F388228

General Info

Members Datasets Scaffolds Average Seq Length
287 201 265 245

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0004244|Ga0496119_0004244_4458_5279
Length 273
Sequence MAFPERGFSVTDEKLQLDAQLAQRIATAAGELLLSLQRSGLYSGKELGKAGDHVANAFIMQTLRTHRPDDGILSEEEAGDPARLGKRRVWIVDPLDGTREYGEYPRVDWAVHIGLAIDGLPRAGAVSLPALSLTLCSDAPIAVAPPGSGALRMLVSRTRPAAEAVDVARLLGAELVPMGSAGAKAMAVLRNEADIYLHSGGQYEWDSCAPVAVAQAAGLHVSRIDGSALRYNCENPYLPDLLICRKEHAQEVLRLIQKVRAAPPRPLEKGVNS

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
3 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
4 2547132424 Nocardia nova SH22a Isolate Unclassified
5 2671180195 Frankia sp. CcI49 Isolate Nodule
6 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
7 2687453737 Frankia sp. BMG5.36 Isolate Nodule
8 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
9 2773857922 Frankia sp. CcI49 Isolate Nodule
10 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
11 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
12 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
13 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
14 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
112 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
113 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
116 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
121 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
122 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
123 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
124 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
140 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
141 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
191 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
192 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
193 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
194 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
195 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
196 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 8002784119 Frankia sp. AgB1.9 Isolate Nodule
201 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.33
Metatranscriptomes 0
Isolates 7.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.32
Nodule 4.18
Rhizoplane 4.88
Rhizosphere 74.22
Stem 0
Stem Tuber 0
Unclassified 9.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10032432 3300005327 Bacteria 4198
2 Ga0070683_100168318 3300005329 Bacteria 2080
3 Ga0070683_100360062 3300005329 Bacteria 1385
4 Ga0070666_10021923 3300005335 Bacteria 4143
5 Ga0070666_10086890 3300005335 Bacteria 2143
6 Ga0070666_10153314 3300005335 Bacteria 1608
7 Ga0070680_100011864 3300005336 Bacteria 6758
8 Ga0068868_100006720 3300005338 Bacteria 8164
9 Ga0070661_100002127 3300005344 Bacteria 13656
10 Ga0070661_100090059 3300005344 Bacteria 2272
11 Ga0070668_100004329 3300005347 Bacteria 10530
12 Ga0070669_100642457 3300005353 Bacteria 892
13 Ga0070671_100049705 3300005355 Bacteria 3488
14 Ga0070673_100106196 3300005364 Bacteria 2321
15 Ga0070673_100309863 3300005364 Bacteria 1392
16 Ga0070667_100005747 3300005367 Bacteria 10364
17 Ga0070667_100014320 3300005367 Bacteria 6554
18 Ga0070714_100755668 3300005435 Bacteria 940
19 Ga0070662_100002184 3300005457 Bacteria 11991
20 Ga0070662_100012726 3300005457 Bacteria 5584
21 Ga0070662_100313357 3300005457 Bacteria 1278
22 Ga0070681_10009625 3300005458 Bacteria 9503
23 Ga0070679_100040899 3300005530 Bacteria 4613
24 Ga0070684_100049219 3300005535 Bacteria 3657
25 Ga0070665_100005712 3300005548 Bacteria 12771
26 Ga0068855_100012222 3300005563 Bacteria 10376
27 Ga0068855_100014908 3300005563 Bacteria 9363
28 Ga0070664_100020279 3300005564 Bacteria 5474
29 Ga0068854_100023131 3300005578 Bacteria 4242
30 Ga0068854_100705737 3300005578 Bacteria 871
31 Ga0068859_100001743 3300005617 Bacteria 22161
32 Ga0068859_100005689 3300005617 Bacteria 12685
33 Ga0068859_100030090 3300005617 Bacteria 5448
34 Ga0068859_100074361 3300005617 Bacteria 3437
35 Ga0068864_100019578 3300005618 Bacteria 5661
36 Ga0068863_100156701 3300005841 Bacteria 2180
37 Ga0068858_100001695 3300005842 Bacteria 22530
38 Ga0068858_100070362 3300005842 Bacteria 3243
39 Ga0068858_100313222 3300005842 Bacteria 1499
