F388228
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 287 | 201 | 265 | 245 |
Family's Representative Sequence
| Representative Sequence | 3300048922|Ga0496119_0004244|Ga0496119_0004244_4458_5279 |
| Length | 273 |
| Sequence | MAFPERGFSVTDEKLQLDAQLAQRIATAAGELLLSLQRSGLYSGKELGKAGDHVANAFIMQTLRTHRPDDGILSEEEAGDPARLGKRRVWIVDPLDGTREYGEYPRVDWAVHIGLAIDGLPRAGAVSLPALSLTLCSDAPIAVAPPGSGALRMLVSRTRPAAEAVDVARLLGAELVPMGSAGAKAMAVLRNEADIYLHSGGQYEWDSCAPVAVAQAAGLHVSRIDGSALRYNCENPYLPDLLICRKEHAQEVLRLIQKVRAAPPRPLEKGVNS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 2 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 3 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 4 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 5 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 6 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 7 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 8 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 9 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 10 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 11 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 12 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 13 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 14 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 42 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 43 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 44 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 70 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 105 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 106 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 107 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 108 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 109 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 110 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 111 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 112 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 113 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 114 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 115 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 116 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 117 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 118 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 119 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 120 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 121 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 122 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 123 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 124 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 125 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 126 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 127 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 128 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 129 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 130 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 131 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 132 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 133 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 155 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 156 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 157 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 158 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 161 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 162 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 163 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 164 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 165 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 166 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 167 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 168 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 186 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 187 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 188 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 189 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 190 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 191 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 192 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 193 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 194 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 195 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 196 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 197 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 198 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 199 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 201 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.33 |
| Metatranscriptomes | 0 |
| Isolates | 7.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.32 |
| Nodule | 4.18 |
| Rhizoplane | 4.88 |
| Rhizosphere | 74.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10032432 | 3300005327 | Bacteria | 4198 |
| 2 | Ga0070683_100168318 | 3300005329 | Bacteria | 2080 |
| 3 | Ga0070683_100360062 | 3300005329 | Bacteria | 1385 |
| 4 | Ga0070666_10021923 | 3300005335 | Bacteria | 4143 |
| 5 | Ga0070666_10086890 | 3300005335 | Bacteria | 2143 |
| 6 | Ga0070666_10153314 | 3300005335 | Bacteria | 1608 |
| 7 | Ga0070680_100011864 | 3300005336 | Bacteria | 6758 |
