F388157

General Info

Members Datasets Scaffolds Average Seq Length
287 121 574 209

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0044795|Ga0466961_0044795_1101_1805
Length 234
Sequence LARESFHWTRAKRELTSFAMAKPLTIGNSIAPWRFLVFIAVLVIGAIPASLWLGSWWLGIIDAFDVSAALFLILCWRVIAIDDPKEMERNAQLNDANRTFLLIITGIVMAVLLIAVGAETVGRNPQAFAKALIIVTLIVAWLFSNTVYALHYAHMAYITPAAGCAGFRFPGTPQPVYWDFVYFAFTCGMAFATSDVEVTDQRIRKVVTFHCLAAFAFNIGVLAFTVNLLASGGG

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
103 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
110 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.74
Rhizosphere 97.91
Stem 0
Stem Tuber 0
Unclassified 6.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0044795 3300044693 Bacteria 2831
2 JGI24740J21852_10033164 3300001979 Bacteria 1643
3 JGI24740J21852_10067258 3300001979 Bacteria 970
4 JGI24735J21928_10024874 3300002067 Bacteria 1809
5 JGI24745J21846_1002113 3300002073 Bacteria 1997
6 rootH1_10026065 3300003323 Bacteria 1955
7 Ga0070658_10028835 3300005327 Bacteria 4456
8 Ga0070658_10287071 3300005327 Bacteria 1402
9 Ga0070683_100056998 3300005329 Bacteria 3629
10 Ga0070683_100327665 3300005329 Bacteria 1458
11 Ga0070683_100373976 3300005329 Bacteria 1358
12 Ga0070670_100241470 3300005331 Bacteria 1573
13 Ga0068869_100011150 3300005334 Bacteria 5891
14 Ga0070680_100001107 3300005336 Bacteria 19340
15 Ga0070680_100006267 3300005336 Bacteria 9026
16 Ga0070680_100180198 3300005336 Bacteria 1779
17 Ga0068868_100791071 3300005338 Bacteria 855
18 Ga0070660_100034868 3300005339 Bacteria 3805
19 Ga0070660_100043777 3300005339 Bacteria 3422
20 Ga0070660_100074462 3300005339 Bacteria 2657
21 Ga0070660_100129580 3300005339 Bacteria 2018
22 Ga0070660_100203914 3300005339 Bacteria 1604
23 Ga0070661_100003711 3300005344 Bacteria 10524
24 Ga0070661_100092680 3300005344 Bacteria 2238
25 Ga0070661_100231607 3300005344 Unclassified 1420
26 Ga0070674_100065224 3300005356 Bacteria 2555
27 Ga0070673_100070377 3300005364 Bacteria 2807
28 Ga0070673_100254312 3300005364 Unclassified 1532
29 Ga0070659_100005660 3300005366 Bacteria 8983
30 Ga0070659_100052895 3300005366 Bacteria 3195
31 Ga0070667_100032031 3300005367 Bacteria 4383
32 Ga0070667_100424251 3300005367 Bacteria 1213
33 Ga0070714_100037700 3300005435 Bacteria 4063
34 Ga0070714_100047169 3300005435 Bacteria 3659
35 Ga0070714_100113463 3300005435 Bacteria 2403
36 Ga0070714_100240774 3300005435 Bacteria 1670
37 Ga0070714_100345034 3300005435 Bacteria 1397
38 Ga0070713_100022349 3300005436 Bacteria 4888
39 Ga0070713_100097079 3300005436 Bacteria 2545
40 Ga0070678_100067128 3300005456 Bacteria 2668
41 Ga0070678_100337887 3300005456 Bacteria 1291
42 Ga0070662_100018099 3300005457 Bacteria 4761
43 Ga0070662_100119075 3300005457 Bacteria 2022
44 Ga0070681_10005224 3300005458 Bacteria 12540
45 Ga0070681_10142444 3300005458 Bacteria 2327