40 Ga0068860_100000382 3300005843 Bacteria 58081
41 Ga0068860_100008642 3300005843 Bacteria 10149
42 Ga0068862_100000066 3300005844 Bacteria 124095
43 Ga0068862_100004369 3300005844 Bacteria 11962
44 Ga0068862_100006074 3300005844 Bacteria 10055
45 Ga0075365_10076278 3300006038 Bacteria 2263
46 Ga0075365_10326013 3300006038 Bacteria 1082
47 Ga0075363_100001213 3300006048 Bacteria 9522
48 Ga0075363_100133940 3300006048 Bacteria 1391
49 Ga0075363_100260464 3300006048 Bacteria 1000
50 Ga0075432_10035632 3300006058 Bacteria 1729
51 Ga0075369_10108368 3300006186 Bacteria 1251
52 Ga0097621_100004696 3300006237 Bacteria 9544
53 Ga0075370_10013826 3300006353 Bacteria 4295
54 Ga0068865_100578382 3300006881 Bacteria 947
55 Ga0097620_100001743 3300006931 Bacteria 22161
56 Ga0097620_100005689 3300006931 Bacteria 12685
57 Ga0097620_100030090 3300006931 Bacteria 5448
58 Ga0097620_100074364 3300006931 Bacteria 3437
59 Ga0105240_10000854 3300009093 Bacteria 54945
60 Ga0105247_10001423 3300009101 Bacteria 17370
61 Ga0105247_10056328 3300009101 Bacteria 2428
62 Ga0105241_10059466 3300009174 Bacteria 2938
63 Ga0105248_10005754 3300009177 Bacteria 13620
64 Ga0105248_10007917 3300009177 Bacteria 11679
65 Ga0105248_10036696 3300009177 Bacteria 5482
66 Ga0105238_10066388 3300009551 Bacteria 3609
67 Ga0105249_10002922 3300009553 Bacteria 14737
68 Ga0105239_10174195 3300010375 Bacteria 2407
69 Ga0105246_10000032 3300011119 Bacteria 51397
70 Ga0157373_10027995 3300013100 Bacteria 4066
71 Ga0157373_10029602 3300013100 Bacteria 3943
72 Ga0157371_10012870 3300013102 Bacteria 6371
73 Ga0157370_10061912 3300013104 Bacteria 3551
74 Ga0157370_10124760 3300013104 Bacteria 2404
75 Ga0157369_10007697 3300013105 Bacteria 12396
76 Ga0157369_10024942 3300013105 Bacteria 6643
77 Ga0157374_10019901 3300013296 Bacteria 5949
78 Ga0157378_10017452 3300013297 Bacteria 6300
79 Ga0163162_10113949 3300013306 Bacteria 2803
80 Ga0157372_10606633 3300013307 Bacteria 1276
81 Ga0163163_10002708 3300014325 Bacteria 14962
82 Ga0157377_10095201 3300014745 Bacteria 1765
83 Ga0157379_10001026 3300014968 Bacteria 22704
84 Ga0157379_10003362 3300014968 Bacteria 13542
85 Ga0157376_10011857 3300014969 Bacteria 6444
86 Ga0213876_10000185 3300021384 Bacteria 64516
87 Ga0207710_10000545 3300025900 Bacteria 22636
88 Ga0207710_10000556 3300025900 Bacteria 22299
89 Ga0207710_10000571 3300025900 Bacteria 22034
90 Ga0207680_10018201 3300025903 Bacteria 3728
91 Ga0207680_10046508 3300025903 Bacteria 2566
92 Ga0207680_10071022 3300025903 Bacteria 2157
93 Ga0207705_10487041 3300025909 Bacteria 957
94 Ga0207707_10072127 3300025912 Bacteria 3010
95 Ga0207695_10045503 3300025913 Bacteria 4658
96 Ga0207660_10065967 3300025917 Bacteria 2617
97 Ga0207657_10005883 3300025919 Bacteria 12777
98 Ga0207649_10073166 3300025920 Bacteria 2195
99 Ga0207652_10032334 3300025921 Bacteria 4397
100 Ga0207694_10099484 3300025924 Bacteria 2303
101 Ga0207694_10202123 3300025924 Bacteria 1617
102 Ga0207659_10421168 3300025926 Bacteria 1120
103 Ga0207664_10660541 3300025929 Bacteria 940
104 Ga0207644_10498565 3300025931 Bacteria 1004
105 Ga0207690_10002354 3300025932 Bacteria 11476
106 Ga0207706_10002856 3300025933 Bacteria 16769
107 Ga0207706_10005439 3300025933 Bacteria 11866
108 Ga0207706_10063198 3300025933 Bacteria 3260
109 Ga0207711_10000365 3300025941 Bacteria 47940
110 Ga0207711_10005445 3300025941 Bacteria 10760
111 Ga0207711_10073208 3300025941 Bacteria 2977
112 Ga0207661_10174278 3300025944 Bacteria 1874
113 Ga0207679_10239209 3300025945 Bacteria 1537
114 Ga0207667_10106717 3300025949 Bacteria 2889
115 Ga0207651_10221305 3300025960 Bacteria 1530
116 Ga0207651_10378675 3300025960 Bacteria 1199
117 Ga0207712_10009683 3300025961 Bacteria 6108
118 Ga0207668_10233724 3300025972 Bacteria 1483
119 Ga0207668_10354087 3300025972 Unclassified 1228
120 Ga0207658_10041528 3300025986 Bacteria 3331
121 Ga0207677_10364934 3300026023 Bacteria 1214
122 Ga0207703_10000071 3300026035 Bacteria 121299
123 Ga0207703_10001291 3300026035 Bacteria 23198
124 Ga0207703_10018192 3300026035 Bacteria 5488
125 Ga0207639_10008247 3300026041 Bacteria 7135
126 Ga0207678_10094616 3300026067 Bacteria 2553
127 Ga0207641_10466285 3300026088 Bacteria 1222
128 Ga0207648_10271496 3300026089 Bacteria 1515