| 8 | Ga0068868_100006720 | 3300005338 | Bacteria | 8164 |
| 9 | Ga0070661_100002127 | 3300005344 | Bacteria | 13656 |
| 10 | Ga0070661_100090059 | 3300005344 | Bacteria | 2272 |
| 11 | Ga0070668_100004329 | 3300005347 | Bacteria | 10530 |
| 12 | Ga0070669_100642457 | 3300005353 | Bacteria | 892 |
| 13 | Ga0070671_100049705 | 3300005355 | Bacteria | 3488 |
| 14 | Ga0070673_100106196 | 3300005364 | Bacteria | 2321 |
| 15 | Ga0070673_100309863 | 3300005364 | Bacteria | 1392 |
| 16 | Ga0070667_100005747 | 3300005367 | Bacteria | 10364 |
| 17 | Ga0070667_100014320 | 3300005367 | Bacteria | 6554 |
| 18 | Ga0070714_100755668 | 3300005435 | Bacteria | 940 |
| 19 | Ga0070662_100002184 | 3300005457 | Bacteria | 11991 |
| 20 | Ga0070662_100012726 | 3300005457 | Bacteria | 5584 |
| 21 | Ga0070662_100313357 | 3300005457 | Bacteria | 1278 |
| 22 | Ga0070681_10009625 | 3300005458 | Bacteria | 9503 |
| 23 | Ga0070679_100040899 | 3300005530 | Bacteria | 4613 |
| 24 | Ga0070684_100049219 | 3300005535 | Bacteria | 3657 |
| 25 | Ga0070665_100005712 | 3300005548 | Bacteria | 12771 |
| 26 | Ga0068855_100012222 | 3300005563 | Bacteria | 10376 |
| 27 | Ga0068855_100014908 | 3300005563 | Bacteria | 9363 |
| 28 | Ga0070664_100020279 | 3300005564 | Bacteria | 5474 |
| 29 | Ga0068854_100023131 | 3300005578 | Bacteria | 4242 |
| 30 | Ga0068854_100705737 | 3300005578 | Bacteria | 871 |
| 31 | Ga0068859_100001743 | 3300005617 | Bacteria | 22161 |
| 32 | Ga0068859_100005689 | 3300005617 | Bacteria | 12685 |
| 33 | Ga0068859_100030090 | 3300005617 | Bacteria | 5448 |
| 34 | Ga0068859_100074361 | 3300005617 | Bacteria | 3437 |
| 35 | Ga0068864_100019578 | 3300005618 | Bacteria | 5661 |
| 36 | Ga0068863_100156701 | 3300005841 | Bacteria | 2180 |
| 37 | Ga0068858_100001695 | 3300005842 | Bacteria | 22530 |
| 38 | Ga0068858_100070362 | 3300005842 | Bacteria | 3243 |
| 39 | Ga0068858_100313222 | 3300005842 | Bacteria | 1499 |
| 40 | Ga0068860_100000382 | 3300005843 | Bacteria | 58081 |
| 41 | Ga0068860_100008642 | 3300005843 | Bacteria | 10149 |
| 42 | Ga0068862_100000066 | 3300005844 | Bacteria | 124095 |
| 43 | Ga0068862_100004369 | 3300005844 | Bacteria | 11962 |
| 44 | Ga0068862_100006074 | 3300005844 | Bacteria | 10055 |
| 45 | Ga0075365_10076278 | 3300006038 | Bacteria | 2263 |
| 46 | Ga0075365_10326013 | 3300006038 | Bacteria | 1082 |
| 47 | Ga0075363_100001213 | 3300006048 | Bacteria | 9522 |
| 48 | Ga0075363_100133940 | 3300006048 | Bacteria | 1391 |
| 49 | Ga0075363_100260464 | 3300006048 | Bacteria | 1000 |
| 50 | Ga0075432_10035632 | 3300006058 | Bacteria | 1729 |
| 51 | Ga0075369_10108368 | 3300006186 | Bacteria | 1251 |
| 52 | Ga0097621_100004696 | 3300006237 | Bacteria | 9544 |
| 53 | Ga0075370_10013826 | 3300006353 | Bacteria | 4295 |
| 54 | Ga0068865_100578382 | 3300006881 | Bacteria | 947 |
| 55 | Ga0097620_100001743 | 3300006931 | Bacteria | 22161 |
| 56 | Ga0097620_100005689 | 3300006931 | Bacteria | 12685 |
| 57 | Ga0097620_100030090 | 3300006931 | Bacteria | 5448 |
| 58 | Ga0097620_100074364 | 3300006931 | Bacteria | 3437 |
| 59 | Ga0105240_10000854 | 3300009093 | Bacteria | 54945 |
| 60 | Ga0105247_10001423 | 3300009101 | Bacteria | 17370 |
| 61 | Ga0105247_10056328 | 3300009101 | Bacteria | 2428 |
| 62 | Ga0105241_10059466 | 3300009174 | Bacteria | 2938 |
| 63 | Ga0105248_10005754 | 3300009177 | Bacteria | 13620 |
| 64 | Ga0105248_10007917 | 3300009177 | Bacteria | 11679 |
| 65 | Ga0105248_10036696 | 3300009177 | Bacteria | 5482 |
| 66 | Ga0105238_10066388 | 3300009551 | Bacteria | 3609 |
| 67 | Ga0105249_10002922 | 3300009553 | Bacteria | 14737 |
| 68 | Ga0105239_10174195 | 3300010375 | Bacteria | 2407 |
| 69 | Ga0105246_10000032 | 3300011119 | Bacteria | 51397 |
| 70 | Ga0157373_10027995 | 3300013100 | Bacteria | 4066 |
| 71 | Ga0157373_10029602 | 3300013100 | Bacteria | 3943 |
| 72 | Ga0157371_10012870 | 3300013102 | Bacteria | 6371 |
| 73 | Ga0157370_10061912 | 3300013104 | Bacteria | 3551 |
| 74 | Ga0157370_10124760 | 3300013104 | Bacteria | 2404 |
| 75 | Ga0157369_10007697 | 3300013105 | Bacteria | 12396 |
| 76 | Ga0157369_10024942 | 3300013105 | Bacteria | 6643 |
| 77 | Ga0157374_10019901 | 3300013296 | Bacteria | 5949 |
| 78 | Ga0157378_10017452 | 3300013297 | Bacteria | 6300 |
| 79 | Ga0163162_10113949 | 3300013306 | Bacteria | 2803 |
| 80 | Ga0157372_10606633 | 3300013307 | Bacteria | 1276 |
| 81 | Ga0163163_10002708 | 3300014325 | Bacteria | 14962 |
| 82 | Ga0157377_10095201 | 3300014745 | Bacteria | 1765 |
| 83 | Ga0157379_10001026 | 3300014968 | Bacteria | 22704 |
| 84 | Ga0157379_10003362 | 3300014968 | Bacteria | 13542 |
| 85 | Ga0157376_10011857 | 3300014969 | Bacteria | 6444 |
| 86 | Ga0213876_10000185 | 3300021384 | Bacteria | 64516 |
| 87 | Ga0207710_10000545 | 3300025900 | Bacteria | 22636 |
| 88 | Ga0207710_10000556 | 3300025900 | Bacteria | 22299 |
| 89 | Ga0207710_10000571 | 3300025900 | Bacteria | 22034 |
| 90 | Ga0207680_10018201 | 3300025903 | Bacteria | 3728 |
| 91 | Ga0207680_10046508 | 3300025903 | Bacteria | 2566 |
| 92 | Ga0207680_10071022 | 3300025903 | Bacteria | 2157 |
| 93 | Ga0207705_10487041 | 3300025909 | Bacteria | 957 |
| 94 | Ga0207707_10072127 | 3300025912 | Bacteria | 3010 |
| 95 | Ga0207695_10045503 | 3300025913 | Bacteria | 4658 |
| 96 | Ga0207660_10065967 | 3300025917 | Bacteria | 2617 |
| 97 | Ga0207657_10005883 | 3300025919 | Bacteria | 12777 |
| 98 | Ga0207649_10073166 | 3300025920 | Bacteria | 2195 |
