F388208

General Info

Members Datasets Scaffolds Average Seq Length
287 159 574 228

Family's Representative Sequence

Representative Sequence 3300047321|Ga0495676_0250733|Ga0495676_0250733_234_989
Length 251
Sequence LGIGWLNPSINYQITRLLNNQMLTAVLLSGGLDSAVLAAEEAASGEVQPIYVSAGLAWEAAEREIVSSFLARAPLNGRVRPLVSLSVDMRDVYAAKHWAVEGRPPGYHTPDEEVYLPGRNVILLAKAAVYCAAAKIDRLVIGTLAHNPFPDATPEFRAAMARALTLGLDRPLQIEAPYADTEKADVIRRGAALGVPFELTLSCMNPPESAVSSLQSALHCGECSKCRERHDAFVEAAIVDPTTYASTTNLR

Samples

Sample ID Description Type Environment
1 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
102 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
109 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
156 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
157 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
158 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.44
Rhizosphere 97.56
Stem 0
Stem Tuber 0
Unclassified 19.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495676_0250733 3300047321 Unclassified 1208
2 MRS1b_contig_7004058 2162886011 Bacteria 949
3 Ga0065712_10086649 3300005290 Unclassified 2623
4 Ga0065715_10160510 3300005293 Bacteria 1634
5 Ga0065707_10139415 3300005295 Bacteria 1793
6 Ga0065707_10197313 3300005295 Bacteria 1329
7 Ga0070683_100085660 3300005329 Bacteria 2954
8 Ga0070690_100156310 3300005330 Unclassified 1559
9 Ga0070670_100033570 3300005331 Bacteria 4419
10 Ga0070670_100191562 3300005331 Unclassified 1776
11 Ga0068869_100051445 3300005334 Bacteria 2989
12 Ga0068868_100090526 3300005338 Bacteria 2464
13 Ga0068868_100152623 3300005338 Bacteria 1903
14 Ga0070689_100224672 3300005340 Bacteria 1541
15 Ga0070668_100999237 3300005347 Unclassified 752
16 Ga0070674_100166274 3300005356 Unclassified 1678
17 Ga0070688_100607795 3300005365 Unclassified 838
18 Ga0070709_10072698 3300005434 Bacteria 2224
19 Ga0070709_10258912 3300005434 Bacteria 1256
20 Ga0070714_100021632 3300005435 Bacteria 5263
21 Ga0070713_100124770 3300005436 Bacteria 2263
22 Ga0070705_100225191 3300005440 Bacteria 1301
23 Ga0070705_100350636 3300005440 Bacteria 1076
24 Ga0070694_100466988 3300005444 Unclassified 999
25 Ga0070708_100383465 3300005445 Bacteria 1325
26 Ga0070708_100713443 3300005445 Bacteria 944
27 Ga0070678_100109357 3300005456 Unclassified 2159
28 Ga0070707_100092032 3300005468 Bacteria 2936
29 Ga0070698_100418039 3300005471 Bacteria 1275
30 Ga0070684_100258474 3300005535 Bacteria 1593
31 Ga0070697_100098169 3300005536 Bacteria 2431
32 Ga0070697_100509048 3300005536 Bacteria 1053
33 Ga0068853_100981504 3300005539 Bacteria 813
34 Ga0070672_100054363 3300005543 Bacteria 3134
35 Ga0070672_100063089 3300005543 Bacteria 2926
36 Ga0070665_100004603 3300005548 Bacteria 14428
37 Ga0070665_100062807 3300005548 Bacteria 3723
38 Ga0070664_100071520 3300005564 Bacteria 2972
39 Ga0068856_100029560 3300005614 Bacteria 5353
40 Ga0068859_100077242 3300005617 Bacteria 3371
