300050511 Bacteria 12990
266 nmdc:mga0rr50_942026_c1 3300050513 Bacteria 736
267 nmdc:mga0a205_893519_c1 3300050515 Bacteria 735
268 Ga0495601_0029407 3300053077 Bacteria 3408
269 Ga0495601_0202540 3300053077 Bacteria 1297
270 Ga0495612_0217492 3300053078 Bacteria 845
271 Ga0495595_0003352 3300053084 Bacteria 6357
272 Ga0495595_0207780 3300053084 Bacteria 975
273 Ga0495595_0484117 3300053084 Bacteria 630
274 Ga0495619_0017835 3300053085 Bacteria 4499
275 Ga0495619_0052323 3300053085 Bacteria 2699
276 Ga0500646_0068990 3300053090 Bacteria 1057
277 Ga0500566_0000606 3300053094 Bacteria 20147
278 Ga0501084_0140597 3300054114 Bacteria 2033
279 Ga0501084_0299009 3300054114 Bacteria 1359
280 Ga0501084_0866021 3300054114 Bacteria 760
281 Ga0501082_0095358 3300060353 Bacteria 2571
282 Ga0501082_0242423 3300060353 Bacteria 1569
283 Ga0501082_1112017 3300060353 Bacteria 691
284 Ga0466962_0269032 3300061719 Bacteria 840
285 Ga0530510_0008708 3300061734 Bacteria 7095
286 Ga0530510_1004769 3300061734 Bacteria 638
287 2809197526 2808606439 Bacteria 5952208
288 Ga0501071_0076037
289 JGI24735J21928_10120637
290 Ga0070690_100915325
291 Ga0070690_101176001
292 Ga0068868_101948772
293 Ga0070668_100391544
294 Ga0070675_100460155
295 Ga0070659_100986042
296 Ga0070667_101184062
297 Ga0070713_100099653
298 Ga0070700_101623367
299 Ga0070681_10209300
300 Ga0070697_101953671
301 Ga0070665_101418577
302 Ga0070702_100269686
303 Ga0068864_101019590
304 Ga0068858_100285137
305 Ga0081455_10014071
306 Ga0081455_10043105
307 Ga0081455_10171119
308 Ga0081538_10032782
309 Ga0081538_10038771
310 Ga0070717_11127698
311 Ga0075365_10105249
312 Ga0075365_10152634
313 Ga0075365_10159124
314 Ga0075365_10330910
315 Ga0075365_10401129
316 Ga0075363_100726285
317 Ga0075364_10052221
318 Ga0075362_10509062
319 Ga0075367_10152538
320 Ga0075367_10156480
321 Ga0075367_10207109
322 Ga0075428_100000955
323 Ga0075428_100071359
324 Ga0075428_100158672
325 Ga0075430_100002600
326 Ga0075430_100172528
327 Ga0075430_100396849
328 Ga0075431_100000463
329 Ga0075431_101066218
330 Ga0075433_11021598
331 Ga0075429_100000747
332 Ga0075429_100251548
333 Ga0075435_100969912
334 Ga0105240_11309612
335 Ga0111539_10024442
336 Ga0111539_10029279
337 Ga0111539_10055310
338 Ga0111539_12873612
339 Ga0105245_10557675
340 Ga0105245_10580590
341 Ga0114129_10000160
342 Ga0114129_10093428
343 Ga0114129_10245145
344 Ga0114129_10824177
345 Ga0114129_11268764
346 Ga0105243_10039507
347 Ga0105243_10590522
348 Ga0105237_11019186
349 Ga0105249_10160178
350 Ga0105239_11556286
351 Ga0157374_10990712
352 Ga0157372_10270295
353 Ga0163163_10048483
354 Ga0157380_11520531
355 Ga0207647_10040311
356 Ga0207657_10788578
357 Ga0207659_11264353
358 Ga0207709_10530998
359 Ga0207691_10810392
360 Ga0207711_11547026
361 Ga0207712_10320715
362 Ga0207703_10313393
363 Ga0207702_11749430
364 Ga0207676_11415691
365 Ga0207675_100446784
366 Ga0207683_10628171
367 Ga0207428_10005918
368 Ga0207428_10040094
369 Ga0207428_10461822
370 Ga0268266_11249510
371 Ga0268266_11516802
372 Ga0265762_1057525
373 Ga0265327_10007948
374 Ga0265327_10085098
375 Ga0265342_10568112
376 Ga0307405_10651596
377 Ga0307407_10565734
378 Ga0307409_100185511
379 Ga0307409_100842822
380 Ga0307416_100367564
381 Ga0307416_101015438
382 Ga0307415_100088615
383 Ga0307415_101346728
384 Ga0373933_0803245
385 Ga0373937_0031953
386 Ga0436364_0629708
387 Ga0436365_0547336
388 Ga0436365_1145501
389 Ga0436365_1473034
390 Ga0436360_0894723
391 Ga0436363_0993347
392 Ga0436362_1035204
393 Ga0451791_0990291
394 Ga0451791_1330563
395 Ga0451847_0202929
396 Ga0451851_1117202
397 Ga0451855_1745287
398 Ga0439443_018683
399 Ga0439445_0109719
400 Ga0439450_001545
401 Ga0439456_140827
402 Ga0450923_013029
403 Ga0439464_0012758
404 Ga0439440_0031760
405 Ga0439440_0267915
406 Ga0466966_0142992
407 Ga0466961_0090055