129 Ga0207676_10009299 3300026095 Bacteria 6993
130 Ga0207676_10260956 3300026095 Bacteria 1564
131 Ga0207674_10169937 3300026116 Bacteria 2134
132 Ga0207675_100010006 3300026118 Bacteria 8885
133 Ga0268265_10000062 3300028380 Bacteria 148317
134 Ga0268265_10006091 3300028380 Bacteria 8189
135 Ga0268265_10012049 3300028380 Bacteria 5854
136 Ga0268264_10000008 3300028381 Bacteria 773387
137 Ga0268264_10013433 3300028381 Bacteria 6743
138 Ga0268264_10130834 3300028381 Bacteria 2224
139 Ga0265327_10000252 3300031251 Bacteria 106339
140 Ga0316578_10260916 3300031728 Bacteria 1039
141 Ga0307516_10000937 3300031730 Bacteria 40227
142 Ga0307405_10240027 3300031731 Bacteria 1342
143 Ga0307413_10203557 3300031824 Bacteria 1431
144 Ga0307518_10104329 3300031838 Bacteria 2026
145 Ga0307414_10064299 3300032004 Bacteria 2611
146 Ga0316583_10004355 3300032133 Bacteria 5050
147 Ga0373929_0001099 3300035085 Bacteria 5256
148 Ga0373932_0000943 3300035112 Bacteria 8518
149 Ga0373931_0000029 3300035691 Bacteria 116290
150 Ga0316582_0037897 3300036647 Bacteria 2992
151 Ga0316584_0126565 3300036712 Bacteria 1908
152 Ga0436364_0986343 3300037853 Bacteria 1240
153 Ga0400483_028153 3300039062 Bacteria 36990
154 Ga0400483_086606 3300039062 Bacteria 2852
155 Ga0400483_143208 3300039062 Bacteria 16664
156 Ga0400483_205722 3300039062 Bacteria 12693
157 Ga0400483_216221 3300039062 Bacteria 3834
158 Ga0436365_0321092 3300039437 Bacteria 982
159 Ga0436365_0820464 3300039437 Bacteria 3195
160 Ga0439447_000181 3300041407 Bacteria 22248
161 Ga0439447_003501 3300041407 Bacteria 5571
162 Ga0439466_0001981 3300041411 Bacteria 8027
163 Ga0439466_0032802 3300041411 Bacteria 1768
164 Ga0439452_000097 3300042010 Bacteria 74034
165 Ga0450911_006907 3300042115 Bacteria 1669
166 Ga0450902_000305 3300042137 Bacteria 5899
167 Ga0451577_0794438 3300042876 Bacteria 855
168 Ga0466969_0042021 3300044656 Bacteria 2284
169 Ga0466966_0052761 3300044684 Bacteria 2581
170 Ga0466961_0093497 3300044693 Bacteria 1897
171 Ga0466970_0011935 3300044765 Bacteria 4434
172 Ga0466957_0021721 3300044842 Bacteria 3782
173 Ga0466959_0394876 3300045049 Bacteria 940
174 Ga0466958_0431686 3300045836 Bacteria 852
175 Ga0495617_004369 3300046452 Bacteria 5150
176 Ga0495603_0071559 3300046455 Bacteria 2038
177 Ga0495638_0000277 3300046460 Bacteria 69421
178 Ga0495638_0032629 3300046460 Bacteria 3337
179 Ga0495653_0086563 3300046463 Bacteria 2303
180 Ga0495594_0050431 3300046499 Bacteria 2289
181 Ga0495618_0035059 3300046514 Bacteria 3149
182 Ga0495632_0011496 3300046519 Bacteria 5161
183 Ga0495648_0000199 3300046524 Bacteria 69421
184 Ga0495654_0212077 3300046530 Bacteria 823
185 Ga0495622_0033325 3300046557 Bacteria 2404
186 Ga0495633_0002978 3300046558 Bacteria 11579
187 Ga0495633_0030855 3300046558 Bacteria 2601
188 Ga0495625_0004331 3300046660 Bacteria 13476
189 Ga0495625_0124248 3300046660 Bacteria 1753
190 Ga0495657_0148936 3300046675 Bacteria 1454
191 Ga0495669_0000002 3300046684 Bacteria 282777
192 Ga0495669_0000115 3300046684 Bacteria 51909
193 Ga0495649_0022543 3300046694 Bacteria 3523
194 Ga0495589_0025614 3300046794 Bacteria 2993
195 Ga0495600_0293448 3300046809 Bacteria 1027
196 Ga0495672_0002160 3300047320 Bacteria 18349
197 Ga0495680_0104522 3300047322 Bacteria 2107
198 Ga0495677_0015137 3300047445 Bacteria 2802
199 Ga0496101_0565090 3300048904 Bacteria 899
200 Ga0496102_0400401 3300048905 Bacteria 1291
201 Ga0496104_0005276 3300048907 Bacteria 11295
202 Ga0496104_0046712 3300048907 Bacteria 4079
203 Ga0496104_0495807 3300048907 Bacteria 1132
204 Ga0496105_0002923 3300048908 Bacteria 12535
205 Ga0496105_0159436 3300048908 Bacteria 1852
206 Ga0496106_0107153 3300048909 Bacteria 2173
207 Ga0496106_0331500 3300048909 Bacteria 1222
208 Ga0496108_0018112 3300048911 Bacteria 5762
209 Ga0496109_0004753 3300048912 Bacteria 11342
210 Ga0496110_0016664 3300048913 Bacteria 6138
211 Ga0496111_0012894 3300048914 Bacteria 5671
212 Ga0496114_0169717 3300048917 Bacteria 1901
213 Ga0496116_0000479 3300048919 Bacteria 55101
214 Ga0496117_0017041 3300048920 Bacteria 6085
215 Ga0496119_0002316 3300048922 Bacteria 21003
216 Ga0496119_0004244 3300048922 Bacteria 14370
217 Ga0496119_0014048 3300048922 Bacteria 6306
218 Ga0496119_0014935 3300048922 Bacteria 6033