41 Ga0068859_100262774 3300005617 Unclassified 1817
42 Ga0068859_100353283 3300005617 Bacteria 1565
43 Ga0068859_100390254 3300005617 Bacteria 1488
44 Ga0068864_100068467 3300005618 Unclassified 3084
45 Ga0068866_10284540 3300005718 Bacteria 1026
46 Ga0068861_100141211 3300005719 Bacteria 1966
47 Ga0068858_100009891 3300005842 Bacteria 9061
48 Ga0068858_100098336 3300005842 Bacteria 2728
49 Ga0068858_100146454 3300005842 Bacteria 2218
50 Ga0068858_100171988 3300005842 Bacteria 2043
51 Ga0068858_100377183 3300005842 Bacteria 1361
52 Ga0068860_100121914 3300005843 Unclassified 2497
53 Ga0081455_10025640 3300005937 Bacteria 5437
54 Ga0081538_10003729 3300005981 Bacteria 14270
55 Ga0081538_10020825 3300005981 Bacteria 4814
56 Ga0081538_10046736 3300005981 Unclassified 2665
57 Ga0070712_100468816 3300006175 Bacteria 1051
58 Ga0097621_100000311 3300006237 Bacteria 32935
59 Ga0097621_100005974 3300006237 Bacteria 8607
60 Ga0097621_100009536 3300006237 Bacteria 7051
61 Ga0097621_100187665 3300006237 Unclassified 1789
62 Ga0068871_100001093 3300006358 Bacteria 18209
63 Ga0068871_100144209 3300006358 Bacteria 2026
64 Ga0075428_100567134 3300006844 Unclassified 1213
65 Ga0075428_100850358 3300006844 Bacteria 969
66 Ga0075430_100267264 3300006846 Bacteria 1416
67 Ga0075433_10117481 3300006852 Bacteria 2360
68 Ga0075434_100000100 3300006871 Bacteria 48123
69 Ga0075434_100000213 3300006871 Bacteria 39624
70 Ga0075429_100404073 3300006880 Unclassified 1196
71 Ga0068865_100020075 3300006881 Bacteria 4332
72 Ga0068865_100025793 3300006881 Bacteria 3870
73 Ga0068865_100135105 3300006881 Bacteria 1852
74 Ga0068865_100173035 3300006881 Bacteria 1657
75 Ga0068865_100384483 3300006881 Bacteria 1145
76 Ga0075436_100019171 3300006914 Bacteria 4686
77 Ga0097620_100077238 3300006931 Bacteria 3371
78 Ga0097620_100262766 3300006931 Unclassified 1817
79 Ga0097620_100353271 3300006931 Bacteria 1565
80 Ga0097620_100390257 3300006931 Bacteria 1488
81 Ga0075435_100000331 3300007076 Bacteria 29105
82 Ga0075435_100030565 3300007076 Bacteria 4237
83 Ga0075435_100152019 3300007076 Bacteria 1947
84 Ga0075435_100175382 3300007076 Bacteria 1810
85 Ga0105240_10011023 3300009093 Bacteria 12644
86 Ga0105240_10017877 3300009093 Bacteria 9540
87 Ga0111539_10005676 3300009094 Bacteria 16147
88 Ga0111539_10018920 3300009094 Bacteria 8517
89 Ga0111539_10430455 3300009094 Bacteria 1536
90 Ga0111539_10557745 3300009094 Bacteria 1334
91 Ga0105245_10005304 3300009098 Bacteria 11325
92 Ga0105245_10058040 3300009098 Bacteria 3483
93 Ga0105245_10166278 3300009098 Unclassified 2097
94 Ga0105245_10787896 3300009098 Unclassified 988
95 Ga0105247_10031087 3300009101 Bacteria 3239
96 Ga0105241_10787855 3300009174 Bacteria 875
97 Ga0105242_10001523 3300009176 Bacteria 18223
98 Ga0105242_10022088 3300009176 Bacteria 5000
99 Ga0105242_10023151 3300009176 Bacteria 4896