408 Ga0466961_0605232
409 Ga0466963_0941841
410 Ga0466957_0563440
411 Ga0466967_0006300
412 Ga0466967_0156488
413 Ga0466967_0184834
414 Ga0495629_0553436
415 Ga0495651_0082041
416 Ga0495651_0745023
417 Ga0495653_0152152
418 Ga0495662_0320871
419 Ga0495664_0623976
420 Ga0495608_0014064
421 Ga0495608_0026459
422 Ga0495618_0231901
423 Ga0495618_0510037
424 Ga0495628_0008999
425 Ga0495630_0180009
426 Ga0495630_0203777
427 Ga0495652_0711150
428 Ga0495640_0059352
429 Ga0495587_0006043
430 Ga0495645_0249261
431 Ga0495667_0027491
432 Ga0495667_0051955
433 Ga0495634_0517516
434 Ga0495635_0191536
435 Ga0495635_0298261
436 Ga0495657_0009212
437 Ga0495599_0843218
438 Ga0495646_0370877
439 Ga0495647_0171146
440 Ga0495658_0169575
441 Ga0495658_0528731
442 Ga0495613_0000365
443 Ga0495613_0284458
444 Ga0495613_0439468
445 Ga0495624_0337568
446 Ga0495604_0350571
447 Ga0495676_0201672
448 Ga0495680_0005985
449 Ga0495680_0143030
450 Ga0495679_183511
451 Ga0495602_0093948
452 Ga0495614_0152758
453 Ga0496100_0561587
454 Ga0496102_0233770
455 Ga0496103_0220802
456 Ga0496104_0387336
457 Ga0496104_0392006
458 Ga0496109_0941473
459 Ga0496110_0257472
460 Ga0496111_0536785
461 Ga0496113_0363538
462 Ga0496114_0217058
463 Ga0496114_0384723
464 Ga0496114_0812928
465 Ga0496115_0234354
466 Ga0496126_0000104
467 Ga0501031_0415241
468 Ga0501032_0016877
469 Ga0501033_0007631
470 Ga0501034_0726875
471 Ga0501034_0974039
472 Ga0501036_0142938
473 Ga0501036_0160940
474 Ga0501036_0174661
475 Ga0501038_0180262
476 Ga0501038_0426350
477 Ga0501038_0949484
478 Ga0501039_0144135
479 Ga0501039_0258524
480 Ga0501041_0061640
481 Ga0501042_0300037
482 Ga0501047_1047880
483 Ga0501067_0017153
484 Ga0501068_0312148
485 Ga0501069_0000043
486 Ga0501069_0045285
487 Ga0501069_0103065
488 Ga0501069_0982573
489 Ga0501070_0000298
490 Ga0501070_0022594
491 Ga0501070_0074883
492 Ga0501070_0114051
493 Ga0501070_0227136
494 Ga0501070_0595220
495 Ga0501070_0613032
496 Ga0501070_1389625
497 Ga0501071_0033176
498 Ga0501071_0131978
499 Ga0501071_0315264
500 Ga0501071_0693685
501 Ga0501072_0030586
502 Ga0501072_0182078
503 Ga0501072_0355391
504 Ga0501073_0131670
505 Ga0501073_0276749
506 Ga0501073_0287268
507 Ga0501073_0731596
508 Ga0501074_0007279
509 Ga0501074_0048507
510 Ga0501074_0176843
511 Ga0501074_0589593
512 Ga0501075_0174195
513 Ga0501077_0028922
514 Ga0501079_0000222
515 Ga0501079_0021976
516 Ga0501080_0045107
517 Ga0501080_0050965
518 Ga0501080_0072785
519 Ga0501080_0880869
520 Ga0501080_1161661
521 Ga0501081_0070710
522 Ga0501044_0154032
523 Ga0501044_0391254
524 Ga0501045_0199261
525 Ga0501045_1019695
526 nmdc:mga03n38_68782_c1
527 nmdc:mga00v17_33693_c1
528 nmdc:mga0yw44_1036920_c1
529 nmdc:mga0yw44_166631_c1
530 nmdc:mga0yw44_213679_c1
531 nmdc:mga0yw44_232287_c1
532 nmdc:mga0yw44_808740_c1
533 nmdc:mga06z11_200306_c1
534 nmdc:mga06z11_281887_c1
535 nmdc:mga06z11_65696_c1
536 nmdc:mga05p37_1049210_c1
537 nmdc:mga05p37_211929_c1
538 nmdc:mga05p37_3605_c1
539 nmdc:mga05p37_647787_c1
540 nmdc:mga09592_1137_c1
541 nmdc:mga09592_1401128_c1
542 nmdc:mga0qj67_18056_c1
543 nmdc:mga0qj67_213072_c1
544 nmdc:mga0qj67_75944_c1
545 nmdc:mga06r32_1071685_c1
546 nmdc:mga06r32_130175_c1
547 nmdc:mga06r32_27497_c1
548 nmdc:mga06r32_6827_c1
549 nmdc:mga06r32_82086_c1
550 nmdc:mga08y16_29479_c1
551 nmdc:mga08y16_438398_c1
552 nmdc:mga08y16_5749_c1
553 nmdc:mga0rr50_942026_c1
554 nmdc:mga0a205_893519_c1
555 Ga0495601_0029407
556 Ga0495601_0202540
557 Ga0495612_0217492
558 Ga0495595_0003352
559 Ga0495595_0207780
560 Ga0495595_0484117
561 Ga0495619_0017835
562 Ga0495619_0052323
563 Ga0500646_0068990
564 Ga0500566_0000606
565 Ga0501084_0140597
566 Ga0501084_0299009
567 Ga0501084_0866021
568 Ga0501082_0095358
569 Ga0501082_0242423
570 Ga0501082_1112017
571 Ga0466962_0269032
572 Ga0530510_0008708
573 Ga0530510_1004769
574 2809197526