| 99 | Ga0207652_10032334 | 3300025921 | Bacteria | 4397 |
| 100 | Ga0207694_10099484 | 3300025924 | Bacteria | 2303 |
| 101 | Ga0207694_10202123 | 3300025924 | Bacteria | 1617 |
| 102 | Ga0207659_10421168 | 3300025926 | Bacteria | 1120 |
| 103 | Ga0207664_10660541 | 3300025929 | Bacteria | 940 |
| 104 | Ga0207644_10498565 | 3300025931 | Bacteria | 1004 |
| 105 | Ga0207690_10002354 | 3300025932 | Bacteria | 11476 |
| 106 | Ga0207706_10002856 | 3300025933 | Bacteria | 16769 |
| 107 | Ga0207706_10005439 | 3300025933 | Bacteria | 11866 |
| 108 | Ga0207706_10063198 | 3300025933 | Bacteria | 3260 |
| 109 | Ga0207711_10000365 | 3300025941 | Bacteria | 47940 |
| 110 | Ga0207711_10005445 | 3300025941 | Bacteria | 10760 |
| 111 | Ga0207711_10073208 | 3300025941 | Bacteria | 2977 |
| 112 | Ga0207661_10174278 | 3300025944 | Bacteria | 1874 |
| 113 | Ga0207679_10239209 | 3300025945 | Bacteria | 1537 |
| 114 | Ga0207667_10106717 | 3300025949 | Bacteria | 2889 |
| 115 | Ga0207651_10221305 | 3300025960 | Bacteria | 1530 |
| 116 | Ga0207651_10378675 | 3300025960 | Bacteria | 1199 |
| 117 | Ga0207712_10009683 | 3300025961 | Bacteria | 6108 |
| 118 | Ga0207668_10233724 | 3300025972 | Bacteria | 1483 |
| 119 | Ga0207668_10354087 | 3300025972 | Unclassified | 1228 |
| 120 | Ga0207658_10041528 | 3300025986 | Bacteria | 3331 |
| 121 | Ga0207677_10364934 | 3300026023 | Bacteria | 1214 |
| 122 | Ga0207703_10000071 | 3300026035 | Bacteria | 121299 |
| 123 | Ga0207703_10001291 | 3300026035 | Bacteria | 23198 |
| 124 | Ga0207703_10018192 | 3300026035 | Bacteria | 5488 |
| 125 | Ga0207639_10008247 | 3300026041 | Bacteria | 7135 |
| 126 | Ga0207678_10094616 | 3300026067 | Bacteria | 2553 |
| 127 | Ga0207641_10466285 | 3300026088 | Bacteria | 1222 |
| 128 | Ga0207648_10271496 | 3300026089 | Bacteria | 1515 |
| 129 | Ga0207676_10009299 | 3300026095 | Bacteria | 6993 |
| 130 | Ga0207676_10260956 | 3300026095 | Bacteria | 1564 |
| 131 | Ga0207674_10169937 | 3300026116 | Bacteria | 2134 |
| 132 | Ga0207675_100010006 | 3300026118 | Bacteria | 8885 |
| 133 | Ga0268265_10000062 | 3300028380 | Bacteria | 148317 |
| 134 | Ga0268265_10006091 | 3300028380 | Bacteria | 8189 |
| 135 | Ga0268265_10012049 | 3300028380 | Bacteria | 5854 |
| 136 | Ga0268264_10000008 | 3300028381 | Bacteria | 773387 |
| 137 | Ga0268264_10013433 | 3300028381 | Bacteria | 6743 |
| 138 | Ga0268264_10130834 | 3300028381 | Bacteria | 2224 |
| 139 | Ga0265327_10000252 | 3300031251 | Bacteria | 106339 |
| 140 | Ga0316578_10260916 | 3300031728 | Bacteria | 1039 |
| 141 | Ga0307516_10000937 | 3300031730 | Bacteria | 40227 |
| 142 | Ga0307405_10240027 | 3300031731 | Bacteria | 1342 |
| 143 | Ga0307413_10203557 | 3300031824 | Bacteria | 1431 |
| 144 | Ga0307518_10104329 | 3300031838 | Bacteria | 2026 |
| 145 | Ga0307414_10064299 | 3300032004 | Bacteria | 2611 |
| 146 | Ga0316583_10004355 | 3300032133 | Bacteria | 5050 |
| 147 | Ga0373929_0001099 | 3300035085 | Bacteria | 5256 |
| 148 | Ga0373932_0000943 | 3300035112 | Bacteria | 8518 |
| 149 | Ga0373931_0000029 | 3300035691 | Bacteria | 116290 |
| 150 | Ga0316582_0037897 | 3300036647 | Bacteria | 2992 |
| 151 | Ga0316584_0126565 | 3300036712 | Bacteria | 1908 |
| 152 | Ga0436364_0986343 | 3300037853 | Bacteria | 1240 |
| 153 | Ga0400483_028153 | 3300039062 | Bacteria | 36990 |
| 154 | Ga0400483_086606 | 3300039062 | Bacteria | 2852 |
| 155 | Ga0400483_143208 | 3300039062 | Bacteria | 16664 |
| 156 | Ga0400483_205722 | 3300039062 | Bacteria | 12693 |
| 157 | Ga0400483_216221 | 3300039062 | Bacteria | 3834 |
| 158 | Ga0436365_0321092 | 3300039437 | Bacteria | 982 |
| 159 | Ga0436365_0820464 | 3300039437 | Bacteria | 3195 |
| 160 | Ga0439447_000181 | 3300041407 | Bacteria | 22248 |
| 161 | Ga0439447_003501 | 3300041407 | Bacteria | 5571 |
| 162 | Ga0439466_0001981 | 3300041411 | Bacteria | 8027 |
| 163 | Ga0439466_0032802 | 3300041411 | Bacteria | 1768 |
| 164 | Ga0439452_000097 | 3300042010 | Bacteria | 74034 |
| 165 | Ga0450911_006907 | 3300042115 | Bacteria | 1669 |
| 166 | Ga0450902_000305 | 3300042137 | Bacteria | 5899 |
| 167 | Ga0451577_0794438 | 3300042876 | Bacteria | 855 |
| 168 | Ga0466969_0042021 | 3300044656 | Bacteria | 2284 |
| 169 | Ga0466966_0052761 | 3300044684 | Bacteria | 2581 |
| 170 | Ga0466961_0093497 | 3300044693 | Bacteria | 1897 |
| 171 | Ga0466970_0011935 | 3300044765 | Bacteria | 4434 |
| 172 | Ga0466957_0021721 | 3300044842 | Bacteria | 3782 |
| 173 | Ga0466959_0394876 | 3300045049 | Bacteria | 940 |
| 174 | Ga0466958_0431686 | 3300045836 | Bacteria | 852 |
| 175 | Ga0495617_004369 | 3300046452 | Bacteria | 5150 |
| 176 | Ga0495603_0071559 | 3300046455 | Bacteria | 2038 |
| 177 | Ga0495638_0000277 | 3300046460 | Bacteria | 69421 |
| 178 | Ga0495638_0032629 | 3300046460 | Bacteria | 3337 |
| 179 | Ga0495653_0086563 | 3300046463 | Bacteria | 2303 |
| 180 | Ga0495594_0050431 | 3300046499 | Bacteria | 2289 |
| 181 | Ga0495618_0035059 | 3300046514 | Bacteria | 3149 |
| 182 | Ga0495632_0011496 | 3300046519 | Bacteria | 5161 |
| 183 | Ga0495648_0000199 | 3300046524 | Bacteria | 69421 |
| 184 | Ga0495654_0212077 | 3300046530 | Bacteria | 823 |
| 185 | Ga0495622_0033325 | 3300046557 | Bacteria | 2404 |
| 186 | Ga0495633_0002978 | 3300046558 | Bacteria | 11579 |
| 187 | Ga0495633_0030855 | 3300046558 | Bacteria | 2601 |
| 188 | Ga0495625_0004331 | 3300046660 | Bacteria | 13476 |
| 189 | Ga0495625_0124248 | 3300046660 | Bacteria | 1753 |