100 Ga0105242_10064515 3300009176 Bacteria 3019
101 Ga0105242_10108388 3300009176 Unclassified 2364
102 Ga0105242_10648541 3300009176 Bacteria 1026
103 Ga0105248_10001706 3300009177 Bacteria 24451
104 Ga0105248_10085272 3300009177 Bacteria 3554
105 Ga0105248_10138045 3300009177 Bacteria 2750
106 Ga0105248_10213514 3300009177 Unclassified 2174
107 Ga0105248_10260245 3300009177 Unclassified 1953
108 Ga0105248_10300953 3300009177 Bacteria 1806
109 Ga0105248_10539731 3300009177 Bacteria 1315
110 Ga0105249_11432981 3300009553 Bacteria 763
111 Ga0157370_10344763 3300013104 Unclassified 1373
112 Ga0157369_10109184 3300013105 Bacteria 2942
113 Ga0157374_10079163 3300013296 Bacteria 3114
114 Ga0163162_10058381 3300013306 Bacteria 3887
115 Ga0157372_10406575 3300013307 Bacteria 1586
116 Ga0157375_10334766 3300013308 Bacteria 1679
117 Ga0157375_10377586 3300013308 Unclassified 1584
118 Ga0163163_10000240 3300014325 Bacteria 55940
119 Ga0163163_10013535 3300014325 Bacteria 7476
120 Ga0163163_10253132 3300014325 Unclassified 1812
121 Ga0157380_11446627 3300014326 Bacteria 739
122 Ga0157379_10085207 3300014968 Unclassified 2832
123 Ga0157379_10286561 3300014968 Bacteria 1499
124 Ga0157376_10035193 3300014969 Bacteria 4050
125 Ga0207710_10016690 3300025900 Bacteria 3108
126 Ga0207680_10045337 3300025903 Bacteria 2592
127 Ga0207699_10363366 3300025906 Unclassified 1024
128 Ga0207684_10617627 3300025910 Bacteria 925
129 Ga0207654_10557584 3300025911 Bacteria 814
130 Ga0207695_10212590 3300025913 Bacteria 1844
131 Ga0207695_10266631 3300025913 Bacteria 1609
132 Ga0207650_10184993 3300025925 Unclassified 1662
133 Ga0207687_10054170 3300025927 Bacteria 2805
134 Ga0207687_10126884 3300025927 Bacteria 1917
135 Ga0207687_10150475 3300025927 Unclassified 1775
136 Ga0207687_10392867 3300025927 Unclassified 1139
137 Ga0207686_10003296 3300025934 Bacteria 8681
138 Ga0207686_10019310 3300025934 Bacteria 3874
139 Ga0207686_10042895 3300025934 Unclassified 2769
140 Ga0207704_10069337 3300025938 Unclassified 2227
141 Ga0207704_10076933 3300025938 Bacteria 2140
142 Ga0207704_10218098 3300025938 Bacteria 1409
143 Ga0207711_10038345 3300025941 Bacteria 4074
144 Ga0207711_10051398 3300025941 Bacteria 3529
145 Ga0207711_10177252 3300025941 Unclassified 1937
146 Ga0207711_10207667 3300025941 Bacteria 1789
147 Ga0207711_10211484 3300025941 Bacteria 1771
148 Ga0207711_10380891 3300025941 Bacteria 1309
149 Ga0207711_10433144 3300025941 Archaea 1224
150 Ga0207711_10441335 3300025941 Bacteria 1211
151 Ga0207689_10053525 3300025942 Bacteria 3325
152 Ga0207689_10270586 3300025942 Bacteria 1407
153 Ga0207689_10623623 3300025942 Bacteria 908
154 Ga0207679_10042386 3300025945 Bacteria 3271
155 Ga0207651_10364706 3300025960 Bacteria 1220
156 Ga0207668_10258915 3300025972 Bacteria 1417
157 Ga0207677_10010724 3300026023 Bacteria 5194
158 Ga0207703_10029210 3300026035 Bacteria 4349