46 Ga0068867_100283411 3300005459 Bacteria 1359
47 Ga0068853_100003622 3300005539 Bacteria 11840
48 Ga0068853_100056455 3300005539 Bacteria 3386
49 Ga0068853_100193784 3300005539 Bacteria 1847
50 Ga0070672_100098993 3300005543 Bacteria 2362
51 Ga0070672_100126623 3300005543 Bacteria 2096
52 Ga0070665_100006014 3300005548 Bacteria 12406
53 Ga0068855_100061376 3300005563 Bacteria 4393
54 Ga0068855_100323259 3300005563 Bacteria 1705
55 Ga0068855_100520548 3300005563 Bacteria 1290
56 Ga0068855_100818499 3300005563 Bacteria 989
57 Ga0068855_101035476 3300005563 Bacteria 861
58 Ga0070664_100623678 3300005564 Bacteria 1001
59 Ga0068857_100002151 3300005577 Bacteria 16023
60 Ga0068854_100075573 3300005578 Bacteria 2474
61 Ga0068854_100106477 3300005578 Bacteria 2109
62 Ga0068854_100205683 3300005578 Bacteria 1550
63 Ga0068854_101152034 3300005578 Bacteria 693
64 Ga0068856_100083141 3300005614 Bacteria 3179
65 Ga0068856_100198619 3300005614 Bacteria 2020
66 Ga0068856_100236632 3300005614 Bacteria 1841
67 Ga0068856_100327735 3300005614 Unclassified 1549
68 Ga0068856_100878434 3300005614 Bacteria 915
69 Ga0068852_100004103 3300005616 Bacteria 10252
70 Ga0068852_100004379 3300005616 Bacteria 9978
71 Ga0068852_100004670 3300005616 Bacteria 9714
72 Ga0068852_100029691 3300005616 Bacteria 4494
73 Ga0068852_100031521 3300005616 Bacteria 4376
74 Ga0068852_100119710 3300005616 Bacteria 2408
75 Ga0068858_100331752 3300005842 Bacteria 1455
76 Ga0105240_10015829 3300009093 Bacteria 10231
77 Ga0105240_10259609 3300009093 Bacteria 2005
78 Ga0105245_10030961 3300009098 Bacteria 4733
79 Ga0105241_10037451 3300009174 Bacteria 3654
80 Ga0105242_10444339 3300009176 Bacteria 1221
81 Ga0105248_10196666 3300009177 Bacteria 2272
82 Ga0105237_10080761 3300009545 Bacteria 3242
83 Ga0105238_10004794 3300009551 Bacteria 13382
84 Ga0105238_10027374 3300009551 Bacteria 5808
85 Ga0105239_10077903 3300010375 Bacteria 3648
86 Ga0105239_10211166 3300010375 Unclassified 2176
87 Ga0157373_10081743 3300013100 Bacteria 2278
88 Ga0157373_10158072 3300013100 Unclassified 1595
89 Ga0157373_10170660 3300013100 Unclassified 1531
90 Ga0157373_10597411 3300013100 Bacteria 803
91 Ga0157371_10062321 3300013102 Bacteria 2644
92 Ga0157371_10092851 3300013102 Bacteria 2139
93 Ga0157371_10130190 3300013102 Unclassified 1790
94 Ga0157371_10172701 3300013102 Bacteria 1545
95 Ga0157371_10245910 3300013102 Bacteria 1287
96 Ga0157370_10005206 3300013104 Bacteria 14654
97 Ga0157370_10075579 3300013104 Bacteria 3175
98 Ga0157370_10213097 3300013104 Bacteria 1790
99 Ga0157370_10299652 3300013104 Bacteria 1484
100 Ga0157370_10381649 3300013104 Bacteria 1298
101 Ga0157369_10002615 3300013105 Bacteria 21530
102 Ga0157369_10026402 3300013105 Bacteria 6442
103 Ga0157369_10075654 3300013105 Bacteria 3609
104 Ga0157369_10549190 3300013105 Bacteria 1194