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13577

SnoaL_4

SnoaL-like domain

25

138

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cnx-assembly1.cif.gz_A crystal structure of a putative dehydratase from the ntf2-like family (sav_4671) from streptomyces avermitilis at 2.10 a resolution 0.8641 14 124
1ar0-assembly1.cif.gz_B nuclear transport factor 2 (ntf2) e42k mutant 0.862 17 130
1jb2-assembly1.cif.gz_B crystal structure of ntf2 m84e mutant 0.8603 15 129
1jb4-assembly1.cif.gz_B crystal structure of ntf2 m102e mutant 0.86 15 129
2chc-assembly1.cif.gz_A structure of rv3472(d26n), a function unknown protein from mycobacterium tuberculosis 0.8568 4 130
ID Description Score Start End Superfamily
af_O07237_11_153_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8654 14 130 3.10.450.50
2rfrA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8644 12 133 3.10.450.50
af_Q9M2S5_17_155_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8603 16 129 3.10.450.50
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8576 18 129 3.10.450.50
af_Q564W9_26_137_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.857 21 124 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A117RB06-F1-model_v4 SnoaL-like domain-containing protein 0.9902 31 141
AF-A0A4R4V9N5-F1-model_v4 Nuclear transport factor 2 family protein 0.98 14 148
AF-A0A378UTK0-F1-model_v4 deleted 0.9735 9 148
AF-A0A101BCK3-F1-model_v4 deleted 0.9665 5 148
AF-A0A2N8LH86-F1-model_v4 deleted 0.9624 9 148

Map