159 Ga0207703_10070888 3300026035 Unclassified 2877
160 Ga0207703_10326279 3300026035 Bacteria 1407
161 Ga0207703_10381064 3300026035 Archaea 1304
162 Ga0207703_10646267 3300026035 Unclassified 1003
163 Ga0207639_10803757 3300026041 Bacteria 876
164 Ga0207702_10122709 3300026078 Bacteria 2327
165 Ga0207641_10481353 3300026088 Bacteria 1203
166 Ga0207648_10421249 3300026089 Bacteria 1212
167 Ga0207676_10057968 3300026095 Unclassified 3052
168 Ga0207675_100013772 3300026118 Archaea 7544
169 Ga0207683_10138012 3300026121 Bacteria 2195
170 Ga0207683_10649498 3300026121 Bacteria 977
171 Ga0207428_10019539 3300027907 Bacteria 5773
172 Ga0268266_10004395 3300028379 Bacteria 13511
173 Ga0268264_10161077 3300028381 Bacteria 2021
174 Ga0268264_10189657 3300028381 Bacteria 1873
175 Ga0268264_10376371 3300028381 Bacteria 1359
176 Ga0307410_10904494 3300031852 Bacteria 756
177 Ga0307416_100135920 3300032002 Bacteria 2224
178 Ga0307415_100258760 3300032126 Unclassified 1419
179 Ga0373935_0819085 3300035692 Unclassified 688
180 Ga0373937_0705426 3300036401 Unclassified 956
181 Ga0373937_0707987 3300036401 Unclassified 954
182 Ga0439433_0027969 3300041999 Unclassified 1281
183 Ga0439460_0064009 3300042461 Unclassified 1128
184 Ga0451576_0085032 3300045051 Unclassified 3290
185 Ga0495592_0148475 3300046454 Bacteria 1623
186 Ga0495580_0034457 3300046472 Unclassified 3646
187 Ga0495582_0065731 3300046473 Unclassified 2004
188 Ga0495628_0406206 3300046516 Bacteria 994
189 Ga0495635_0138673 3300046663 Bacteria 1657
190 Ga0495659_0064044 3300046664 Bacteria 1364
191 Ga0496104_0024954 3300048907 Bacteria 5507
192 Ga0496108_0061576 3300048911 Bacteria 3158
193 Ga0496109_0171044 3300048912 Unclassified 2038
194 Ga0496112_0027342 3300048915 Bacteria 5499
195 Ga0496112_0383813 3300048915 Bacteria 1346
196 Ga0496113_0008765 3300048916 Bacteria 6606
197 Ga0496114_0024328 3300048917 Bacteria 4943
198 Ga0501031_0037352 3300049568 Bacteria 3169
199 Ga0501031_0104574 3300049568 Unclassified 1848
200 Ga0501032_0015305 3300049569 Bacteria 5415
201 Ga0501033_0014914 3300049570 Bacteria 5899
202 Ga0501033_0019113 3300049570 Bacteria 5181
203 Ga0501033_0028188 3300049570 Bacteria 4221
204 Ga0501034_0074412 3300049571 Bacteria 3404
205 Ga0501036_0020812 3300049572 Bacteria 5509
206 Ga0501036_0046192 3300049572 Bacteria 3687
207 Ga0501037_0007463 3300049573 Bacteria 8000
208 Ga0501037_0008213 3300049573 Bacteria 7652
209 Ga0501037_0585460 3300049573 Unclassified 750
210 Ga0501038_0004706 3300049574 Bacteria 12692
211 Ga0501038_0011613 3300049574 Bacteria 8034
212 Ga0501038_0013478 3300049574 Bacteria 7452
213 Ga0501039_0017979 3300049575 Bacteria 5422
214 Ga0501039_0071598 3300049575 Bacteria 2694
215 Ga0501039_0635153 3300049575 Unclassified 836
216 Ga0501040_0110432 3300049576 Bacteria 1923
217 Ga0501042_0203617 3300049578 Archaea 1427
218 Ga0501042_0275560 3300049578 Bacteria 1215