219 Ga0496120_0000197 3300048923 Bacteria 103378
220 Ga0496120_0000394 3300048923 Bacteria 70310
221 Ga0496121_0022884 3300048924 Bacteria 6040
222 Ga0496121_0032902 3300048924 Bacteria 4704
223 Ga0501031_0121477 3300049568 Bacteria 1707
224 Ga0501032_0013814 3300049569 Bacteria 5729
225 Ga0501033_0005558 3300049570 Bacteria 9969
226 Ga0501033_0154323 3300049570 Bacteria 1655
227 Ga0501034_0001731 3300049571 Bacteria 28080
228 Ga0501034_0007907 3300049571 Bacteria 11297
229 Ga0501034_0037207 3300049571 Bacteria 4928
230 Ga0501034_0043911 3300049571 Bacteria 4521
231 Ga0501037_0004967 3300049573 Bacteria 9671
232 Ga0501038_0029319 3300049574 Bacteria 4878
233 Ga0501038_0222909 3300049574 Bacteria 1504
234 Ga0501040_0151364 3300049576 Bacteria 1637
235 Ga0501042_0206027 3300049578 Bacteria 1418
236 Ga0501047_0049337 3300049581 Bacteria 4065
237 Ga0501047_0058462 3300049581 Bacteria 3725
238 Ga0501068_0017368 3300049584 Bacteria 4161
239 Ga0501069_0026732 3300049585 Bacteria 3161
240 Ga0501070_0003070 3300049586 Bacteria 14540
241 Ga0501070_0061119 3300049586 Bacteria 3122
242 Ga0501074_0100166 3300049590 Bacteria 2074
243 Ga0501079_0200800 3300049741 Bacteria 1557
244 Ga0501080_0023143 3300049742 Bacteria 5762
245 Ga0501080_0231726 3300049742 Bacteria 1688
246 Ga0501035_0102309 3300049822 Bacteria 2513
247 Ga0501035_0195447 3300049822 Bacteria 1738
248 Ga0501044_0003233 3300049823 Bacteria 18345
249 Ga0501044_0004139 3300049823 Bacteria 16285
250 Ga0501044_0295628 3300049823 Bacteria 1550
251 nmdc:mga03683_41159_c1 3300050489 Bacteria 1897
252 nmdc:mga00v17_45158_c2 3300050491 Bacteria 2106
253 nmdc:mga0yw44_61496_c1 3300050492 Bacteria 2304
254 nmdc:mga04h51_61386_c1 3300050495 Bacteria 1289
255 nmdc:mga07m45_38278_c1 3300050496 Bacteria 2676
256 nmdc:mga0sz30_45552_c1 3300050516 Bacteria 1850
257 Ga0500644_0002517 3300053088 Bacteria 4575
258 Ga0500566_0001099 3300053094 Bacteria 15666
259 Ga0500562_006063 3300053108 Bacteria 3043
260 Ga0500618_001815 3300053125 Bacteria 8952
261 Ga0500655_013205 3300053133 Bacteria 1506
262 Ga0500573_0105511 3300053140 Bacteria 1582
263 Ga0500616_0080025 3300053153 Bacteria 1644
264 Ga0500637_0018830 3300053178 Bacteria 3715
265 Ga0501082_0164849 3300060353 Bacteria 1926

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0037207 Ga0501034_0037207_36_710 200
2 3300050491 nmdc:mga00v17_45158_c2 nmdc:mga00v17_45158_c2_466_1248 210
3 3300005335 Ga0070666_10086890 Ga0070666_100868902 211
4 3300005842 Ga0068858_100313222 Ga0068858_1003132221 211
5 3300009093 Ga0105240_10000854 Ga0105240_1000085443 211
6 3300009551 Ga0105238_10066388 Ga0105238_100663882 211
7 3300025903 Ga0207680_10071022 Ga0207680_100710222 211
8 3300025913 Ga0207695_10045503 Ga0207695_100455032 211
9 3300025924 Ga0207694_10099484 Ga0207694_100994843 211
10 3300042010 Ga0439452_000097 Ga0439452_000097_25777_26553 215
11 3300053125 Ga0500618_001815 Ga0500618_001815_4781_5542 215
12 3300006038 Ga0075365_10326013 Ga0075365_103260132 221
13 3300047320 Ga0495672_0002160 Ga0495672_0002160_11173_11928 223
14 3300053094 Ga0500566_0001099 Ga0500566_0001099_8637_9413 223
15 3300049568 Ga0501031_0121477 Ga0501031_0121477_515_1285 224
16 3300049569 Ga0501032_0013814 Ga0501032_0013814_602_1372 224
17 3300049570 Ga0501033_0154323 Ga0501033_0154323_511_1281 224
18 3300049573 Ga0501037_0004967 Ga0501037_0004967_7470_8240 224
19 3300049574 Ga0501038_0029319 Ga0501038_0029319_3545_4315 224
20 3300049581 Ga0501047_0049337 Ga0501047_0049337_2791_3561 224
21 3300049586 Ga0501070_0003070 Ga0501070_0003070_9602_10372 224
22 3300049590 Ga0501074_0100166 Ga0501074_0100166_301_1071 224
23 3300049742 Ga0501080_0023143 Ga0501080_0023143_3640_4410 224
24 3300049822 Ga0501035_0102309 Ga0501035_0102309_1589_2359 224
25 3300049823 Ga0501044_0003233 Ga0501044_0003233_12733_13503 224
26 3300035085 Ga0373929_0001099 Ga0373929_0001099_2471_3199 226
27 3300035112 Ga0373932_0000943 Ga0373932_0000943_3932_4660 226
28 3300035691 Ga0373931_0000029 Ga0373931_0000029_25270_25998 226
29 3300045049 Ga0466959_0394876 Ga0466959_0394876_52_744 226
30 3300046463 Ga0495653_0086563 Ga0495653_0086563_445_1203 229
31 3300046514 Ga0495618_0035059 Ga0495618_0035059_1250_2008 229