| 190 | Ga0495657_0148936 | 3300046675 | Bacteria | 1454 |
| 191 | Ga0495669_0000002 | 3300046684 | Bacteria | 282777 |
| 192 | Ga0495669_0000115 | 3300046684 | Bacteria | 51909 |
| 193 | Ga0495649_0022543 | 3300046694 | Bacteria | 3523 |
| 194 | Ga0495589_0025614 | 3300046794 | Bacteria | 2993 |
| 195 | Ga0495600_0293448 | 3300046809 | Bacteria | 1027 |
| 196 | Ga0495672_0002160 | 3300047320 | Bacteria | 18349 |
| 197 | Ga0495680_0104522 | 3300047322 | Bacteria | 2107 |
| 198 | Ga0495677_0015137 | 3300047445 | Bacteria | 2802 |
| 199 | Ga0496101_0565090 | 3300048904 | Bacteria | 899 |
| 200 | Ga0496102_0400401 | 3300048905 | Bacteria | 1291 |
| 201 | Ga0496104_0005276 | 3300048907 | Bacteria | 11295 |
| 202 | Ga0496104_0046712 | 3300048907 | Bacteria | 4079 |
| 203 | Ga0496104_0495807 | 3300048907 | Bacteria | 1132 |
| 204 | Ga0496105_0002923 | 3300048908 | Bacteria | 12535 |
| 205 | Ga0496105_0159436 | 3300048908 | Bacteria | 1852 |
| 206 | Ga0496106_0107153 | 3300048909 | Bacteria | 2173 |
| 207 | Ga0496106_0331500 | 3300048909 | Bacteria | 1222 |
| 208 | Ga0496108_0018112 | 3300048911 | Bacteria | 5762 |
| 209 | Ga0496109_0004753 | 3300048912 | Bacteria | 11342 |
| 210 | Ga0496110_0016664 | 3300048913 | Bacteria | 6138 |
| 211 | Ga0496111_0012894 | 3300048914 | Bacteria | 5671 |
| 212 | Ga0496114_0169717 | 3300048917 | Bacteria | 1901 |
| 213 | Ga0496116_0000479 | 3300048919 | Bacteria | 55101 |
| 214 | Ga0496117_0017041 | 3300048920 | Bacteria | 6085 |
| 215 | Ga0496119_0002316 | 3300048922 | Bacteria | 21003 |
| 216 | Ga0496119_0004244 | 3300048922 | Bacteria | 14370 |
| 217 | Ga0496119_0014048 | 3300048922 | Bacteria | 6306 |
| 218 | Ga0496119_0014935 | 3300048922 | Bacteria | 6033 |
| 219 | Ga0496120_0000197 | 3300048923 | Bacteria | 103378 |
| 220 | Ga0496120_0000394 | 3300048923 | Bacteria | 70310 |
| 221 | Ga0496121_0022884 | 3300048924 | Bacteria | 6040 |
| 222 | Ga0496121_0032902 | 3300048924 | Bacteria | 4704 |
| 223 | Ga0501031_0121477 | 3300049568 | Bacteria | 1707 |
| 224 | Ga0501032_0013814 | 3300049569 | Bacteria | 5729 |
| 225 | Ga0501033_0005558 | 3300049570 | Bacteria | 9969 |
| 226 | Ga0501033_0154323 | 3300049570 | Bacteria | 1655 |
| 227 | Ga0501034_0001731 | 3300049571 | Bacteria | 28080 |
| 228 | Ga0501034_0007907 | 3300049571 | Bacteria | 11297 |
| 229 | Ga0501034_0037207 | 3300049571 | Bacteria | 4928 |
| 230 | Ga0501034_0043911 | 3300049571 | Bacteria | 4521 |
| 231 | Ga0501037_0004967 | 3300049573 | Bacteria | 9671 |
| 232 | Ga0501038_0029319 | 3300049574 | Bacteria | 4878 |
| 233 | Ga0501038_0222909 | 3300049574 | Bacteria | 1504 |
| 234 | Ga0501040_0151364 | 3300049576 | Bacteria | 1637 |
| 235 | Ga0501042_0206027 | 3300049578 | Bacteria | 1418 |
| 236 | Ga0501047_0049337 | 3300049581 | Bacteria | 4065 |
| 237 | Ga0501047_0058462 | 3300049581 | Bacteria | 3725 |
| 238 | Ga0501068_0017368 | 3300049584 | Bacteria | 4161 |
| 239 | Ga0501069_0026732 | 3300049585 | Bacteria | 3161 |
| 240 | Ga0501070_0003070 | 3300049586 | Bacteria | 14540 |
| 241 | Ga0501070_0061119 | 3300049586 | Bacteria | 3122 |
| 242 | Ga0501074_0100166 | 3300049590 | Bacteria | 2074 |
| 243 | Ga0501079_0200800 | 3300049741 | Bacteria | 1557 |
| 244 | Ga0501080_0023143 | 3300049742 | Bacteria | 5762 |
| 245 | Ga0501080_0231726 | 3300049742 | Bacteria | 1688 |
| 246 | Ga0501035_0102309 | 3300049822 | Bacteria | 2513 |
| 247 | Ga0501035_0195447 | 3300049822 | Bacteria | 1738 |
| 248 | Ga0501044_0003233 | 3300049823 | Bacteria | 18345 |
| 249 | Ga0501044_0004139 | 3300049823 | Bacteria | 16285 |
| 250 | Ga0501044_0295628 | 3300049823 | Bacteria | 1550 |
| 251 | nmdc:mga03683_41159_c1 | 3300050489 | Bacteria | 1897 |
| 252 | nmdc:mga00v17_45158_c2 | 3300050491 | Bacteria | 2106 |
| 253 | nmdc:mga0yw44_61496_c1 | 3300050492 | Bacteria | 2304 |
| 254 | nmdc:mga04h51_61386_c1 | 3300050495 | Bacteria | 1289 |
| 255 | nmdc:mga07m45_38278_c1 | 3300050496 | Bacteria | 2676 |
| 256 | nmdc:mga0sz30_45552_c1 | 3300050516 | Bacteria | 1850 |
| 257 | Ga0500644_0002517 | 3300053088 | Bacteria | 4575 |
| 258 | Ga0500566_0001099 | 3300053094 | Bacteria | 15666 |
| 259 | Ga0500562_006063 | 3300053108 | Bacteria | 3043 |
| 260 | Ga0500618_001815 | 3300053125 | Bacteria | 8952 |
| 261 | Ga0500655_013205 | 3300053133 | Bacteria | 1506 |
| 262 | Ga0500573_0105511 | 3300053140 | Bacteria | 1582 |
| 263 | Ga0500616_0080025 | 3300053153 | Bacteria | 1644 |
| 264 | Ga0500637_0018830 | 3300053178 | Bacteria | 3715 |
| 265 | Ga0501082_0164849 | 3300060353 | Bacteria | 1926 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049571 | Ga0501034_0037207 | Ga0501034_0037207_36_710 | 200 |
| 2 | 3300050491 | nmdc:mga00v17_45158_c2 | nmdc:mga00v17_45158_c2_466_1248 | 210 |
| 3 | 3300005335 | Ga0070666_10086890 | Ga0070666_100868902 | 211 |
| 4 | 3300005842 | Ga0068858_100313222 | Ga0068858_1003132221 | 211 |
| 5 | 3300009093 | Ga0105240_10000854 | Ga0105240_1000085443 | 211 |
| 6 | 3300009551 | Ga0105238_10066388 | Ga0105238_100663882 | 211 |
| 7 | 3300025903 | Ga0207680_10071022 | Ga0207680_100710222 | 211 |
| 8 | 3300025913 | Ga0207695_10045503 | Ga0207695_100455032 | 211 |
| 9 | 3300025924 | Ga0207694_10099484 | Ga0207694_100994843 | 211 |
| 10 | 3300042010 | Ga0439452_000097 | Ga0439452_000097_25777_26553 | 215 |
| 11 | 3300053125 | Ga0500618_001815 | Ga0500618_001815_4781_5542 | 215 |
| 12 | 3300006038 | Ga0075365_10326013 | Ga0075365_103260132 | 221 |