105 Ga0157369_10651906 3300013105 Bacteria 1086
106 Ga0157369_10858894 3300013105 Unclassified 931
107 Ga0157378_10312952 3300013297 Bacteria 1523
108 Ga0157372_10002970 3300013307 Bacteria 18265
109 Ga0157372_10231199 3300013307 Bacteria 2144
110 Ga0157372_10438505 3300013307 Bacteria 1522
111 Ga0157372_10529094 3300013307 Bacteria 1374
112 Ga0157375_10023087 3300013308 Bacteria 5734
113 Ga0206354_10335319 3300020081 Bacteria 2095
114 Ga0207688_10234301 3300025901 Bacteria 1109
115 Ga0207647_10042174 3300025904 Bacteria 2864
116 Ga0207645_10085999 3300025907 Bacteria 2019
117 Ga0207705_10056839 3300025909 Bacteria 2822
118 Ga0207705_10115420 3300025909 Bacteria 1987
119 Ga0207705_10150546 3300025909 Bacteria 1743
120 Ga0207707_10004536 3300025912 Bacteria 12212
121 Ga0207707_10104375 3300025912 Bacteria 2477
122 Ga0207695_10191420 3300025913 Bacteria 1963
123 Ga0207671_10036322 3300025914 Bacteria 3654
124 Ga0207660_10002184 3300025917 Bacteria 12956
125 Ga0207660_10002693 3300025917 Bacteria 11657
126 Ga0207660_10024640 3300025917 Bacteria 4075
127 Ga0207657_10005276 3300025919 Bacteria 13542
128 Ga0207657_10026544 3300025919 Bacteria 5320
129 Ga0207657_10133527 3300025919 Bacteria 2033
130 Ga0207657_10140815 3300025919 Unclassified 1971
131 Ga0207649_10004144 3300025920 Bacteria 7893
132 Ga0207649_10054754 3300025920 Bacteria 2484
133 Ga0207649_10562230 3300025920 Bacteria 874
134 Ga0207652_10037351 3300025921 Bacteria 4111
135 Ga0207694_10004270 3300025924 Bacteria 11187
136 Ga0207694_10017886 3300025924 Bacteria 5358
137 Ga0207694_10052727 3300025924 Bacteria 3153
138 Ga0207694_10123771 3300025924 Bacteria 2067
139 Ga0207700_10084776 3300025928 Bacteria 2485
140 Ga0207664_10024783 3300025929 Bacteria 4511
141 Ga0207664_10033351 3300025929 Bacteria 3955
142 Ga0207664_10069521 3300025929 Bacteria 2831
143 Ga0207690_10036771 3300025932 Bacteria 3173
144 Ga0207690_10398737 3300025932 Bacteria 1097
145 Ga0207706_10040362 3300025933 Bacteria 4136
146 Ga0207706_10189515 3300025933 Unclassified 1805
147 Ga0207691_10045666 3300025940 Bacteria 4026
148 Ga0207691_10361393 3300025940 Bacteria 1241
149 Ga0207689_10183137 3300025942 Unclassified 1727
150 Ga0207661_10044136 3300025944 Bacteria 3521
151 Ga0207661_10218962 3300025944 Bacteria 1682
152 Ga0207661_10269956 3300025944 Bacteria 1518
153 Ga0207679_10575092 3300025945 Bacteria 1013
154 Ga0207679_10989795 3300025945 Bacteria 771
155 Ga0207667_10058504 3300025949 Bacteria 4041
156 Ga0207667_10173961 3300025949 Bacteria 2212
157 Ga0207667_10211996 3300025949 Bacteria 1985
158 Ga0207667_10542040 3300025949 Bacteria 1177
159 Ga0207651_10013121 3300025960 Bacteria 4726
160 Ga0207651_10141935 3300025960 Bacteria 1856
161 Ga0207668_10757564 3300025972 Bacteria 857
162 Ga0207640_10284261 3300025981 Bacteria 1301
163 Ga0207640_10338879 3300025981 Bacteria 1204