32 3300046675 Ga0495657_0148936 Ga0495657_0148936_416_1174 229
33 3300046809 Ga0495600_0293448 Ga0495600_0293448_103_858 229
34 3300047322 Ga0495680_0104522 Ga0495680_0104522_938_1696 229
35 3300006038 Ga0075365_10076278 Ga0075365_100762783 230
36 3300006048 Ga0075363_100260464 Ga0075363_1002604642 230
37 3300013104 Ga0157370_10124760 Ga0157370_101247603 230
38 3300050492 nmdc:mga0yw44_61496_c1 nmdc:mga0yw44_61496_c1_987_1709 230
39 3300031838 Ga0307518_10104329 Ga0307518_101043291 231
40 iso_pu_bacteria 2684623035 2686537410 231
41 iso_pu_bacteria 2687453737 2689955808 231
42 iso_pu_bacteria 8002784119 8002791106 231
43 3300031730 Ga0307516_10000937 Ga0307516_100009373 232
44 3300045836 Ga0466958_0431686 Ga0466958_0431686_12_716 232
45 3300050495 nmdc:mga04h51_61386_c1 nmdc:mga04h51_61386_c1_35_841 232
46 iso_pu_bacteria 2547132424 2548696586 233
47 iso_pu_bacteria 2671180195 2671836569 233
48 iso_pu_bacteria 2684623035 2686539594 233
49 iso_pu_bacteria 2773857922 2774854725 233
50 iso_pu_bacteria 2895880812 2895881608 233
51 iso_pu_bacteria 2919713450 2919713521 233
52 iso_pu_bacteria 8002784119 8002787727 233
53 iso_pu_bacteria 8002784119 8002789483 233
54 3300005842 Ga0068858_100001695 Ga0068858_10000169517 234
55 3300009101 Ga0105247_10001423 Ga0105247_100014232 234
56 3300014968 Ga0157379_10001026 Ga0157379_1000102617 234
57 3300025900 Ga0207710_10000545 Ga0207710_100005453 234
58 3300026035 Ga0207703_10001291 Ga0207703_100012914 234
59 3300039062 Ga0400483_143208 Ga0400483_143208_3098_3865 234
60 3300039062 Ga0400483_216221 Ga0400483_216221_1204_1971 234
61 3300048907 Ga0496104_0046712 Ga0496104_0046712_2492_3265 234
62 3300048922 Ga0496119_0014048 Ga0496119_0014048_4306_5079 234
63 3300048924 Ga0496121_0022884 Ga0496121_0022884_4051_4824 234
64 3300005347 Ga0070668_100004329 Ga0070668_1000043299 235
65 3300005435 Ga0070714_100755668 Ga0070714_1007556681 235
66 3300005617 Ga0068859_100005689 Ga0068859_1000056895 235
67 3300005617 Ga0068859_100074361 Ga0068859_1000743613 235
68 3300005842 Ga0068858_100070362 Ga0068858_1000703622 235
69 3300005843 Ga0068860_100000382 Ga0068860_1000003827 235
70 3300005844 Ga0068862_100000066 Ga0068862_100000066100 235
71 3300005844 Ga0068862_100004369 Ga0068862_1000043697 235
72 3300006931 Ga0097620_100005689 Ga0097620_1000056895 235
73 3300006931 Ga0097620_100074364 Ga0097620_1000743641 235
74 3300009177 Ga0105248_10007917 Ga0105248_100079178 235
75 3300009177 Ga0105248_10036696 Ga0105248_100366962 235
76 3300009553 Ga0105249_10002922 Ga0105249_1000292215 235
77 3300025900 Ga0207710_10000556 Ga0207710_1000055612 235
78 3300025900 Ga0207710_10000571 Ga0207710_1000057113 235
79 3300025929 Ga0207664_10660541 Ga0207664_106605412 235
80 3300025941 Ga0207711_10000365 Ga0207711_1000036546 235
81 3300025941 Ga0207711_10073208 Ga0207711_100732082 235
82 3300025961 Ga0207712_10009683 Ga0207712_100096834 235
83 3300025972 Ga0207668_10233724 Ga0207668_102337242 235
84 3300026035 Ga0207703_10000071 Ga0207703_1000007169 235
85 3300028380 Ga0268265_10000062 Ga0268265_1000006297 235
86 3300028380 Ga0268265_10012049 Ga0268265_100120495 235
87 3300028381 Ga0268264_10000008 Ga0268264_10000008265 235
88 3300048907 Ga0496104_0495807 Ga0496104_0495807_74_796 235
89 3300048908 Ga0496105_0159436 Ga0496105_0159436_301_1023 235
90 3300048909 Ga0496106_0107153 Ga0496106_0107153_169_891 235
91 3300048919 Ga0496116_0000479 Ga0496116_0000479_36537_37256 235
92 3300048920 Ga0496117_0017041 Ga0496117_0017041_22_741 235
93 3300048922 Ga0496119_0002316 Ga0496119_0002316_19202_19924 235
94 3300048922 Ga0496119_0014935 Ga0496119_0014935_746_1465 235
95 3300048923 Ga0496120_0000394 Ga0496120_0000394_7335_8057 235
96 3300048924 Ga0496121_0032902 Ga0496121_0032902_636_1358 235
97 iso_pu_bacteria 2773857922 2774854766 235
98 3300031251 Ga0265327_10000252 Ga0265327_1000025275 236
99 3300046558 Ga0495633_0030855 Ga0495633_0030855_60_773 236
100 3300049574 Ga0501038_0222909 Ga0501038_0222909_494_1216 236
101 iso_pu_bacteria 2508501039 2508673112 236
102 3300049581 Ga0501047_0058462 Ga0501047_0058462_2934_3659 237
103 3300039062 Ga0400483_028153 Ga0400483_028153_14167_14955 238
104 3300049570 Ga0501033_0005558 Ga0501033_0005558_8086_8856 238
105 3300049571 Ga0501034_0001731 Ga0501034_0001731_8346_9149 238