| 13 | 3300047320 | Ga0495672_0002160 | Ga0495672_0002160_11173_11928 | 223 |
| 14 | 3300053094 | Ga0500566_0001099 | Ga0500566_0001099_8637_9413 | 223 |
| 15 | 3300049568 | Ga0501031_0121477 | Ga0501031_0121477_515_1285 | 224 |
| 16 | 3300049569 | Ga0501032_0013814 | Ga0501032_0013814_602_1372 | 224 |
| 17 | 3300049570 | Ga0501033_0154323 | Ga0501033_0154323_511_1281 | 224 |
| 18 | 3300049573 | Ga0501037_0004967 | Ga0501037_0004967_7470_8240 | 224 |
| 19 | 3300049574 | Ga0501038_0029319 | Ga0501038_0029319_3545_4315 | 224 |
| 20 | 3300049581 | Ga0501047_0049337 | Ga0501047_0049337_2791_3561 | 224 |
| 21 | 3300049586 | Ga0501070_0003070 | Ga0501070_0003070_9602_10372 | 224 |
| 22 | 3300049590 | Ga0501074_0100166 | Ga0501074_0100166_301_1071 | 224 |
| 23 | 3300049742 | Ga0501080_0023143 | Ga0501080_0023143_3640_4410 | 224 |
| 24 | 3300049822 | Ga0501035_0102309 | Ga0501035_0102309_1589_2359 | 224 |
| 25 | 3300049823 | Ga0501044_0003233 | Ga0501044_0003233_12733_13503 | 224 |
| 26 | 3300035085 | Ga0373929_0001099 | Ga0373929_0001099_2471_3199 | 226 |
| 27 | 3300035112 | Ga0373932_0000943 | Ga0373932_0000943_3932_4660 | 226 |
| 28 | 3300035691 | Ga0373931_0000029 | Ga0373931_0000029_25270_25998 | 226 |
| 29 | 3300045049 | Ga0466959_0394876 | Ga0466959_0394876_52_744 | 226 |
| 30 | 3300046463 | Ga0495653_0086563 | Ga0495653_0086563_445_1203 | 229 |
| 31 | 3300046514 | Ga0495618_0035059 | Ga0495618_0035059_1250_2008 | 229 |
| 32 | 3300046675 | Ga0495657_0148936 | Ga0495657_0148936_416_1174 | 229 |
| 33 | 3300046809 | Ga0495600_0293448 | Ga0495600_0293448_103_858 | 229 |
| 34 | 3300047322 | Ga0495680_0104522 | Ga0495680_0104522_938_1696 | 229 |
| 35 | 3300006038 | Ga0075365_10076278 | Ga0075365_100762783 | 230 |
| 36 | 3300006048 | Ga0075363_100260464 | Ga0075363_1002604642 | 230 |
| 37 | 3300013104 | Ga0157370_10124760 | Ga0157370_101247603 | 230 |
| 38 | 3300050492 | nmdc:mga0yw44_61496_c1 | nmdc:mga0yw44_61496_c1_987_1709 | 230 |
| 39 | 3300031838 | Ga0307518_10104329 | Ga0307518_101043291 | 231 |
| 40 | iso_pu_bacteria | 2684623035 | 2686537410 | 231 |
| 41 | iso_pu_bacteria | 2687453737 | 2689955808 | 231 |
| 42 | iso_pu_bacteria | 8002784119 | 8002791106 | 231 |
| 43 | 3300031730 | Ga0307516_10000937 | Ga0307516_100009373 | 232 |
| 44 | 3300045836 | Ga0466958_0431686 | Ga0466958_0431686_12_716 | 232 |
| 45 | 3300050495 | nmdc:mga04h51_61386_c1 | nmdc:mga04h51_61386_c1_35_841 | 232 |
| 46 | iso_pu_bacteria | 2547132424 | 2548696586 | 233 |
| 47 | iso_pu_bacteria | 2671180195 | 2671836569 | 233 |
| 48 | iso_pu_bacteria | 2684623035 | 2686539594 | 233 |
| 49 | iso_pu_bacteria | 2773857922 | 2774854725 | 233 |
| 50 | iso_pu_bacteria | 2895880812 | 2895881608 | 233 |
| 51 | iso_pu_bacteria | 2919713450 | 2919713521 | 233 |
| 52 | iso_pu_bacteria | 8002784119 | 8002787727 | 233 |
| 53 | iso_pu_bacteria | 8002784119 | 8002789483 | 233 |
| 54 | 3300005842 | Ga0068858_100001695 | Ga0068858_10000169517 | 234 |
| 55 | 3300009101 | Ga0105247_10001423 | Ga0105247_100014232 | 234 |
| 56 | 3300014968 | Ga0157379_10001026 | Ga0157379_1000102617 | 234 |
| 57 | 3300025900 | Ga0207710_10000545 | Ga0207710_100005453 | 234 |
| 58 | 3300026035 | Ga0207703_10001291 | Ga0207703_100012914 | 234 |
| 59 | 3300039062 | Ga0400483_143208 | Ga0400483_143208_3098_3865 | 234 |
| 60 | 3300039062 | Ga0400483_216221 | Ga0400483_216221_1204_1971 | 234 |
| 61 | 3300048907 | Ga0496104_0046712 | Ga0496104_0046712_2492_3265 | 234 |
| 62 | 3300048922 | Ga0496119_0014048 | Ga0496119_0014048_4306_5079 | 234 |
| 63 | 3300048924 | Ga0496121_0022884 | Ga0496121_0022884_4051_4824 | 234 |
| 64 | 3300005347 | Ga0070668_100004329 | Ga0070668_1000043299 | 235 |
| 65 | 3300005435 | Ga0070714_100755668 | Ga0070714_1007556681 | 235 |
| 66 | 3300005617 | Ga0068859_100005689 | Ga0068859_1000056895 | 235 |
| 67 | 3300005617 | Ga0068859_100074361 | Ga0068859_1000743613 | 235 |
| 68 | 3300005842 | Ga0068858_100070362 | Ga0068858_1000703622 | 235 |
| 69 | 3300005843 | Ga0068860_100000382 | Ga0068860_1000003827 | 235 |
| 70 | 3300005844 | Ga0068862_100000066 | Ga0068862_100000066100 | 235 |
| 71 | 3300005844 | Ga0068862_100004369 | Ga0068862_1000043697 | 235 |
| 72 | 3300006931 | Ga0097620_100005689 | Ga0097620_1000056895 | 235 |
| 73 | 3300006931 | Ga0097620_100074364 | Ga0097620_1000743641 | 235 |
| 74 | 3300009177 | Ga0105248_10007917 | Ga0105248_100079178 | 235 |
| 75 | 3300009177 | Ga0105248_10036696 | Ga0105248_100366962 | 235 |
| 76 | 3300009553 | Ga0105249_10002922 | Ga0105249_1000292215 | 235 |
| 77 | 3300025900 | Ga0207710_10000556 | Ga0207710_1000055612 | 235 |
| 78 | 3300025900 | Ga0207710_10000571 | Ga0207710_1000057113 | 235 |
| 79 | 3300025929 | Ga0207664_10660541 | Ga0207664_106605412 | 235 |
| 80 | 3300025941 | Ga0207711_10000365 | Ga0207711_1000036546 | 235 |
| 81 | 3300025941 | Ga0207711_10073208 | Ga0207711_100732082 | 235 |
| 82 | 3300025961 | Ga0207712_10009683 | Ga0207712_100096834 | 235 |
| 83 | 3300025972 | Ga0207668_10233724 | Ga0207668_102337242 | 235 |
| 84 | 3300026035 | Ga0207703_10000071 | Ga0207703_1000007169 | 235 |
| 85 | 3300028380 | Ga0268265_10000062 | Ga0268265_1000006297 | 235 |
| 86 | 3300028380 | Ga0268265_10012049 | Ga0268265_100120495 | 235 |
| 87 | 3300028381 | Ga0268264_10000008 | Ga0268264_10000008265 | 235 |
| 88 | 3300048907 | Ga0496104_0495807 | Ga0496104_0495807_74_796 | 235 |