219 Ga0501043_0005920 3300049579 Bacteria 9832
220 Ga0501043_0042091 3300049579 Bacteria 3588
221 Ga0501043_0231039 3300049579 Bacteria 1428
222 Ga0501046_0044784 3300049580 Bacteria 3518
223 Ga0501046_0175807 3300049580 Bacteria 1604
224 Ga0501047_0026363 3300049581 Bacteria 5592
225 Ga0501048_0005878 3300049582 Bacteria 9338
226 Ga0501048_0009540 3300049582 Bacteria 7285
227 Ga0501048_0019807 3300049582 Bacteria 4933
228 Ga0501067_0000913 3300049583 Bacteria 15884
229 Ga0501067_0008912 3300049583 Bacteria 5559
230 Ga0501067_0016664 3300049583 Bacteria 4061
231 Ga0501068_0009006 3300049584 Bacteria 5569
232 Ga0501068_0009599 3300049584 Bacteria 5418
233 Ga0501069_0002325 3300049585 Bacteria 9602
234 Ga0501069_0082774 3300049585 Bacteria 1809
235 Ga0501070_0007254 3300049586 Bacteria 9409
236 Ga0501070_0031584 3300049586 Bacteria 4436
237 Ga0501071_0004219 3300049587 Bacteria 9100
238 Ga0501071_0071678 3300049587 Bacteria 2526
239 Ga0501071_0490399 3300049587 Unclassified 942
240 Ga0501072_0026915 3300049588 Bacteria 4488
241 Ga0501072_0620122 3300049588 Bacteria 852
242 Ga0501073_0003470 3300049589 Bacteria 11833
243 Ga0501073_0004091 3300049589 Bacteria 10941
244 Ga0501073_0158453 3300049589 Bacteria 1568
245 Ga0501074_0006512 3300049590 Bacteria 8430
246 Ga0501074_0009982 3300049590 Bacteria 6894
247 Ga0501074_0185259 3300049590 Archaea 1484
248 Ga0501075_0707665 3300049591 Bacteria 767
249 Ga0501076_0037146 3300049592 Bacteria 3819
250 Ga0501076_0039844 3300049592 Bacteria 3690
251 Ga0501076_0050071 3300049592 Bacteria 3304
252 Ga0501076_0119054 3300049592 Bacteria 2138
253 Ga0501077_0109302 3300049593 Bacteria 1752
254 Ga0501079_0003117 3300049741 Bacteria 12147
255 Ga0501079_0035593 3300049741 Bacteria 3833
256 Ga0501079_0484061 3300049741 Unclassified 973
257 Ga0501080_0043473 3300049742 Bacteria 4183
258 Ga0501081_0319894 3300049743 Unclassified 1140
259 Ga0501083_0102832 3300049744 Bacteria 1883
260 Ga0501035_0008641 3300049822 Bacteria 9481
261 Ga0501035_0040104 3300049822 Bacteria 4233
262 Ga0501035_0467587 3300049822 Bacteria 1041
263 Ga0501044_0528547 3300049823 Archaea 1078
264 Ga0501045_0689814 3300049824 Unclassified 754
265 nmdc:mga0qj67_129890_c1 3300050509 Bacteria 2040
266 nmdc:mga08y16_2811_c1 3300050511 Bacteria 17870
267 nmdc:mga08y16_391269_c1 3300050511 Bacteria 1424
268 nmdc:mga0n895_111_c1 3300050512 Bacteria 48235
269 nmdc:mga0n895_84135_c1 3300050512 Bacteria 3174
270 nmdc:mga0rr50_187201_c1 3300050513 Bacteria 1695
271 nmdc:mga0rr50_57_c1 3300050513 Bacteria 67718
272 nmdc:mga0rr50_62160_c1 3300050513 Bacteria 2816
273 nmdc:mga08x19_13506_c1 3300050514 Bacteria 4939
274 nmdc:mga08x19_426_c1 3300050514 Bacteria 28960
275 nmdc:mga0a205_61919_c1 3300050515 Bacteria 2491
276 Ga0501084_0007864 3300054114 Bacteria 8777
277 Ga0501084_0253210 3300054114 Bacteria 1486
278 Ga0501084_0429935 3300054114 Bacteria 1116