106 3300049585 Ga0501069_0026732 Ga0501069_0026732_766_1536 238
107 3300049823 Ga0501044_0004139 Ga0501044_0004139_3214_3984 238
108 iso_pu_bacteria 2842888712 2842890794 238
109 3300049576 Ga0501040_0151364 Ga0501040_0151364_64_816 239
110 3300049578 Ga0501042_0206027 Ga0501042_0206027_23_775 239
111 3300049586 Ga0501070_0061119 Ga0501070_0061119_246_1010 239
112 3300049741 Ga0501079_0200800 Ga0501079_0200800_312_1064 239
113 3300060353 Ga0501082_0164849 Ga0501082_0164849_917_1669 239
114 iso_pu_bacteria 2895880812 2895883380 239
115 iso_pu_bacteria 2895880812 2895884723 239
116 3300021384 Ga0213876_10000185 Ga0213876_1000018565 240
117 3300039437 Ga0436365_0321092 Ga0436365_0321092_114_845 240
118 3300039437 Ga0436365_0820464 Ga0436365_0820464_2309_3040 240
119 3300049584 Ga0501068_0017368 Ga0501068_0017368_1462_2217 240
120 3300049742 Ga0501080_0231726 Ga0501080_0231726_448_1203 240
121 3300037853 Ga0436364_0986343 Ga0436364_0986343_335_1072 241
122 3300049571 Ga0501034_0043911 Ga0501034_0043911_939_1733 241
123 3300053108 Ga0500562_006063 Ga0500562_006063_702_1442 241
124 iso_pu_bacteria 2510065045 2510246990 241
125 iso_pu_bacteria 2515154122 2515681239 241
126 iso_pu_bacteria 2718217991 2719637988 241
127 iso_pu_bacteria 2902682994 2902686315 241
128 iso_pu_bacteria 8055266321 8055273041 241
129 3300006048 Ga0075363_100133940 Ga0075363_1001339402 242
130 3300046455 Ga0495603_0071559 Ga0495603_0071559_1105_1842 242
131 3300046530 Ga0495654_0212077 Ga0495654_0212077_55_792 242
132 3300046557 Ga0495622_0033325 Ga0495622_0033325_408_1145 242
133 3300046694 Ga0495649_0022543 Ga0495649_0022543_1737_2474 242
134 3300053133 Ga0500655_013205 Ga0500655_013205_610_1347 242
135 3300053178 Ga0500637_0018830 Ga0500637_0018830_208_945 242
136 3300013105 Ga0157369_10007697 Ga0157369_1000769711 243
137 3300046660 Ga0495625_0004331 Ga0495625_0004331_10005_10766 243
138 3300005335 Ga0070666_10021923 Ga0070666_100219231 244
139 3300005338 Ga0068868_100006720 Ga0068868_1000067202 244
140 3300005355 Ga0070671_100049705 Ga0070671_1000497053 244
141 3300005364 Ga0070673_100106196 Ga0070673_1001061962 244
142 3300005367 Ga0070667_100014320 Ga0070667_1000143205 244
143 3300005548 Ga0070665_100005712 Ga0070665_1000057129 244
144 3300005617 Ga0068859_100030090 Ga0068859_1000300902 244
145 3300005618 Ga0068864_100019578 Ga0068864_1000195784 244
146 3300005841 Ga0068863_100156701 Ga0068863_1001567012 244
147 3300006048 Ga0075363_100001213 Ga0075363_1000012133 244
148 3300006237 Ga0097621_100004696 Ga0097621_1000046966 244
149 3300006881 Ga0068865_100578382 Ga0068865_1005783821 244
150 3300006931 Ga0097620_100030090 Ga0097620_1000300904 244
151 3300009101 Ga0105247_10056328 Ga0105247_100563283 244
152 3300009177 Ga0105248_10005754 Ga0105248_1000575416 244
153 3300013296 Ga0157374_10019901 Ga0157374_100199012 244
154 3300013297 Ga0157378_10017452 Ga0157378_100174522 244
155 3300013306 Ga0163162_10113949 Ga0163162_101139492 244
156 3300014325 Ga0163163_10002708 Ga0163163_100027088 244
157 3300014968 Ga0157379_10003362 Ga0157379_100033625 244
158 3300014969 Ga0157376_10011857 Ga0157376_100118572 244
159 3300025903 Ga0207680_10018201 Ga0207680_100182013 244
160 3300025941 Ga0207711_10005445 Ga0207711_100054458 244
161 3300025960 Ga0207651_10221305 Ga0207651_102213052 244
162 3300026023 Ga0207677_10364934 Ga0207677_103649342 244
163 3300026035 Ga0207703_10018192 Ga0207703_100181926 244
164 3300026089 Ga0207648_10271496 Ga0207648_102714962 244
165 3300026095 Ga0207676_10009299 Ga0207676_100092996 244
166 3300028381 Ga0268264_10130834 Ga0268264_101308342 244
167 3300044656 Ga0466969_0042021 Ga0466969_0042021_986_1750 244
168 3300044684 Ga0466966_0052761 Ga0466966_0052761_658_1422 244
169 3300044693 Ga0466961_0093497 Ga0466961_0093497_1072_1836 244
170 3300044765 Ga0466970_0011935 Ga0466970_0011935_3180_3944 244
171 3300044842 Ga0466957_0021721 Ga0466957_0021721_2274_3038 244
172 3300046519 Ga0495632_0011496 Ga0495632_0011496_3739_4488 244
173 3300046558 Ga0495633_0002978 Ga0495633_0002978_10500_11249 244
174 3300048904 Ga0496101_0565090 Ga0496101_0565090_72_806 244
175 3300048905 Ga0496102_0400401 Ga0496102_0400401_462_1196 244
176 3300048907 Ga0496104_0005276 Ga0496104_0005276_6274_7008 244