| 89 | 3300048908 | Ga0496105_0159436 | Ga0496105_0159436_301_1023 | 235 |
| 90 | 3300048909 | Ga0496106_0107153 | Ga0496106_0107153_169_891 | 235 |
| 91 | 3300048919 | Ga0496116_0000479 | Ga0496116_0000479_36537_37256 | 235 |
| 92 | 3300048920 | Ga0496117_0017041 | Ga0496117_0017041_22_741 | 235 |
| 93 | 3300048922 | Ga0496119_0002316 | Ga0496119_0002316_19202_19924 | 235 |
| 94 | 3300048922 | Ga0496119_0014935 | Ga0496119_0014935_746_1465 | 235 |
| 95 | 3300048923 | Ga0496120_0000394 | Ga0496120_0000394_7335_8057 | 235 |
| 96 | 3300048924 | Ga0496121_0032902 | Ga0496121_0032902_636_1358 | 235 |
| 97 | iso_pu_bacteria | 2773857922 | 2774854766 | 235 |
| 98 | 3300031251 | Ga0265327_10000252 | Ga0265327_1000025275 | 236 |
| 99 | 3300046558 | Ga0495633_0030855 | Ga0495633_0030855_60_773 | 236 |
| 100 | 3300049574 | Ga0501038_0222909 | Ga0501038_0222909_494_1216 | 236 |
| 101 | iso_pu_bacteria | 2508501039 | 2508673112 | 236 |
| 102 | 3300049581 | Ga0501047_0058462 | Ga0501047_0058462_2934_3659 | 237 |
| 103 | 3300039062 | Ga0400483_028153 | Ga0400483_028153_14167_14955 | 238 |
| 104 | 3300049570 | Ga0501033_0005558 | Ga0501033_0005558_8086_8856 | 238 |
| 105 | 3300049571 | Ga0501034_0001731 | Ga0501034_0001731_8346_9149 | 238 |
| 106 | 3300049585 | Ga0501069_0026732 | Ga0501069_0026732_766_1536 | 238 |
| 107 | 3300049823 | Ga0501044_0004139 | Ga0501044_0004139_3214_3984 | 238 |
| 108 | iso_pu_bacteria | 2842888712 | 2842890794 | 238 |
| 109 | 3300049576 | Ga0501040_0151364 | Ga0501040_0151364_64_816 | 239 |
| 110 | 3300049578 | Ga0501042_0206027 | Ga0501042_0206027_23_775 | 239 |
| 111 | 3300049586 | Ga0501070_0061119 | Ga0501070_0061119_246_1010 | 239 |
| 112 | 3300049741 | Ga0501079_0200800 | Ga0501079_0200800_312_1064 | 239 |
| 113 | 3300060353 | Ga0501082_0164849 | Ga0501082_0164849_917_1669 | 239 |
| 114 | iso_pu_bacteria | 2895880812 | 2895883380 | 239 |
| 115 | iso_pu_bacteria | 2895880812 | 2895884723 | 239 |
| 116 | 3300021384 | Ga0213876_10000185 | Ga0213876_1000018565 | 240 |
| 117 | 3300039437 | Ga0436365_0321092 | Ga0436365_0321092_114_845 | 240 |
| 118 | 3300039437 | Ga0436365_0820464 | Ga0436365_0820464_2309_3040 | 240 |
| 119 | 3300049584 | Ga0501068_0017368 | Ga0501068_0017368_1462_2217 | 240 |
| 120 | 3300049742 | Ga0501080_0231726 | Ga0501080_0231726_448_1203 | 240 |
| 121 | 3300037853 | Ga0436364_0986343 | Ga0436364_0986343_335_1072 | 241 |
| 122 | 3300049571 | Ga0501034_0043911 | Ga0501034_0043911_939_1733 | 241 |
| 123 | 3300053108 | Ga0500562_006063 | Ga0500562_006063_702_1442 | 241 |
| 124 | iso_pu_bacteria | 2510065045 | 2510246990 | 241 |
| 125 | iso_pu_bacteria | 2515154122 | 2515681239 | 241 |
| 126 | iso_pu_bacteria | 2718217991 | 2719637988 | 241 |
| 127 | iso_pu_bacteria | 2902682994 | 2902686315 | 241 |
| 128 | iso_pu_bacteria | 8055266321 | 8055273041 | 241 |
| 129 | 3300006048 | Ga0075363_100133940 | Ga0075363_1001339402 | 242 |
| 130 | 3300046455 | Ga0495603_0071559 | Ga0495603_0071559_1105_1842 | 242 |
| 131 | 3300046530 | Ga0495654_0212077 | Ga0495654_0212077_55_792 | 242 |
| 132 | 3300046557 | Ga0495622_0033325 | Ga0495622_0033325_408_1145 | 242 |
| 133 | 3300046694 | Ga0495649_0022543 | Ga0495649_0022543_1737_2474 | 242 |
| 134 | 3300053133 | Ga0500655_013205 | Ga0500655_013205_610_1347 | 242 |
| 135 | 3300053178 | Ga0500637_0018830 | Ga0500637_0018830_208_945 | 242 |
| 136 | 3300013105 | Ga0157369_10007697 | Ga0157369_1000769711 | 243 |
| 137 | 3300046660 | Ga0495625_0004331 | Ga0495625_0004331_10005_10766 | 243 |
| 138 | 3300005335 | Ga0070666_10021923 | Ga0070666_100219231 | 244 |
| 139 | 3300005338 | Ga0068868_100006720 | Ga0068868_1000067202 | 244 |
| 140 | 3300005355 | Ga0070671_100049705 | Ga0070671_1000497053 | 244 |
| 141 | 3300005364 | Ga0070673_100106196 | Ga0070673_1001061962 | 244 |
| 142 | 3300005367 | Ga0070667_100014320 | Ga0070667_1000143205 | 244 |
| 143 | 3300005548 | Ga0070665_100005712 | Ga0070665_1000057129 | 244 |
| 144 | 3300005617 | Ga0068859_100030090 | Ga0068859_1000300902 | 244 |
| 145 | 3300005618 | Ga0068864_100019578 | Ga0068864_1000195784 | 244 |
| 146 | 3300005841 | Ga0068863_100156701 | Ga0068863_1001567012 | 244 |
| 147 | 3300006048 | Ga0075363_100001213 | Ga0075363_1000012133 | 244 |
| 148 | 3300006237 | Ga0097621_100004696 | Ga0097621_1000046966 | 244 |
| 149 | 3300006881 | Ga0068865_100578382 | Ga0068865_1005783821 | 244 |
| 150 | 3300006931 | Ga0097620_100030090 | Ga0097620_1000300904 | 244 |
| 151 | 3300009101 | Ga0105247_10056328 | Ga0105247_100563283 | 244 |
| 152 | 3300009177 | Ga0105248_10005754 | Ga0105248_1000575416 | 244 |
| 153 | 3300013296 | Ga0157374_10019901 | Ga0157374_100199012 | 244 |
| 154 | 3300013297 | Ga0157378_10017452 | Ga0157378_100174522 | 244 |
| 155 | 3300013306 | Ga0163162_10113949 | Ga0163162_101139492 | 244 |
| 156 | 3300014325 | Ga0163163_10002708 | Ga0163163_100027088 | 244 |
| 157 | 3300014968 | Ga0157379_10003362 | Ga0157379_100033625 | 244 |
| 158 | 3300014969 | Ga0157376_10011857 | Ga0157376_100118572 | 244 |
| 159 | 3300025903 | Ga0207680_10018201 | Ga0207680_100182013 | 244 |
| 160 | 3300025941 | Ga0207711_10005445 | Ga0207711_100054458 | 244 |
| 161 | 3300025960 | Ga0207651_10221305 | Ga0207651_102213052 | 244 |
| 162 | 3300026023 | Ga0207677_10364934 | Ga0207677_103649342 | 244 |
| 163 | 3300026035 | Ga0207703_10018192 | Ga0207703_100181926 | 244 |
| 164 | 3300026089 | Ga0207648_10271496 | Ga0207648_102714962 | 244 |