164 Ga0207640_10485325 3300025981 Bacteria 1026
165 Ga0207640_11011674 3300025981 Bacteria 732
166 Ga0207658_10224909 3300025986 Bacteria 1581
167 Ga0207658_10274696 3300025986 Bacteria 1442
168 Ga0207677_10381144 3300026023 Bacteria 1190
169 Ga0207703_10052384 3300026035 Bacteria 3314
170 Ga0207703_10228488 3300026035 Bacteria 1667
171 Ga0207639_10010230 3300026041 Bacteria 6490
172 Ga0207678_10021698 3300026067 Bacteria 5631
173 Ga0207678_10146683 3300026067 Bacteria 2014
174 Ga0207702_10162393 3300026078 Bacteria 2041
175 Ga0207702_10297560 3300026078 Unclassified 1531
176 Ga0207648_10002495 3300026089 Bacteria 19746
177 Ga0207674_10138141 3300026116 Bacteria 2398
178 Ga0207683_10001608 3300026121 Bacteria 20313
179 Ga0207698_10001033 3300026142 Bacteria 16205
180 Ga0207698_10002603 3300026142 Bacteria 10730
181 Ga0207698_10002949 3300026142 Bacteria 10177
182 Ga0207698_10009648 3300026142 Bacteria 6164
183 Ga0207698_10010681 3300026142 Bacteria 5920
184 Ga0207698_10181191 3300026142 Bacteria 1866
185 Ga0207698_10230859 3300026142 Bacteria 1680
186 Ga0268266_10022498 3300028379 Bacteria 5371
187 Ga0307408_100061278 3300031548 Bacteria 2746
188 Ga0307413_10018650 3300031824 Bacteria 3646
189 Ga0307413_10258116 3300031824 Bacteria 1297
190 Ga0307410_10023185 3300031852 Bacteria 3853
191 Ga0307410_10063756 3300031852 Bacteria 2529
192 Ga0307406_10157938 3300031901 Bacteria 1626
193 Ga0307407_10092602 3300031903 Bacteria 1856
194 Ga0307407_10194816 3300031903 Bacteria 1353
195 Ga0307412_10198010 3300031911 Bacteria 1523
196 Ga0307409_100053866 3300031995 Bacteria 3094
197 Ga0307409_100221645 3300031995 Bacteria 1708
198 Ga0307414_10070965 3300032004 Bacteria 2510
199 Ga0307411_10124545 3300032005 Bacteria 1871
200 Ga0307411_10253764 3300032005 Bacteria 1384
201 Ga0307415_100330432 3300032126 Bacteria 1275
202 Ga0307415_100430012 3300032126 Bacteria 1135
203 Ga0395899_0002299 3300037312 Bacteria 15586
204 Ga0395899_0031397 3300037312 Bacteria 3992
205 Ga0395899_0592079 3300037312 Bacteria 707
206 Ga0395900_0001302 3300037418 Bacteria 30375
207 Ga0395900_0040874 3300037418 Bacteria 4779
208 Ga0395900_0086910 3300037418 Bacteria 3213
209 Ga0395900_0129069 3300037418 Bacteria 2591
210 Ga0395900_0191451 3300037418 Bacteria 2074
211 Ga0395900_0198958 3300037418 Bacteria 2028
212 Ga0395900_0217462 3300037418 Bacteria 1927
213 Ga0395900_0299903 3300037418 Bacteria 1593
214 Ga0395900_0300347 3300037418 Bacteria 1592
215 Ga0395900_0500468 3300037418 Unclassified 1165
216 Ga0395898_0021683 3300037466 Bacteria 6511
217 Ga0395898_0092193 3300037466 Bacteria 2913
218 Ga0395898_0285395 3300037466 Bacteria 1574
219 Ga0395898_0356718 3300037466 Bacteria 1394
220 Ga0395905_0025081 3300037471 Bacteria 5623
221 Ga0395905_0031873 3300037471 Bacteria 4959
222 Ga0395905_0282329 3300037471 Bacteria 1546