279 Ga0501084_0666203 3300054114 Unclassified 878
280 Ga0590071_000323 3300059421 Bacteria 14020
281 Ga0590071_037920 3300059421 Bacteria 1157
282 Ga0590074_002896 3300059423 Bacteria 2827
283 Ga0590075_004204 3300059424 Bacteria 3408
284 Ga0590077_022478 3300059426 Bacteria 1346
285 Ga0501082_0002769 3300060353 Bacteria 15317
286 Ga0501082_0058612 3300060353 Bacteria 3318
287 Ga0501082_0952665 3300060353 Unclassified 751
288 Ga0495676_0250733
289 MRS1b_contig_7004058
290 Ga0065712_10086649
291 Ga0065715_10160510
292 Ga0065707_10139415
293 Ga0065707_10197313
294 Ga0070683_100085660
295 Ga0070690_100156310
296 Ga0070670_100033570
297 Ga0070670_100191562
298 Ga0068869_100051445
299 Ga0068868_100090526
300 Ga0068868_100152623
301 Ga0070689_100224672
302 Ga0070668_100999237
303 Ga0070674_100166274
304 Ga0070688_100607795
305 Ga0070709_10072698
306 Ga0070709_10258912
307 Ga0070714_100021632
308 Ga0070713_100124770
309 Ga0070705_100225191
310 Ga0070705_100350636
311 Ga0070694_100466988
312 Ga0070708_100383465
313 Ga0070708_100713443
314 Ga0070678_100109357
315 Ga0070707_100092032
316 Ga0070698_100418039
317 Ga0070684_100258474
318 Ga0070697_100098169
319 Ga0070697_100509048
320 Ga0068853_100981504
321 Ga0070672_100054363
322 Ga0070672_100063089
323 Ga0070665_100004603
324 Ga0070665_100062807
325 Ga0070664_100071520
326 Ga0068856_100029560
327 Ga0068859_100077242
328 Ga0068859_100262774
329 Ga0068859_100353283
330 Ga0068859_100390254
331 Ga0068864_100068467
332 Ga0068866_10284540
333 Ga0068861_100141211
334 Ga0068858_100009891
335 Ga0068858_100098336
336 Ga0068858_100146454
337 Ga0068858_100171988
338 Ga0068858_100377183
339 Ga0068860_100121914
340 Ga0081455_10025640
341 Ga0081538_10003729
342 Ga0081538_10020825
343 Ga0081538_10046736
344 Ga0070712_100468816
345 Ga0097621_100000311
346 Ga0097621_100005974
347 Ga0097621_100009536
348 Ga0097621_100187665
349 Ga0068871_100001093
350 Ga0068871_100144209
351 Ga0075428_100567134
352 Ga0075428_100850358
353 Ga0075430_100267264
354 Ga0075433_10117481
355 Ga0075434_100000100
356 Ga0075434_100000213
357 Ga0075429_100404073
358 Ga0068865_100020075
359 Ga0068865_100025793
360 Ga0068865_100135105
361 Ga0068865_100173035
362 Ga0068865_100384483
363 Ga0075436_100019171
364 Ga0097620_100077238
365 Ga0097620_100262766
366 Ga0097620_100353271
367 Ga0097620_100390257
368 Ga0075435_100000331
369 Ga0075435_100030565
370 Ga0075435_100152019
371 Ga0075435_100175382
372 Ga0105240_10011023
373 Ga0105240_10017877
374 Ga0111539_10005676
375 Ga0111539_10018920
376 Ga0111539_10430455
377 Ga0111539_10557745
378 Ga0105245_10005304
379 Ga0105245_10058040
380 Ga0105245_10166278
381 Ga0105245_10787896
382 Ga0105247_10031087
383 Ga0105241_10787855
384 Ga0105242_10001523
385 Ga0105242_10022088
386 Ga0105242_10023151
387 Ga0105242_10064515
388 Ga0105242_10108388
389 Ga0105242_10648541
390 Ga0105248_10001706