177 3300048908 Ga0496105_0002923 Ga0496105_0002923_393_1127 244
178 3300048909 Ga0496106_0331500 Ga0496106_0331500_140_874 244
179 3300048911 Ga0496108_0018112 Ga0496108_0018112_4638_5372 244
180 3300048912 Ga0496109_0004753 Ga0496109_0004753_6472_7206 244
181 3300048913 Ga0496110_0016664 Ga0496110_0016664_1597_2331 244
182 3300048914 Ga0496111_0012894 Ga0496111_0012894_4115_4849 244
183 3300048917 Ga0496114_0169717 Ga0496114_0169717_359_1093 244
184 3300049571 Ga0501034_0007907 Ga0501034_0007907_2404_3204 244
185 3300053088 Ga0500644_0002517 Ga0500644_0002517_824_1573 244
186 3300053140 Ga0500573_0105511 Ga0500573_0105511_499_1233 244
187 3300005335 Ga0070666_10153314 Ga0070666_101533142 245
188 3300005353 Ga0070669_100642457 Ga0070669_1006424571 245
189 3300005364 Ga0070673_100309863 Ga0070673_1003098632 245
190 3300005367 Ga0070667_100005747 Ga0070667_10000574711 245
191 3300005617 Ga0068859_100001743 Ga0068859_10000174317 245
192 3300005843 Ga0068860_100008642 Ga0068860_1000086425 245
193 3300005844 Ga0068862_100006074 Ga0068862_1000060747 245
194 3300006058 Ga0075432_10035632 Ga0075432_100356322 245
195 3300006353 Ga0075370_10013826 Ga0075370_100138263 245
196 3300006931 Ga0097620_100001743 Ga0097620_10000174317 245
197 3300025903 Ga0207680_10046508 Ga0207680_100465082 245
198 3300025931 Ga0207644_10498565 Ga0207644_104985652 245
199 3300025960 Ga0207651_10378675 Ga0207651_103786752 245
200 3300025972 Ga0207668_10354087 Ga0207668_103540872 245
201 3300025986 Ga0207658_10041528 Ga0207658_100415282 245
202 3300026088 Ga0207641_10466285 Ga0207641_104662851 245
203 3300026095 Ga0207676_10260956 Ga0207676_102609561 245
204 3300026118 Ga0207675_100010006 Ga0207675_1000100067 245
205 3300028380 Ga0268265_10006091 Ga0268265_100060917 245
206 3300028381 Ga0268264_10013433 Ga0268264_100134332 245
207 3300031728 Ga0316578_10260916 Ga0316578_102609161 245
208 3300032133 Ga0316583_10004355 Ga0316583_100043555 245
209 3300036647 Ga0316582_0037897 Ga0316582_0037897_781_1518 245
210 3300036712 Ga0316584_0126565 Ga0316584_0126565_566_1315 245
211 3300042115 Ga0450911_006907 Ga0450911_006907_528_1301 245
212 3300046499 Ga0495594_0050431 Ga0495594_0050431_1346_2092 245
213 3300046794 Ga0495589_0025614 Ga0495589_0025614_1721_2467 245
214 3300050496 nmdc:mga07m45_38278_c1 nmdc:mga07m45_38278_c1_1281_2018 245
215 3300053153 Ga0500616_0080025 Ga0500616_0080025_435_1196 245
216 iso_pu_bacteria 3000865235 3000867684 245
217 3300025924 Ga0207694_10202123 Ga0207694_102021232 246
218 3300031731 Ga0307405_10240027 Ga0307405_102400272 246
219 3300031824 Ga0307413_10203557 Ga0307413_102035572 246
220 3300032004 Ga0307414_10064299 Ga0307414_100642994 246
221 3300039062 Ga0400483_086606 Ga0400483_086606_924_1694 246
222 3300039062 Ga0400483_205722 Ga0400483_205722_7160_7957 246
223 3300041407 Ga0439447_000181 Ga0439447_000181_19228_20004 246
224 3300041407 Ga0439447_003501 Ga0439447_003501_4133_4909 246
225 3300041411 Ga0439466_0001981 Ga0439466_0001981_882_1658 246
226 3300041411 Ga0439466_0032802 Ga0439466_0032802_91_867 246
227 3300042137 Ga0450902_000305 Ga0450902_000305_3896_4672 246
228 3300042876 Ga0451577_0794438 Ga0451577_0794438_16_762 246
229 3300046660 Ga0495625_0124248 Ga0495625_0124248_856_1611 246
230 3300046684 Ga0495669_0000002 Ga0495669_0000002_72249_73016 246
231 3300046684 Ga0495669_0000115 Ga0495669_0000115_48195_48950 246
232 3300047445 Ga0495677_0015137 Ga0495677_0015137_503_1258 246
233 3300048922 Ga0496119_0004244 Ga0496119_0004244_4458_5279 246
234 3300048923 Ga0496120_0000197 Ga0496120_0000197_66789_67610 246
235 3300005327 Ga0070658_10032432 Ga0070658_100324323 248
236 3300005329 Ga0070683_100168318 Ga0070683_1001683182 248
237 3300005329 Ga0070683_100360062 Ga0070683_1003600622 248
238 3300005336 Ga0070680_100011864 Ga0070680_1000118642 248
239 3300005344 Ga0070661_100002127 Ga0070661_10000212712 248
240 3300005344 Ga0070661_100090059 Ga0070661_1000900592 248
241 3300005457 Ga0070662_100002184 Ga0070662_1000021843 248
242 3300005457 Ga0070662_100012726 Ga0070662_1000127265 248
243 3300005457 Ga0070662_100313357 Ga0070662_1003133571 248
244 3300005458 Ga0070681_10009625 Ga0070681_100096253 248
245 3300005530 Ga0070679_100040899 Ga0070679_1000408992 248