223 Ga0395905_0307466 3300037471 Bacteria 1473
224 Ga0395905_0323619 3300037471 Bacteria 1432
225 Ga0395901_0000131 3300038443 Bacteria 96504
226 Ga0395901_0001289 3300038443 Bacteria 26489
227 Ga0395901_0005957 3300038443 Bacteria 12344
228 Ga0395901_0109266 3300038443 Bacteria 2903
229 Ga0395901_0144568 3300038443 Bacteria 2500
230 Ga0395901_0254123 3300038443 Bacteria 1830
231 Ga0395901_0569720 3300038443 Unclassified 1145
232 Ga0395901_0800388 3300038443 Unclassified 931
233 Ga0466966_0000021 3300044684 Bacteria 116714
234 Ga0466966_0044397 3300044684 Bacteria 2845
235 Ga0466966_0054135 3300044684 Bacteria 2544
236 Ga0466966_0145634 3300044684 Bacteria 1446
237 Ga0466966_0489904 3300044684 Bacteria 739
238 Ga0466961_0035856 3300044693 Bacteria 3184
239 Ga0466961_0041712 3300044693 Bacteria 2942
240 Ga0466961_0046528 3300044693 Bacteria 2774
241 Ga0466961_0087009 3300044693 Bacteria 1975
242 Ga0466963_0000344 3300044694 Bacteria 21096
243 Ga0466963_0064760 3300044694 Bacteria 2449
244 Ga0466963_0069759 3300044694 Bacteria 2363
245 Ga0466963_0445356 3300044694 Unclassified 914
246 Ga0466964_0017366 3300044706 Bacteria 2753
247 Ga0466964_0079649 3300044706 Unclassified 1403
248 Ga0466964_0192755 3300044706 Bacteria 974
249 Ga0466971_0103074 3300044719 Bacteria 1312
250 Ga0466970_0017974 3300044765 Bacteria 3658
251 Ga0466970_0053764 3300044765 Bacteria 2151
252 Ga0466970_0055286 3300044765 Bacteria 2120
253 Ga0466970_0080984 3300044765 Bacteria 1755
254 Ga0466957_0000196 3300044842 Bacteria 27913
255 Ga0466957_0035908 3300044842 Bacteria 2976
256 Ga0466957_0123502 3300044842 Bacteria 1652
257 Ga0466957_0135986 3300044842 Bacteria 1580
258 Ga0466957_0365032 3300044842 Bacteria 982
259 Ga0466959_0365919 3300045049 Bacteria 982
260 Ga0466958_0000482 3300045836 Bacteria 16679
261 Ga0466958_0013070 3300045836 Bacteria 4718
262 Ga0466958_0077216 3300045836 Unclassified 2045
263 Ga0466958_0113956 3300045836 Bacteria 1689
264 Ga0466958_0604877 3300045836 Bacteria 713
265 Ga0466967_0000471 3300045976 Bacteria 19492
266 Ga0466967_0008368 3300045976 Bacteria 7571
267 Ga0466967_0026526 3300045976 Bacteria 4801
268 Ga0466967_0031603 3300045976 Bacteria 4459
269 Ga0466967_0076803 3300045976 Bacteria 3005
270 Ga0466967_0152369 3300045976 Bacteria 2162
271 Ga0466967_0155078 3300045976 Bacteria 2144
272 Ga0495654_0111613 3300046530 Bacteria 1247
273 Ga0495633_0124215 3300046558 Bacteria 1195
274 Ga0495668_0019980 3300046616 Bacteria 3852
275 Ga0495669_0001357 3300046684 Bacteria 10139
276 Ga0495669_0016715 3300046684 Bacteria 3145
277 Ga0495669_0033605 3300046684 Bacteria 2258
278 Ga0495686_0187501 3300047472 Bacteria 1194
279 Ga0496103_0094893 3300048906 Bacteria 1885
280 Ga0496108_0000944 3300048911 Bacteria 22620
281 Ga0496109_0327159 3300048912 Bacteria 1447
282 Ga0496111_0424902 3300048914 Bacteria 982
283 Ga0496112_0048519 3300048915 Bacteria 4163