391 Ga0105248_10085272
392 Ga0105248_10138045
393 Ga0105248_10213514
394 Ga0105248_10260245
395 Ga0105248_10300953
396 Ga0105248_10539731
397 Ga0105249_11432981
398 Ga0157370_10344763
399 Ga0157369_10109184
400 Ga0157374_10079163
401 Ga0163162_10058381
402 Ga0157372_10406575
403 Ga0157375_10334766
404 Ga0157375_10377586
405 Ga0163163_10000240
406 Ga0163163_10013535
407 Ga0163163_10253132
408 Ga0157380_11446627
409 Ga0157379_10085207
410 Ga0157379_10286561
411 Ga0157376_10035193
412 Ga0207710_10016690
413 Ga0207680_10045337
414 Ga0207699_10363366
415 Ga0207684_10617627
416 Ga0207654_10557584
417 Ga0207695_10212590
418 Ga0207695_10266631
419 Ga0207650_10184993
420 Ga0207687_10054170
421 Ga0207687_10126884
422 Ga0207687_10150475
423 Ga0207687_10392867
424 Ga0207686_10003296
425 Ga0207686_10019310
426 Ga0207686_10042895
427 Ga0207704_10069337
428 Ga0207704_10076933
429 Ga0207704_10218098
430 Ga0207711_10038345
431 Ga0207711_10051398
432 Ga0207711_10177252
433 Ga0207711_10207667
434 Ga0207711_10211484
435 Ga0207711_10380891
436 Ga0207711_10433144
437 Ga0207711_10441335
438 Ga0207689_10053525
439 Ga0207689_10270586
440 Ga0207689_10623623
441 Ga0207679_10042386
442 Ga0207651_10364706
443 Ga0207668_10258915
444 Ga0207677_10010724
445 Ga0207703_10029210
446 Ga0207703_10070888
447 Ga0207703_10326279
448 Ga0207703_10381064
449 Ga0207703_10646267
450 Ga0207639_10803757
451 Ga0207702_10122709
452 Ga0207641_10481353
453 Ga0207648_10421249
454 Ga0207676_10057968
455 Ga0207675_100013772
456 Ga0207683_10138012
457 Ga0207683_10649498
458 Ga0207428_10019539
459 Ga0268266_10004395
460 Ga0268264_10161077
461 Ga0268264_10189657
462 Ga0268264_10376371
463 Ga0307410_10904494
464 Ga0307416_100135920
465 Ga0307415_100258760
466 Ga0373935_0819085
467 Ga0373937_0705426
468 Ga0373937_0707987
469 Ga0439433_0027969
470 Ga0439460_0064009
471 Ga0451576_0085032
472 Ga0495592_0148475
473 Ga0495580_0034457
474 Ga0495582_0065731
475 Ga0495628_0406206
476 Ga0495635_0138673
477 Ga0495659_0064044
478 Ga0496104_0024954
479 Ga0496108_0061576
480 Ga0496109_0171044
481 Ga0496112_0027342
482 Ga0496112_0383813
483 Ga0496113_0008765
484 Ga0496114_0024328
485 Ga0501031_0037352
486 Ga0501031_0104574
487 Ga0501032_0015305
488 Ga0501033_0014914
489 Ga0501033_0019113
490 Ga0501033_0028188
491 Ga0501034_0074412
492 Ga0501036_0020812
493 Ga0501036_0046192
494 Ga0501037_0007463
495 Ga0501037_0008213
496 Ga0501037_0585460
497 Ga0501038_0004706
498 Ga0501038_0011613
499 Ga0501038_0013478
500 Ga0501039_0017979
501 Ga0501039_0071598
502 Ga0501039_0635153
503 Ga0501040_0110432
504 Ga0501042_0203617
505 Ga0501042_0275560
506 Ga0501043_0005920
507 Ga0501043_0042091
508 Ga0501043_0231039
509 Ga0501046_0044784
510 Ga0501046_0175807
511 Ga0501047_0026363
512 Ga0501048_0005878
513 Ga0501048_0009540
514 Ga0501048_0019807
515 Ga0501067_0000913
516 Ga0501067_0008912
517 Ga0501067_0016664
518 Ga0501068_0009006
519 Ga0501068_0009599
520 Ga0501069_0002325
521 Ga0501069_0082774
522 Ga0501070_0007254
523 Ga0501070_0031584
524 Ga0501071_0004219
525 Ga0501071_0071678
526 Ga0501071_0490399
527 Ga0501072_0026915
528 Ga0501072_0620122
529 Ga0501073_0003470
530 Ga0501073_0004091
531 Ga0501073_0158453
532 Ga0501074_0006512
533 Ga0501074_0009982
534 Ga0501074_0185259
535 Ga0501075_0707665
536 Ga0501076_0037146
537 Ga0501076_0039844
538 Ga0501076_0050071
539 Ga0501076_0119054
540 Ga0501077_0109302
541 Ga0501079_0003117
542 Ga0501079_0035593
543 Ga0501079_0484061
544 Ga0501080_0043473
545 Ga0501081_0319894
546 Ga0501083_0102832
547 Ga0501035_0008641
548 Ga0501035_0040104
549 Ga0501035_0467587
550 Ga0501044_0528547
551 Ga0501045_0689814
552 nmdc:mga0qj67_129890_c1
553 nmdc:mga08y16_2811_c1
554 nmdc:mga08y16_391269_c1
555 nmdc:mga0n895_111_c1
556 nmdc:mga0n895_84135_c1
557 nmdc:mga0rr50_187201_c1
558 nmdc:mga0rr50_57_c1
559 nmdc:mga0rr50_62160_c1
560 nmdc:mga08x19_13506_c1
561 nmdc:mga08x19_426_c1
562 nmdc:mga0a205_61919_c1
563 Ga0501084_0007864
564 Ga0501084_0253210
565 Ga0501084_0429935
566 Ga0501084_0666203
567 Ga0590071_000323
568 Ga0590071_037920
569 Ga0590074_002896
570 Ga0590075_004204
571 Ga0590077_022478
572 Ga0501082_0002769
573 Ga0501082_0058612
574 Ga0501082_0952665

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06508

QueC

Queuosine biosynthesis protein QueC

24

237

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bl5-assembly1.cif.gz_A crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.7764 1 223
3bl5-assembly6.cif.gz_F crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.7712 2 223
2pg3-assembly1.cif.gz_A-2 crystal structure of a queuosine biosynthesis protein quec (eca1155) from erwinia carotovora subsp. atroseptica scri1043 at 2.40 a resolution 0.7679 1 223
3bl5-assembly1.cif.gz_A crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.762 1 223
3bl5-assembly6.cif.gz_F crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.75 2 223
ID Description Score Start End Superfamily
af_Q58742_1_231_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8022 1 230 3.40.50.620
af_Q58742_1_231_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7957 1 230 3.40.50.620
af_Q2G1X6_7_221_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7431 2 224 3.40.50.620
af_Q2G1X6_7_221_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7338 2 224 3.40.50.620
1korA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7283 1 175 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A2G4JJR6-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.985 1 232
AF-A0A7V9CK80-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.981 16 234
AF-A0A7Z9T943-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.9763 2 232
AF-A0A3N5P5P7-F1-model_v4 7-cyano-7-deazaguanine synthase 0.9751 1 153
AF-A0A800EGJ8-F1-model_v4 deleted 0.9743 1 135

Map