| 165 | 3300026095 | Ga0207676_10009299 | Ga0207676_100092996 | 244 |
| 166 | 3300028381 | Ga0268264_10130834 | Ga0268264_101308342 | 244 |
| 167 | 3300044656 | Ga0466969_0042021 | Ga0466969_0042021_986_1750 | 244 |
| 168 | 3300044684 | Ga0466966_0052761 | Ga0466966_0052761_658_1422 | 244 |
| 169 | 3300044693 | Ga0466961_0093497 | Ga0466961_0093497_1072_1836 | 244 |
| 170 | 3300044765 | Ga0466970_0011935 | Ga0466970_0011935_3180_3944 | 244 |
| 171 | 3300044842 | Ga0466957_0021721 | Ga0466957_0021721_2274_3038 | 244 |
| 172 | 3300046519 | Ga0495632_0011496 | Ga0495632_0011496_3739_4488 | 244 |
| 173 | 3300046558 | Ga0495633_0002978 | Ga0495633_0002978_10500_11249 | 244 |
| 174 | 3300048904 | Ga0496101_0565090 | Ga0496101_0565090_72_806 | 244 |
| 175 | 3300048905 | Ga0496102_0400401 | Ga0496102_0400401_462_1196 | 244 |
| 176 | 3300048907 | Ga0496104_0005276 | Ga0496104_0005276_6274_7008 | 244 |
| 177 | 3300048908 | Ga0496105_0002923 | Ga0496105_0002923_393_1127 | 244 |
| 178 | 3300048909 | Ga0496106_0331500 | Ga0496106_0331500_140_874 | 244 |
| 179 | 3300048911 | Ga0496108_0018112 | Ga0496108_0018112_4638_5372 | 244 |
| 180 | 3300048912 | Ga0496109_0004753 | Ga0496109_0004753_6472_7206 | 244 |
| 181 | 3300048913 | Ga0496110_0016664 | Ga0496110_0016664_1597_2331 | 244 |
| 182 | 3300048914 | Ga0496111_0012894 | Ga0496111_0012894_4115_4849 | 244 |
| 183 | 3300048917 | Ga0496114_0169717 | Ga0496114_0169717_359_1093 | 244 |
| 184 | 3300049571 | Ga0501034_0007907 | Ga0501034_0007907_2404_3204 | 244 |
| 185 | 3300053088 | Ga0500644_0002517 | Ga0500644_0002517_824_1573 | 244 |
| 186 | 3300053140 | Ga0500573_0105511 | Ga0500573_0105511_499_1233 | 244 |
| 187 | 3300005335 | Ga0070666_10153314 | Ga0070666_101533142 | 245 |
| 188 | 3300005353 | Ga0070669_100642457 | Ga0070669_1006424571 | 245 |
| 189 | 3300005364 | Ga0070673_100309863 | Ga0070673_1003098632 | 245 |
| 190 | 3300005367 | Ga0070667_100005747 | Ga0070667_10000574711 | 245 |
| 191 | 3300005617 | Ga0068859_100001743 | Ga0068859_10000174317 | 245 |
| 192 | 3300005843 | Ga0068860_100008642 | Ga0068860_1000086425 | 245 |
| 193 | 3300005844 | Ga0068862_100006074 | Ga0068862_1000060747 | 245 |
| 194 | 3300006058 | Ga0075432_10035632 | Ga0075432_100356322 | 245 |
| 195 | 3300006353 | Ga0075370_10013826 | Ga0075370_100138263 | 245 |
| 196 | 3300006931 | Ga0097620_100001743 | Ga0097620_10000174317 | 245 |
| 197 | 3300025903 | Ga0207680_10046508 | Ga0207680_100465082 | 245 |
| 198 | 3300025931 | Ga0207644_10498565 | Ga0207644_104985652 | 245 |
| 199 | 3300025960 | Ga0207651_10378675 | Ga0207651_103786752 | 245 |
| 200 | 3300025972 | Ga0207668_10354087 | Ga0207668_103540872 | 245 |
| 201 | 3300025986 | Ga0207658_10041528 | Ga0207658_100415282 | 245 |
| 202 | 3300026088 | Ga0207641_10466285 | Ga0207641_104662851 | 245 |
| 203 | 3300026095 | Ga0207676_10260956 | Ga0207676_102609561 | 245 |
| 204 | 3300026118 | Ga0207675_100010006 | Ga0207675_1000100067 | 245 |
| 205 | 3300028380 | Ga0268265_10006091 | Ga0268265_100060917 | 245 |
| 206 | 3300028381 | Ga0268264_10013433 | Ga0268264_100134332 | 245 |
| 207 | 3300031728 | Ga0316578_10260916 | Ga0316578_102609161 | 245 |
| 208 | 3300032133 | Ga0316583_10004355 | Ga0316583_100043555 | 245 |
| 209 | 3300036647 | Ga0316582_0037897 | Ga0316582_0037897_781_1518 | 245 |
| 210 | 3300036712 | Ga0316584_0126565 | Ga0316584_0126565_566_1315 | 245 |
| 211 | 3300042115 | Ga0450911_006907 | Ga0450911_006907_528_1301 | 245 |
| 212 | 3300046499 | Ga0495594_0050431 | Ga0495594_0050431_1346_2092 | 245 |
| 213 | 3300046794 | Ga0495589_0025614 | Ga0495589_0025614_1721_2467 | 245 |
| 214 | 3300050496 | nmdc:mga07m45_38278_c1 | nmdc:mga07m45_38278_c1_1281_2018 | 245 |
| 215 | 3300053153 | Ga0500616_0080025 | Ga0500616_0080025_435_1196 | 245 |
| 216 | iso_pu_bacteria | 3000865235 | 3000867684 | 245 |
| 217 | 3300025924 | Ga0207694_10202123 | Ga0207694_102021232 | 246 |
| 218 | 3300031731 | Ga0307405_10240027 | Ga0307405_102400272 | 246 |
| 219 | 3300031824 | Ga0307413_10203557 | Ga0307413_102035572 | 246 |
| 220 | 3300032004 | Ga0307414_10064299 | Ga0307414_100642994 | 246 |
| 221 | 3300039062 | Ga0400483_086606 | Ga0400483_086606_924_1694 | 246 |
| 222 | 3300039062 | Ga0400483_205722 | Ga0400483_205722_7160_7957 | 246 |
| 223 | 3300041407 | Ga0439447_000181 | Ga0439447_000181_19228_20004 | 246 |
| 224 | 3300041407 | Ga0439447_003501 | Ga0439447_003501_4133_4909 | 246 |
| 225 | 3300041411 | Ga0439466_0001981 | Ga0439466_0001981_882_1658 | 246 |
| 226 | 3300041411 | Ga0439466_0032802 | Ga0439466_0032802_91_867 | 246 |
| 227 | 3300042137 | Ga0450902_000305 | Ga0450902_000305_3896_4672 | 246 |
| 228 | 3300042876 | Ga0451577_0794438 | Ga0451577_0794438_16_762 | 246 |
| 229 | 3300046660 | Ga0495625_0124248 | Ga0495625_0124248_856_1611 | 246 |
| 230 | 3300046684 | Ga0495669_0000002 | Ga0495669_0000002_72249_73016 | 246 |
| 231 | 3300046684 | Ga0495669_0000115 | Ga0495669_0000115_48195_48950 | 246 |
| 232 | 3300047445 | Ga0495677_0015137 | Ga0495677_0015137_503_1258 | 246 |
| 233 | 3300048922 | Ga0496119_0004244 | Ga0496119_0004244_4458_5279 | 246 |
| 234 | 3300048923 | Ga0496120_0000197 | Ga0496120_0000197_66789_67610 | 246 |
| 235 | 3300005327 | Ga0070658_10032432 | Ga0070658_100324323 | 248 |
| 236 | 3300005329 | Ga0070683_100168318 | Ga0070683_1001683182 | 248 |
| 237 | 3300005329 | Ga0070683_100360062 | Ga0070683_1003600622 | 248 |