246 3300005535 Ga0070684_100049219 Ga0070684_1000492192 248
247 3300005563 Ga0068855_100012222 Ga0068855_10001222212 248
248 3300005563 Ga0068855_100014908 Ga0068855_1000149083 248
249 3300005564 Ga0070664_100020279 Ga0070664_1000202796 248
250 3300005578 Ga0068854_100023131 Ga0068854_1000231312 248
251 3300005578 Ga0068854_100705737 Ga0068854_1007057371 248
252 3300006186 Ga0075369_10108368 Ga0075369_101083683 248
253 3300009174 Ga0105241_10059466 Ga0105241_100594662 248
254 3300010375 Ga0105239_10174195 Ga0105239_101741953 248
255 3300011119 Ga0105246_10000032 Ga0105246_1000003215 248
256 3300013100 Ga0157373_10027995 Ga0157373_100279954 248
257 3300013100 Ga0157373_10029602 Ga0157373_100296024 248
258 3300013102 Ga0157371_10012870 Ga0157371_100128703 248
259 3300013104 Ga0157370_10061912 Ga0157370_100619123 248
260 3300013105 Ga0157369_10024942 Ga0157369_100249424 248
261 3300013307 Ga0157372_10606633 Ga0157372_106066331 248
262 3300014745 Ga0157377_10095201 Ga0157377_100952011 248
263 3300025909 Ga0207705_10487041 Ga0207705_104870412 248
264 3300025912 Ga0207707_10072127 Ga0207707_100721273 248
265 3300025917 Ga0207660_10065967 Ga0207660_100659673 248
266 3300025919 Ga0207657_10005883 Ga0207657_1000588310 248
267 3300025920 Ga0207649_10073166 Ga0207649_100731662 248
268 3300025921 Ga0207652_10032334 Ga0207652_100323343 248
269 3300025926 Ga0207659_10421168 Ga0207659_104211682 248
270 3300025932 Ga0207690_10002354 Ga0207690_100023543 248
271 3300025933 Ga0207706_10002856 Ga0207706_100028569 248
272 3300025933 Ga0207706_10005439 Ga0207706_100054396 248
273 3300025933 Ga0207706_10063198 Ga0207706_100631984 248
274 3300025944 Ga0207661_10174278 Ga0207661_101742782 248
275 3300025945 Ga0207679_10239209 Ga0207679_102392092 248
276 3300025949 Ga0207667_10106717 Ga0207667_101067172 248
277 3300026041 Ga0207639_10008247 Ga0207639_100082476 248
278 3300026067 Ga0207678_10094616 Ga0207678_100946162 248
279 3300026116 Ga0207674_10169937 Ga0207674_101699372 248
280 3300046452 Ga0495617_004369 Ga0495617_004369_703_1467 248
281 3300046460 Ga0495638_0000277 Ga0495638_0000277_66245_67009 248
282 3300046460 Ga0495638_0032629 Ga0495638_0032629_1181_1942 248
283 3300046524 Ga0495648_0000199 Ga0495648_0000199_66245_67009 248
284 3300049822 Ga0501035_0195447 Ga0501035_0195447_633_1394 248
285 3300049823 Ga0501044_0295628 Ga0501044_0295628_116_877 248
286 3300050489 nmdc:mga03683_41159_c1 nmdc:mga03683_41159_c1_615_1367 248
287 3300050516 nmdc:mga0sz30_45552_c1 nmdc:mga0sz30_45552_c1_388_1140 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

9

261

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5djk-assembly1.cif.gz_A structure of m. tuberculosis cysq, a pap phosphatase with po4 and 2ca bound 0.944 1 243
5djg-assembly1.cif.gz_A structure of m. tuberculosis cysq, a pap phosphatase with pap, mg, and li bound 0.9425 1 243
5dji-assembly1.cif.gz_A structure of m. tuberculosis cysq, a pap phosphatase with amp, po4, and 2mg bound 0.9417 1 243
5djh-assembly1.cif.gz_A structure of m. tuberculosis cysq, a pap phosphatase with amp, po4, and 3mg bound 0.9349 1 243
5djf-assembly1.cif.gz_A structure of m. tuberculosis cysq, a pap phosphatase - ligand-free structure 0.9349 1 243
ID Description Score Start End Superfamily
af_P9WKJ1_154_255_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9398 133 232 3.40.190.80
af_P9WKJ1_12_146_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9346 1 124 3.30.540.10
2q74C01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9142 4 114 3.30.540.10
af_P9WKJ1_154_255_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9136 133 232 3.40.190.80
5zhhC01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9074 4 122 3.30.540.10
ID Description Score Start End GO Terms
AF-A0A2D4XZT0-F1-model_v4 deleted 1.005 1 97
AF-A0A1Q3MEU1-F1-model_v4 deleted 0.9922 3 243
AF-A0A2Z6ALE3-F1-model_v4 3'(2'), 5'-bisphosphate nucleotidase 0.9901 1 247 GO:0000103
GO:0008441
GO:0046872
GO:0050427
AF-A0A165PIH6-F1-model_v4 deleted 0.9894 1 243
AF-A0A1M3P914-F1-model_v4 3'(2'),5'-bisphosphate nucleotidase CysQ 0.9891 1 245 GO:0000103
GO:0008441
GO:0046872
GO:0050427

Feature Viewer

pLDDT pTM Quality
95.49 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map