284 Ga0501242_004975 3300049674 Bacteria 1484
285 Ga0501080_0027204 3300049742 Bacteria 5319
286 Ga0466962_0114464 3300061719 Bacteria 1299
287 Ga0466962_0292935 3300061719 Unclassified 804
288 Ga0466961_0044795
289 JGI24740J21852_10033164
290 JGI24740J21852_10067258
291 JGI24735J21928_10024874
292 JGI24745J21846_1002113
293 rootH1_10026065
294 Ga0070658_10028835
295 Ga0070658_10287071
296 Ga0070683_100056998
297 Ga0070683_100327665
298 Ga0070683_100373976
299 Ga0070670_100241470
300 Ga0068869_100011150
301 Ga0070680_100001107
302 Ga0070680_100006267
303 Ga0070680_100180198
304 Ga0068868_100791071
305 Ga0070660_100034868
306 Ga0070660_100043777
307 Ga0070660_100074462
308 Ga0070660_100129580
309 Ga0070660_100203914
310 Ga0070661_100003711
311 Ga0070661_100092680
312 Ga0070661_100231607
313 Ga0070674_100065224
314 Ga0070673_100070377
315 Ga0070673_100254312
316 Ga0070659_100005660
317 Ga0070659_100052895
318 Ga0070667_100032031
319 Ga0070667_100424251
320 Ga0070714_100037700
321 Ga0070714_100047169
322 Ga0070714_100113463
323 Ga0070714_100240774
324 Ga0070714_100345034
325 Ga0070713_100022349
326 Ga0070713_100097079
327 Ga0070678_100067128
328 Ga0070678_100337887
329 Ga0070662_100018099
330 Ga0070662_100119075
331 Ga0070681_10005224
332 Ga0070681_10142444
333 Ga0068867_100283411
334 Ga0068853_100003622
335 Ga0068853_100056455
336 Ga0068853_100193784
337 Ga0070672_100098993
338 Ga0070672_100126623
339 Ga0070665_100006014
340 Ga0068855_100061376
341 Ga0068855_100323259
342 Ga0068855_100520548
343 Ga0068855_100818499
344 Ga0068855_101035476
345 Ga0070664_100623678
346 Ga0068857_100002151
347 Ga0068854_100075573
348 Ga0068854_100106477
349 Ga0068854_100205683
350 Ga0068854_101152034
351 Ga0068856_100083141
352 Ga0068856_100198619
353 Ga0068856_100236632
354 Ga0068856_100327735
355 Ga0068856_100878434
356 Ga0068852_100004103
357 Ga0068852_100004379
358 Ga0068852_100004670
359 Ga0068852_100029691
360 Ga0068852_100031521
361 Ga0068852_100119710
362 Ga0068858_100331752
363 Ga0105240_10015829
364 Ga0105240_10259609
365 Ga0105245_10030961
366 Ga0105241_10037451
367 Ga0105242_10444339
368 Ga0105248_10196666
369 Ga0105237_10080761
370 Ga0105238_10004794
371 Ga0105238_10027374
372 Ga0105239_10077903
373 Ga0105239_10211166
374 Ga0157373_10081743
375 Ga0157373_10158072
376 Ga0157373_10170660
377 Ga0157373_10597411
378 Ga0157371_10062321
379 Ga0157371_10092851
380 Ga0157371_10130190
381 Ga0157371_10172701
382 Ga0157371_10245910
383 Ga0157370_10005206
384 Ga0157370_10075579
385 Ga0157370_10213097
386 Ga0157370_10299652
387 Ga0157370_10381649
388 Ga0157369_10002615
389 Ga0157369_10026402
390 Ga0157369_10075654
391 Ga0157369_10549190
392 Ga0157369_10651906
393 Ga0157369_10858894
394 Ga0157378_10312952
395 Ga0157372_10002970
396 Ga0157372_10231199
397 Ga0157372_10438505
398 Ga0157372_10529094
399 Ga0157375_10023087
400 Ga0206354_10335319
401 Ga0207688_10234301
402 Ga0207647_10042174
403 Ga0207645_10085999
404 Ga0207705_10056839
405 Ga0207705_10115420
406 Ga0207705_10150546
407 Ga0207707_10004536
408 Ga0207707_10104375
409 Ga0207695_10191420
410 Ga0207671_10036322
411 Ga0207660_10002184
412 Ga0207660_10002693
413 Ga0207660_10024640
414 Ga0207657_10005276
415 Ga0207657_10026544
416 Ga0207657_10133527
417 Ga0207657_10140815
418 Ga0207649_10004144
419 Ga0207649_10054754
420 Ga0207649_10562230
421 Ga0207652_10037351
422 Ga0207694_10004270
423 Ga0207694_10017886
424 Ga0207694_10052727
425 Ga0207694_10123771
426 Ga0207700_10084776
427 Ga0207664_10024783
428 Ga0207664_10033351
429 Ga0207664_10069521
430 Ga0207690_10036771
431 Ga0207690_10398737
432 Ga0207706_10040362
433 Ga0207706_10189515
434 Ga0207691_10045666
435 Ga0207691_10361393
436 Ga0207689_10183137
437 Ga0207661_10044136
438 Ga0207661_10218962
439 Ga0207661_10269956
440 Ga0207679_10575092
441 Ga0207679_10989795
442 Ga0207667_10058504
443 Ga0207667_10173961
444 Ga0207667_10211996
445 Ga0207667_10542040
446 Ga0207651_10013121
447 Ga0207651_10141935
448 Ga0207668_10757564
449 Ga0207640_10284261
450 Ga0207640_10338879
451 Ga0207640_10485325
452 Ga0207640_11011674
453 Ga0207658_10224909
454 Ga0207658_10274696
455 Ga0207677_10381144
456 Ga0207703_10052384
457 Ga0207703_10228488
458 Ga0207639_10010230
459 Ga0207678_10021698
460 Ga0207678_10146683
461 Ga0207702_10162393
462 Ga0207702_10297560
463 Ga0207648_10002495
464 Ga0207674_10138141
465 Ga0207683_10001608
466 Ga0207698_10001033
467 Ga0207698_10002603
468 Ga0207698_10002949
469 Ga0207698_10009648
470 Ga0207698_10010681
471 Ga0207698_10181191
472 Ga0207698_10230859
473 Ga0268266_10022498
474 Ga0307408_100061278
475 Ga0307413_10018650
476 Ga0307413_10258116
477 Ga0307410_10023185
478 Ga0307410_10063756
479 Ga0307406_10157938
480 Ga0307407_10092602
481 Ga0307407_10194816
482 Ga0307412_10198010
483 Ga0307409_100053866
484 Ga0307409_100221645
485 Ga0307414_10070965
486 Ga0307411_10124545
487 Ga0307411_10253764
488 Ga0307415_100330432
489 Ga0307415_100430012
490 Ga0395899_0002299
491 Ga0395899_0031397
492 Ga0395899_0592079
493 Ga0395900_0001302
494 Ga0395900_0040874
495 Ga0395900_0086910
496 Ga0395900_0129069
497 Ga0395900_0191451
498 Ga0395900_0198958
499 Ga0395900_0217462
500 Ga0395900_0299903
501 Ga0395900_0300347
502 Ga0395900_0500468
503 Ga0395898_0021683
504 Ga0395898_0092193
505 Ga0395898_0285395
506 Ga0395898_0356718
507 Ga0395905_0025081
508 Ga0395905_0031873
509 Ga0395905_0282329
510 Ga0395905_0307466
511 Ga0395905_0323619
512 Ga0395901_0000131
513 Ga0395901_0001289
514 Ga0395901_0005957
515 Ga0395901_0109266
516 Ga0395901_0144568
517 Ga0395901_0254123
518 Ga0395901_0569720
519 Ga0395901_0800388
520 Ga0466966_0000021
521 Ga0466966_0044397
522 Ga0466966_0054135
523 Ga0466966_0145634
524 Ga0466966_0489904
525 Ga0466961_0035856
526 Ga0466961_0041712
527 Ga0466961_0046528
528 Ga0466961_0087009
529 Ga0466963_0000344
530 Ga0466963_0064760
531 Ga0466963_0069759
532 Ga0466963_0445356
533 Ga0466964_0017366
534 Ga0466964_0079649
535 Ga0466964_0192755
536 Ga0466971_0103074
537 Ga0466970_0017974
538 Ga0466970_0053764
539 Ga0466970_0055286
540 Ga0466970_0080984
541 Ga0466957_0000196
542 Ga0466957_0035908
543 Ga0466957_0123502
544 Ga0466957_0135986
545 Ga0466957_0365032
546 Ga0466959_0365919
547 Ga0466958_0000482
548 Ga0466958_0013070
549 Ga0466958_0077216
550 Ga0466958_0113956
551 Ga0466958_0604877
552 Ga0466967_0000471
553 Ga0466967_0008368
554 Ga0466967_0026526
555 Ga0466967_0031603
556 Ga0466967_0076803
557 Ga0466967_0152369
558 Ga0466967_0155078
559 Ga0495654_0111613
560 Ga0495633_0124215
561 Ga0495668_0019980
562 Ga0495669_0001357
563 Ga0495669_0016715
564 Ga0495669_0033605
565 Ga0495686_0187501
566 Ga0496103_0094893
567 Ga0496108_0000944
568 Ga0496109_0327159
569 Ga0496111_0424902
570 Ga0496112_0048519
571 Ga0501242_004975
572 Ga0501080_0027204
573 Ga0466962_0114464
574 Ga0466962_0292935

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07077

DUF1345

Protein of unknown function (DUF1345)

56

224

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pqd-assembly1.cif.gz_UU cryo-em structure of the dimeric rhodobacter sphaeroides rc-lh1 core complex at 2.9 a: the structural basis for dimerisation 0.8971 14 53
4gx1-assembly1.cif.gz_A crystal structure of the gsuk bound to adp 0.8307 114 212
7adi-assembly1.cif.gz_A-2 kirbac3.1 w46r: role of a highly conserved tryptophan at the membrane-water interface of kir channel 0.8032 111 209
5yke-assembly1.cif.gz_A structure of pancreatic atp-sensitive potassium channel bound with glibenclamide and atpgammas (focused refinement on tm at 4.11a) 0.7884 115 214
6o9t-assembly1.cif.gz_A kirbac3.1 mutant at a resolution of 4.1 angstroms 0.787 112 210
ID Description Score Start End Superfamily
4gx0A01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8571 114 205 1.10.287.70
4gx5C01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8532 114 207 1.10.287.70
af_Q55CU6_305_415_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8501 115 213 1.10.287.70
af_I1JJJ2_64_158_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8455 118 212 1.10.287.70
4gx0B01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8321 114 212 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A2W6XIU5-F1-model_v4 DUF1345 domain-containing protein 0.9505 7 213 GO:0016020
AF-A0A0M3CB58-F1-model_v4 deleted 0.9489 121 212
AF-A0A6G8G0F1-F1-model_v4 DUF1345 domain-containing protein 0.9414 113 212 GO:0016020
AF-A0A537MK23-F1-model_v4 DUF1345 domain-containing protein 0.9363 4 211 GO:0016020
AF-A0A4Q9G6L2-F1-model_v4 DUF1345 domain-containing protein 0.9335 10 211 GO:0016020

Map