| 238 | 3300005336 | Ga0070680_100011864 | Ga0070680_1000118642 | 248 |
| 239 | 3300005344 | Ga0070661_100002127 | Ga0070661_10000212712 | 248 |
| 240 | 3300005344 | Ga0070661_100090059 | Ga0070661_1000900592 | 248 |
| 241 | 3300005457 | Ga0070662_100002184 | Ga0070662_1000021843 | 248 |
| 242 | 3300005457 | Ga0070662_100012726 | Ga0070662_1000127265 | 248 |
| 243 | 3300005457 | Ga0070662_100313357 | Ga0070662_1003133571 | 248 |
| 244 | 3300005458 | Ga0070681_10009625 | Ga0070681_100096253 | 248 |
| 245 | 3300005530 | Ga0070679_100040899 | Ga0070679_1000408992 | 248 |
| 246 | 3300005535 | Ga0070684_100049219 | Ga0070684_1000492192 | 248 |
| 247 | 3300005563 | Ga0068855_100012222 | Ga0068855_10001222212 | 248 |
| 248 | 3300005563 | Ga0068855_100014908 | Ga0068855_1000149083 | 248 |
| 249 | 3300005564 | Ga0070664_100020279 | Ga0070664_1000202796 | 248 |
| 250 | 3300005578 | Ga0068854_100023131 | Ga0068854_1000231312 | 248 |
| 251 | 3300005578 | Ga0068854_100705737 | Ga0068854_1007057371 | 248 |
| 252 | 3300006186 | Ga0075369_10108368 | Ga0075369_101083683 | 248 |
| 253 | 3300009174 | Ga0105241_10059466 | Ga0105241_100594662 | 248 |
| 254 | 3300010375 | Ga0105239_10174195 | Ga0105239_101741953 | 248 |
| 255 | 3300011119 | Ga0105246_10000032 | Ga0105246_1000003215 | 248 |
| 256 | 3300013100 | Ga0157373_10027995 | Ga0157373_100279954 | 248 |
| 257 | 3300013100 | Ga0157373_10029602 | Ga0157373_100296024 | 248 |
| 258 | 3300013102 | Ga0157371_10012870 | Ga0157371_100128703 | 248 |
| 259 | 3300013104 | Ga0157370_10061912 | Ga0157370_100619123 | 248 |
| 260 | 3300013105 | Ga0157369_10024942 | Ga0157369_100249424 | 248 |
| 261 | 3300013307 | Ga0157372_10606633 | Ga0157372_106066331 | 248 |
| 262 | 3300014745 | Ga0157377_10095201 | Ga0157377_100952011 | 248 |
| 263 | 3300025909 | Ga0207705_10487041 | Ga0207705_104870412 | 248 |
| 264 | 3300025912 | Ga0207707_10072127 | Ga0207707_100721273 | 248 |
| 265 | 3300025917 | Ga0207660_10065967 | Ga0207660_100659673 | 248 |
| 266 | 3300025919 | Ga0207657_10005883 | Ga0207657_1000588310 | 248 |
| 267 | 3300025920 | Ga0207649_10073166 | Ga0207649_100731662 | 248 |
| 268 | 3300025921 | Ga0207652_10032334 | Ga0207652_100323343 | 248 |
| 269 | 3300025926 | Ga0207659_10421168 | Ga0207659_104211682 | 248 |
| 270 | 3300025932 | Ga0207690_10002354 | Ga0207690_100023543 | 248 |
| 271 | 3300025933 | Ga0207706_10002856 | Ga0207706_100028569 | 248 |
| 272 | 3300025933 | Ga0207706_10005439 | Ga0207706_100054396 | 248 |
| 273 | 3300025933 | Ga0207706_10063198 | Ga0207706_100631984 | 248 |
| 274 | 3300025944 | Ga0207661_10174278 | Ga0207661_101742782 | 248 |
| 275 | 3300025945 | Ga0207679_10239209 | Ga0207679_102392092 | 248 |
| 276 | 3300025949 | Ga0207667_10106717 | Ga0207667_101067172 | 248 |
| 277 | 3300026041 | Ga0207639_10008247 | Ga0207639_100082476 | 248 |
| 278 | 3300026067 | Ga0207678_10094616 | Ga0207678_100946162 | 248 |
| 279 | 3300026116 | Ga0207674_10169937 | Ga0207674_101699372 | 248 |
| 280 | 3300046452 | Ga0495617_004369 | Ga0495617_004369_703_1467 | 248 |
| 281 | 3300046460 | Ga0495638_0000277 | Ga0495638_0000277_66245_67009 | 248 |
| 282 | 3300046460 | Ga0495638_0032629 | Ga0495638_0032629_1181_1942 | 248 |
| 283 | 3300046524 | Ga0495648_0000199 | Ga0495648_0000199_66245_67009 | 248 |
| 284 | 3300049822 | Ga0501035_0195447 | Ga0501035_0195447_633_1394 | 248 |
| 285 | 3300049823 | Ga0501044_0295628 | Ga0501044_0295628_116_877 | 248 |
| 286 | 3300050489 | nmdc:mga03683_41159_c1 | nmdc:mga03683_41159_c1_615_1367 | 248 |
| 287 | 3300050516 | nmdc:mga0sz30_45552_c1 | nmdc:mga0sz30_45552_c1_388_1140 | 248 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5djk-assembly1.cif.gz_A | structure of m. tuberculosis cysq, a pap phosphatase with po4 and 2ca bound | 0.944 | 1 | 243 |
| 5djg-assembly1.cif.gz_A | structure of m. tuberculosis cysq, a pap phosphatase with pap, mg, and li bound | 0.9425 | 1 | 243 |
| 5dji-assembly1.cif.gz_A | structure of m. tuberculosis cysq, a pap phosphatase with amp, po4, and 2mg bound | 0.9417 | 1 | 243 |
| 5djh-assembly1.cif.gz_A | structure of m. tuberculosis cysq, a pap phosphatase with amp, po4, and 3mg bound | 0.9349 | 1 | 243 |
| 5djf-assembly1.cif.gz_A | structure of m. tuberculosis cysq, a pap phosphatase - ligand-free structure | 0.9349 | 1 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WKJ1_154_255_3.40.190.80 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9398 | 133 | 232 | 3.40.190.80 |
| af_P9WKJ1_12_146_3.30.540.10 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 | 0.9346 | 1 | 124 | 3.30.540.10 |
| 2q74C01 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 | 0.9142 | 4 | 114 | 3.30.540.10 |
| af_P9WKJ1_154_255_3.40.190.80 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.9136 | 133 | 232 | 3.40.190.80 |
| 5zhhC01 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 | 0.9074 | 4 | 122 | 3.30.540.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D4XZT0-F1-model_v4 | deleted | 1.005 | 1 | 97 |
|
| AF-A0A1Q3MEU1-F1-model_v4 | deleted | 0.9922 | 3 | 243 |
|
| AF-A0A2Z6ALE3-F1-model_v4 | 3'(2'), 5'-bisphosphate nucleotidase | 0.9901 | 1 | 247 |
GO:0000103
GO:0008441 GO:0046872 GO:0050427 |
| AF-A0A165PIH6-F1-model_v4 | deleted | 0.9894 | 1 | 243 |
|
| AF-A0A1M3P914-F1-model_v4 | 3'(2'),5'-bisphosphate nucleotidase CysQ | 0.9891 | 1 | 245 |
GO:0000103
GO:0008441 GO:0046872 GO:0050427 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar