F388121

General Info

Members Datasets Scaffolds Average Seq Length
287 198 574 144

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0123861|Ga0395901_0123861_226_723
Length 165
Sequence MLRGDCSTRDPLIPVTRRLVWRRLDAPGMEIAHVESLERASGTQIGVPYELRWRLEGPRLELEVVGGPSATIELEDADFFDVFASPFFNSLPVMRDGLLEGGLAQEYTMRFVRVPSLEVVPSVQRYEPLGGRSVRYSSGSFAANIDFDTDGFVTVYEGFLERIGE

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
94 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
95 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
107 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
108 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
109 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
110 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
111 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
112 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
142 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 9.06
Rhizosphere 90.59
Stem 0
Stem Tuber 0
Unclassified 18.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0123861 3300038443 Bacteria 2716
2 Ga0070658_10094158 3300005327 Unclassified 2471
3 Ga0070690_100412702 3300005330 Bacteria 994
4 Ga0070670_100031117 3300005331 Bacteria 4596
5 Ga0068869_100263411 3300005334 Unclassified 1380
6 Ga0070666_10136212 3300005335 Bacteria 1708
7 Ga0070682_100257425 3300005337 Bacteria 1261
8 Ga0070691_10792569 3300005341 Unclassified 576
9 Ga0070687_100164295 3300005343 Bacteria 1315
10 Ga0070675_100242605 3300005354 Bacteria 1575
11 Ga0070675_101093202 3300005354 Bacteria 733
12 Ga0070674_100022644 3300005356 Bacteria 4054
13 Ga0070674_100230529 3300005356 Bacteria 1445
14 Ga0070673_101474485 3300005364 Unclassified 641
15 Ga0070714_100071387 3300005435 Bacteria 3002
16 Ga0070714_100613146 3300005435 Unclassified 1046
17 Ga0070713_100075658 3300005436 Unclassified 2856
18 Ga0070710_10786330 3300005437 Bacteria 679
19 Ga0070710_10861209 3300005437 Bacteria 651
20 Ga0070701_10015194 3300005438 Bacteria 3549
21 Ga0070700_100080280 3300005441 Bacteria 2104
22 Ga0070678_100219794 3300005456 Bacteria 1578
23 Ga0070706_100988082 3300005467 Unclassified 776
24 Ga0070707_100582044 3300005468 Bacteria 1082
25 Ga0070698_100045750 3300005471 Bacteria 4478
26 Ga0070696_100148527 3300005546 Bacteria 1718
27 Ga0070665_100234182 3300005548 Bacteria 1837
28 Ga0068855_100367879 3300005563 Bacteria 1581
29 Ga0068857_100289509 3300005577 Bacteria 1508
30 Ga0068854_100118804 3300005578 Bacteria 2004
31 Ga0068856_100872277 3300005614 Bacteria 919
32 Ga0070702_100176706 3300005615 Bacteria 1393
33 Ga0068852_100141267 3300005616 Bacteria 2229
34 Ga0068864_100055103 3300005618 Bacteria 3432
35 Ga0068864_100434518 3300005618 Bacteria 1253
36 Ga0068866_10059781 3300005718 Bacteria 1973
37 Ga0068851_10044323 3300005834 Bacteria 2245
38 Ga0068870_10005394 3300005840 Bacteria 5582
39 Ga0068870_10461488 3300005840 Bacteria 839
40 Ga0068863_101225830 3300005841 Unclassified 756
41 Ga0068858_100011732 3300005842 Bacteria 8264
42 Ga0068860_100040380 3300005843 Bacteria 4460
43 Ga0081455_10114942 3300005937 Bacteria 2131
44 Ga0081455_10265295 3300005937 Archaea 1249
45 Ga0081455_10316296 3300005937 Bacteria 1114
46 Ga0081539_10127829 3300005985 Unclassified 1253
47 Ga0081539_10177768 3300005985 Bacteria 1001
48 Ga0081539_10222635 3300005985 Unclassified 857
49 Ga0070715_10199672 3300006163 Unclassified 1015
50 Ga0070712_101392201 3300006175 Unclassified 612
51 Ga0075428_100054323 3300006844 Bacteria 4390
52 Ga0075431_100395197 3300006847 Bacteria 1384
53 Ga0075431_102063747 3300006847 Unclassified 525
54 Ga0075433_10005377 3300006852 Bacteria 10060
55 Ga0075434_100004976 3300006871 Bacteria 12053
56 Ga0075434_100198293 3300006871 Bacteria 2027
57 Ga0075434_100198467 3300006871 Bacteria 2026
58 Ga0075429_100373779 3300006880 Bacteria 1248
59 Ga0068865_100071441 3300006881 Bacteria 2462
60 Ga0068865_101548951 3300006881 Bacteria 595
61 Ga0075436_101406203 3300006914 Bacteria 529
62 Ga0075435_101724890 3300007076 Unclassified 550
63 Ga0105240_10143510 3300009093 Bacteria 2852
64 Ga0111539_10832944 3300009094 Bacteria 1073
65 Ga0111539_13093609 3300009094 Unclassified 537
66 Ga0105245_10582301 3300009098 Unclassified 1144
67 Ga0105245_10642953 3300009098 Bacteria 1090
68 Ga0105245_10642987 3300009098 Bacteria 1090
69 Ga0114129_10081067 3300009147 Bacteria 4511
70 Ga0114129_10090451 3300009147 Bacteria 4243
71 Ga0114129_10139583 3300009147 Bacteria 3323
72 Ga0114129_10168821 3300009147 Bacteria 2984
73 Ga0114129_10552181 3300009147 Bacteria 1498
74 Ga0114129_10889604 3300009147 Bacteria 1129
75 Ga0105241_10428377 3300009174 Unclassified 1166
76 Ga0105242_10010575 3300009176 Bacteria 7086
77 Ga0105248_10016930 3300009177 Bacteria 8025
78 Ga0105238_10105888 3300009551 Bacteria 2794
79 Ga0105249_10277250 3300009553 Bacteria 1673
80 Ga0105249_10465767 3300009553 Bacteria 1304
81 Ga0105246_10632428 3300011119 Unclassified 929
82 Ga0157370_10320938 3300013104 Bacteria 1428
83 Ga0157369_10011600 3300013105 Bacteria 10006
84 Ga0157374_10134093 3300013296 Bacteria 2399
85 Ga0157375_10214581 3300013308 Unclassified 2082
86 Ga0157375_10429337 3300013308 Bacteria 1487
87 Ga0157375_10469070 3300013308 Bacteria 1424
88 Ga0163163_10196756 3300014325 Bacteria 2064
89 Ga0163163_12019309 3300014325 Unclassified 636
90 Ga0157380_10477623 3300014326 Bacteria 1205
91 Ga0182008_10071422 3300014497 Unclassified 1708
92 Ga0157377_10143487 3300014745 Bacteria 1470
93 Ga0157377_10283811 3300014745 Bacteria 1086
94 Ga0157379_10311746 3300014968 Unclassified 1435
95 Ga0157379_10420035 3300014968 Bacteria 1231
96 Ga0157376_10209890 3300014969 Bacteria 1797
97 Ga0207692_10460949 3300025898 Bacteria 801
98 Ga0207642_10204898 3300025899 Unclassified 1092
99 Ga0207688_10035344 3300025901 Bacteria 2768
100 Ga0207643_10010459 3300025908 Bacteria 4997
101 Ga0207643_10664023 3300025908 Unclassified 673
102 Ga0207705_10093843 3300025909 Bacteria 2200
103 Ga0207707_10553242 3300025912 Bacteria 977
104 Ga0207693_10000561 3300025915 Bacteria 33553
105 Ga0207650_10068445 3300025925 Bacteria 2666
106 Ga0207687_10090804 3300025927 Bacteria 2227
107 Ga0207664_11325834 3300025929 Unclassified 640
108 Ga0207690_10170595 3300025932 Bacteria 1630
109 Ga0207686_10690809 3300025934 Unclassified 810
110 Ga0207709_10215893 3300025935 Bacteria 1380
111 Ga0207670_10729947 3300025936 Unclassified 822
112 Ga0207704_10197791 3300025938 Unclassified 1468
113 Ga0207711_10132783 3300025941 Bacteria 2233
114 Ga0207689_10061891 3300025942 Bacteria 3078
115 Ga0207712_10169419 3300025961 Bacteria 1705
116 Ga0207640_10366709 3300025981 Unclassified 1162
117 Ga0207641_11055999 3300026088 Unclassified 810
118 Ga0207648_10057345 3300026089 Unclassified 3398
119 Ga0207676_10142073 3300026095 Bacteria 2056
120 Ga0207676_10208824 3300026095 Unclassified 1731
121 Ga0207674_10062973 3300026116 Bacteria 3745
122 Ga0207683_10233020 3300026121 Unclassified 1679
123 Ga0373959_0113020 3300034820 Unclassified 657
124 Ga0373945_0110562 3300035116 Bacteria 1084
125 Ga0373943_0002587 3300035170 Bacteria 8227
126 Ga0373955_0098532 3300035172 Bacteria 1675
127 Ga0373935_1031503 3300035692 Bacteria 611
128 Ga0373933_0042517 3300035724 Bacteria 2686
129 Ga0373947_0029550 3300035725 Bacteria 3216
130 Ga0373937_0001932 3300036401 Bacteria 17334
131 Ga0373925_0006395 3300037068 Bacteria 8672
132 Ga0395899_0023488 3300037312 Bacteria 4669
133 Ga0395899_0234867 3300037312 Bacteria 1264
134 Ga0395899_0695506 3300037312 Unclassified 638
135 Ga0395900_0013983 3300037418 Bacteria 8192
136 Ga0395900_0054165 3300037418 Bacteria 4130
137 Ga0395900_0096672 3300037418 Bacteria 3034
138 Ga0395898_0013486 3300037466 Bacteria 8414
139 Ga0395898_0235145 3300037466 Bacteria 1747
140 Ga0395898_0587029 3300037466 Unclassified 1057
141 Ga0395898_1595098 3300037466 Unclassified 577
142 Ga0395905_0003790 3300037471 Bacteria 15993
143 Ga0395905_0073795 3300037471 Bacteria 3198
144 Ga0395905_0089618 3300037471 Bacteria 2883
145 Ga0395901_0009099 3300038443 Bacteria 10055
146 Ga0395901_0110717 3300038443 Bacteria 2883
147 Ga0395901_0111756 3300038443 Bacteria 2869
148 Ga0395901_1414133 3300038443 Unclassified 654
149 Ga0439433_0009060 3300041999 Bacteria 2166
150 Ga0439445_0105745 3300042004 Bacteria 800
151 Ga0439448_0091797 3300042005 Bacteria 1027
152 Ga0439462_0003314 3300042015 Bacteria 3854
153 Ga0439446_0001605 3300042156 Bacteria 5204
154 Ga0439434_0003581 3300042435 Bacteria 4537
155 Ga0439435_0089937 3300042436 Bacteria 931
156 Ga0451577_0756275 3300042876 Bacteria 879
157 Ga0466965_0330494 3300044683 Bacteria 832
158 Ga0466961_0381017 3300044693 Unclassified 857
159 Ga0466963_0045952 3300044694 Bacteria 2878
160 Ga0466963_0151685 3300044694 Bacteria 1609
161 Ga0466963_0211361 3300044694 Bacteria 1358
162 Ga0466964_0029357 3300044706 Bacteria 2171
163 Ga0466964_0605436 3300044706 Unclassified 601
164 Ga0466971_0020830 3300044719 Bacteria 2915
165 Ga0466968_0032579 3300044735 Bacteria 2169
166 Ga0466957_0044398 3300044842 Bacteria 2693
167 Ga0466959_0920627 3300045049 Bacteria 583
168 Ga0466958_0064188 3300045836 Bacteria 2239
169 Ga0466967_0034987 3300045976 Bacteria 4270
170 Ga0466967_0091806 3300045976 Bacteria 2760
171 Ga0466967_0194840 3300045976 Bacteria 1917
172 Ga0466967_0382045 3300045976 Bacteria 1367
173 Ga0466967_0607640 3300045976 Bacteria 1080
174 Ga0466967_0712888 3300045976 Bacteria 994
175 Ga0466967_1384099 3300045976 Unclassified 701
176 Ga0466967_2372416 3300045976 Bacteria 526
177 Ga0495592_0045486 3300046454 Bacteria 3275
178 Ga0495592_0233080 3300046454 Bacteria 1225
179 Ga0495603_0085543 3300046455 Bacteria 1846
180 Ga0495629_0172518 3300046459 Bacteria 1500
181 Ga0495641_0004571 3300046461 Bacteria 9703
182 Ga0495651_0081731 3300046462 Bacteria 2438
183 Ga0495651_0214922 3300046462 Bacteria 1335
184 Ga0495653_0029950 3300046463 Bacteria 4337
185 Ga0495653_0092478 3300046463 Bacteria 2208
186 Ga0495580_0107324 3300046472 Bacteria 1939
187 Ga0495580_0212248 3300046472 Bacteria 1332
188 Ga0495582_0088031 3300046473 Bacteria 1729
189 Ga0495639_0084363 3300046475 Bacteria 1483
190 Ga0495662_0013684 3300046476 Bacteria 3951
191 Ga0495664_0071406 3300046477 Bacteria 2073
192 Ga0495664_0134320 3300046477 Bacteria 1499
193 Ga0495585_0457310 3300046492 Bacteria 610
194 Ga0495594_0272086 3300046499 Bacteria 965
195 Ga0495608_0007708 3300046511 Bacteria 7586
196 Ga0495618_0000680 3300046514 Bacteria 23842
197 Ga0495618_0070588 3300046514 Bacteria 2221
198 Ga0495628_0086007 3300046516 Bacteria 2438
199 Ga0495628_0133644 3300046516 Bacteria 1897
200 Ga0495630_0055715 3300046517 Bacteria 2962
201 Ga0495644_0143291 3300046523 Unclassified 913
202 Ga0495666_0001406 3300046526 Bacteria 11650
203 Ga0495652_0094486 3300046529 Bacteria 2438
204 Ga0495652_0163342 3300046529 Bacteria 1726
205 Ga0495640_0103982 3300046533 Bacteria 1861
206 Ga0495640_0529428 3300046533 Bacteria 715
207 Ga0495587_0018945 3300046536 Bacteria 4265
208 Ga0495645_0000988 3300046543 Bacteria 19388
209 Ga0495645_0255287 3300046543 Bacteria 1163
210 Ga0495667_0154331 3300046559 Bacteria 1478
211 Ga0495667_0511334 3300046559 Bacteria 752
212 Ga0495656_0054805 3300046615 Bacteria 1717
213 Ga0495656_0277422 3300046615 Bacteria 853
214 Ga0495634_0092293 3300046642 Bacteria 1964
215 Ga0495588_0068687 3300046674 Bacteria 1841
216 Ga0495657_0055599 3300046675 Bacteria 2639
217 Ga0495599_0002425 3300046678 Bacteria 10859
218 Ga0495623_0003164 3300046679 Bacteria 10859
219 Ga0495646_0004927 3300046680 Bacteria 8431
220 Ga0495646_0066553 3300046680 Bacteria 2131
221 Ga0495647_0020691 3300046681 Bacteria 2364
222 Ga0495658_0087537 3300046683 Bacteria 1839
223 Ga0495624_0113772 3300046690 Bacteria 1663
224 Ga0495670_0082535 3300046691 Unclassified 1639
225 Ga0495589_0146287 3300046794 Bacteria 1130
226 Ga0495600_0332864 3300046809 Bacteria 953
227 Ga0495581_0060191 3300047315 Bacteria 2194
228 Ga0495604_0004798 3300047317 Bacteria 10718
229 Ga0495636_0409370 3300047318 Bacteria 647
230 Ga0495674_0310526 3300047319 Bacteria 1286
231 Ga0495676_0007468 3300047321 Bacteria 10024
232 Ga0495680_0018380 3300047322 Bacteria 5936
233 Ga0495680_0045617 3300047322 Bacteria 3460
234 Ga0495675_0000809 3300047444 Bacteria 19282
235 Ga0495593_0001892 3300047673 Bacteria 12466
236 Ga0495602_0001857 3300048088 Bacteria 21151
237 Ga0495614_0093506 3300048089 Bacteria 1309
238 Ga0496100_0016078 3300048903 Unclassified 4384
239 Ga0496100_0018123 3300048903 Bacteria 4171
240 Ga0496101_0045144 3300048904 Bacteria 3155
241 Ga0496101_0265155 3300048904 Bacteria 1340
242 Ga0496102_0043389 3300048905 Bacteria 4078
243 Ga0496102_0609864 3300048905 Unclassified 1014
244 Ga0496102_1106048 3300048905 Bacteria 712
245 Ga0496106_0019574 3300048909 Bacteria 5022
246 Ga0496106_0104908 3300048909 Bacteria 2195
247 Ga0496107_0000240 3300048910 Bacteria 28673
248 Ga0496107_0228513 3300048910 Bacteria 1384
249 Ga0496107_1048214 3300048910 Bacteria 590
250 Ga0496108_0036129 3300048911 Bacteria 4109
251 Ga0496108_0041192 3300048911 Unclassified 3854
252 Ga0496109_0014688 3300048912 Bacteria 6815
253 Ga0496109_0030347 3300048912 Bacteria 4846
254 Ga0496110_0244917 3300048913 Unclassified 1631
255 Ga0496110_1087264 3300048913 Bacteria 708
256 Ga0496111_0176003 3300048914 Unclassified 1590
257 Ga0496112_0091201 3300048915 Unclassified 3016
258 Ga0496112_0296909 3300048915 Bacteria 1561
259 Ga0496113_0101928 3300048916 Unclassified 2225
260 Ga0496113_0281875 3300048916 Bacteria 1329
261 Ga0496113_0652305 3300048916 Unclassified 842
262 Ga0496114_0728003 3300048917 Unclassified 868
263 Ga0496115_1157541 3300048918 Bacteria 583
264 Ga0501040_0193178 3300049576 Bacteria 1445
265 Ga0501068_0900378 3300049584 Bacteria 582
266 Ga0501069_0329631 3300049585 Bacteria 898
267 nmdc:mga05p37_271967_c1 3300050507 Bacteria 2024
268 nmdc:mga05p37_29133_c1 3300050507 Bacteria 6738
269 nmdc:mga05p37_38227_c1 3300050507 Bacteria 5886
270 nmdc:mga05p37_467762_c1 3300050507 Bacteria 1455
271 nmdc:mga05p37_59288_c1 3300050507 Bacteria 4714
272 nmdc:mga09592_336417_c1 3300050508 Bacteria 1307
273 nmdc:mga0qj67_53151_c1 3300050509 Bacteria 3206
274 nmdc:mga06r32_549323_c1 3300050510 Archaea 1129
275 nmdc:mga0n895_159976_c1 3300050512 Bacteria 2283
276 nmdc:mga0n895_935749_c1 3300050512 Bacteria 851
277 nmdc:mga0rr50_293726_c1 3300050513 Bacteria 1358
278 nmdc:mga0rr50_767082_c1 3300050513 Unclassified 823
279 nmdc:mga0a205_169854_c1 3300050515 Bacteria 2077
280 nmdc:mga0a205_807560_c1 3300050515 Unclassified 786
281 Ga0495601_0002666 3300053077 Bacteria 10117
282 Ga0495601_0543916 3300053077 Bacteria 747
283 Ga0495612_0019986 3300053078 Bacteria 2683
284 Ga0495595_0076226 3300053084 Bacteria 1591
285 Ga0495619_0009598 3300053085 Bacteria 6104
286 Ga0495619_0082373 3300053085 Bacteria 2168
287 Ga0500566_0101767 3300053094 Bacteria 1574
288 Ga0395901_0123861
289 Ga0070658_10094158
290 Ga0070690_100412702
291 Ga0070670_100031117
292 Ga0068869_100263411
293 Ga0070666_10136212
294 Ga0070682_100257425
295 Ga0070691_10792569
296 Ga0070687_100164295
297 Ga0070675_100242605
298 Ga0070675_101093202
299 Ga0070674_100022644
300 Ga0070674_100230529
301 Ga0070673_101474485
302 Ga0070714_100071387
303 Ga0070714_100613146
304 Ga0070713_100075658
305 Ga0070710_10786330
306 Ga0070710_10861209
307 Ga0070701_10015194
308 Ga0070700_100080280
309 Ga0070678_100219794
310 Ga0070706_100988082
311 Ga0070707_100582044
312 Ga0070698_100045750
313 Ga0070696_100148527
314 Ga0070665_100234182
315 Ga0068855_100367879
316 Ga0068857_100289509
317 Ga0068854_100118804
318 Ga0068856_100872277
319 Ga0070702_100176706
320 Ga0068852_100141267
321 Ga0068864_100055103
322 Ga0068864_100434518
323 Ga0068866_10059781
324 Ga0068851_10044323
325 Ga0068870_10005394
326 Ga0068870_10461488
327 Ga0068863_101225830
328 Ga0068858_100011732
329 Ga0068860_100040380
330 Ga0081455_10114942
331 Ga0081455_10265295
332 Ga0081455_10316296
333 Ga0081539_10127829
334 Ga0081539_10177768
335 Ga0081539_10222635
336 Ga0070715_10199672
337 Ga0070712_101392201
338 Ga0075428_100054323
339 Ga0075431_100395197
340 Ga0075431_102063747
341 Ga0075433_10005377
342 Ga0075434_100004976
343 Ga0075434_100198293
344 Ga0075434_100198467
345 Ga0075429_100373779
346 Ga0068865_100071441
347 Ga0068865_101548951
348 Ga0075436_101406203
349 Ga0075435_101724890
350 Ga0105240_10143510
351 Ga0111539_10832944
352 Ga0111539_13093609
353 Ga0105245_10582301
354 Ga0105245_10642953
355 Ga0105245_10642987
356 Ga0114129_10081067
357 Ga0114129_10090451
358 Ga0114129_10139583
359 Ga0114129_10168821
360 Ga0114129_10552181
361 Ga0114129_10889604
362 Ga0105241_10428377
363 Ga0105242_10010575
364 Ga0105248_10016930
365 Ga0105238_10105888
366 Ga0105249_10277250
367 Ga0105249_10465767
368 Ga0105246_10632428
369 Ga0157370_10320938
370 Ga0157369_10011600
371 Ga0157374_10134093
372 Ga0157375_10214581
373 Ga0157375_10429337
374 Ga0157375_10469070
375 Ga0163163_10196756
376 Ga0163163_12019309
377 Ga0157380_10477623
378 Ga0182008_10071422
379 Ga0157377_10143487
380 Ga0157377_10283811
381 Ga0157379_10311746
382 Ga0157379_10420035
383 Ga0157376_10209890
384 Ga0207692_10460949
385 Ga0207642_10204898
386 Ga0207688_10035344
387 Ga0207643_10010459
388 Ga0207643_10664023
389 Ga0207705_10093843
390 Ga0207707_10553242
391 Ga0207693_10000561
392 Ga0207650_10068445
393 Ga0207687_10090804
394 Ga0207664_11325834
395 Ga0207690_10170595
396 Ga0207686_10690809
397 Ga0207709_10215893
398 Ga0207670_10729947
399 Ga0207704_10197791
400 Ga0207711_10132783
401 Ga0207689_10061891
402 Ga0207712_10169419
403 Ga0207640_10366709
404 Ga0207641_11055999
405 Ga0207648_10057345
406 Ga0207676_10142073
407 Ga0207676_10208824
408 Ga0207674_10062973
409 Ga0207683_10233020
410 Ga0373959_0113020
411 Ga0373945_0110562
412 Ga0373943_0002587
413 Ga0373955_0098532
414 Ga0373935_1031503
415 Ga0373933_0042517
416 Ga0373947_0029550
417 Ga0373937_0001932
418 Ga0373925_0006395
419 Ga0395899_0023488
420 Ga0395899_0234867
421 Ga0395899_0695506
422 Ga0395900_0013983
423 Ga0395900_0054165
424 Ga0395900_0096672
425 Ga0395898_0013486
426 Ga0395898_0235145
427 Ga0395898_0587029
428 Ga0395898_1595098
429 Ga0395905_0003790
430 Ga0395905_0073795
431 Ga0395905_0089618
432 Ga0395901_0009099
433 Ga0395901_0110717
434 Ga0395901_0111756
435 Ga0395901_1414133
436 Ga0439433_0009060
437 Ga0439445_0105745
438 Ga0439448_0091797
439 Ga0439462_0003314
440 Ga0439446_0001605
441 Ga0439434_0003581
442 Ga0439435_0089937
443 Ga0451577_0756275
444 Ga0466965_0330494
445 Ga0466961_0381017
446 Ga0466963_0045952
447 Ga0466963_0151685
448 Ga0466963_0211361
449 Ga0466964_0029357
450 Ga0466964_0605436
451 Ga0466971_0020830
452 Ga0466968_0032579
453 Ga0466957_0044398
454 Ga0466959_0920627
455 Ga0466958_0064188
456 Ga0466967_0034987
457 Ga0466967_0091806
458 Ga0466967_0194840
459 Ga0466967_0382045
460 Ga0466967_0607640
461 Ga0466967_0712888
462 Ga0466967_1384099
463 Ga0466967_2372416
464 Ga0495592_0045486
465 Ga0495592_0233080
466 Ga0495603_0085543
467 Ga0495629_0172518
468 Ga0495641_0004571
469 Ga0495651_0081731
470 Ga0495651_0214922
471 Ga0495653_0029950
472 Ga0495653_0092478
473 Ga0495580_0107324
474 Ga0495580_0212248
475 Ga0495582_0088031
476 Ga0495639_0084363
477 Ga0495662_0013684
478 Ga0495664_0071406
479 Ga0495664_0134320
480 Ga0495585_0457310
481 Ga0495594_0272086
482 Ga0495608_0007708
483 Ga0495618_0000680
484 Ga0495618_0070588
485 Ga0495628_0086007
486 Ga0495628_0133644
487 Ga0495630_0055715
488 Ga0495644_0143291
489 Ga0495666_0001406
490 Ga0495652_0094486
491 Ga0495652_0163342
492 Ga0495640_0103982
493 Ga0495640_0529428
494 Ga0495587_0018945
495 Ga0495645_0000988
496 Ga0495645_0255287
497 Ga0495667_0154331
498 Ga0495667_0511334
499 Ga0495656_0054805
500 Ga0495656_0277422
501 Ga0495634_0092293
502 Ga0495588_0068687
503 Ga0495657_0055599
504 Ga0495599_0002425
505 Ga0495623_0003164
506 Ga0495646_0004927
507 Ga0495646_0066553
508 Ga0495647_0020691
509 Ga0495658_0087537
510 Ga0495624_0113772
511 Ga0495670_0082535
512 Ga0495589_0146287
513 Ga0495600_0332864
514 Ga0495581_0060191
515 Ga0495604_0004798
516 Ga0495636_0409370
517 Ga0495674_0310526
518 Ga0495676_0007468
519 Ga0495680_0018380
520 Ga0495680_0045617
521 Ga0495675_0000809
522 Ga0495593_0001892
523 Ga0495602_0001857
524 Ga0495614_0093506
525 Ga0496100_0016078
526 Ga0496100_0018123
527 Ga0496101_0045144
528 Ga0496101_0265155
529 Ga0496102_0043389
530 Ga0496102_0609864
531 Ga0496102_1106048
532 Ga0496106_0019574
533 Ga0496106_0104908
534 Ga0496107_0000240
535 Ga0496107_0228513
536 Ga0496107_1048214
537 Ga0496108_0036129
538 Ga0496108_0041192
539 Ga0496109_0014688
540 Ga0496109_0030347
541 Ga0496110_0244917
542 Ga0496110_1087264
543 Ga0496111_0176003
544 Ga0496112_0091201
545 Ga0496112_0296909
546 Ga0496113_0101928
547 Ga0496113_0281875
548 Ga0496113_0652305
549 Ga0496114_0728003
550 Ga0496115_1157541
551 Ga0501040_0193178
552 Ga0501068_0900378
553 Ga0501069_0329631
554 nmdc:mga05p37_271967_c1
555 nmdc:mga05p37_29133_c1
556 nmdc:mga05p37_38227_c1
557 nmdc:mga05p37_467762_c1
558 nmdc:mga05p37_59288_c1
559 nmdc:mga09592_336417_c1
560 nmdc:mga0qj67_53151_c1
561 nmdc:mga06r32_549323_c1
562 nmdc:mga0n895_159976_c1
563 nmdc:mga0n895_935749_c1
564 nmdc:mga0rr50_293726_c1
565 nmdc:mga0rr50_767082_c1
566 nmdc:mga0a205_169854_c1
567 nmdc:mga0a205_807560_c1
568 Ga0495601_0002666
569 Ga0495601_0543916
570 Ga0495612_0019986
571 Ga0495595_0076226
572 Ga0495619_0009598
573 Ga0495619_0082373
574 Ga0500566_0101767

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06475

Glycolipid_bind

Putative glycolipid-binding

63

162

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h1t-assembly1.cif.gz_B crystal structure of a duf1089 family protein (pa1994) from pseudomonas aeruginosa at 1.80 a resolution 0.7686 17 153
8iq1-assembly4.cif.gz_G crystal structure of hydrogen sulfide-bound superoxide dismutase in reduced state 0.7361 1 36
2z7z-assembly1.cif.gz_A crystal structure of h2o2 treated cu,zn-sod 0.6729 1 49
2h1t-assembly1.cif.gz_B crystal structure of a duf1089 family protein (pa1994) from pseudomonas aeruginosa at 1.80 a resolution 0.6728 17 153
1sda-assembly2.cif.gz_G crystal structure of peroxynitrite-modified bovine cu,zn superoxide dismutase 0.6545 1 51
ID Description Score Start End Superfamily
af_Q9XU25_246_381_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.7357 31 63 2.40.50.100
af_A3KFD5_112_191_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.7241 31 63 2.40.50.100
4r7rA00 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;Uncharacterised protein PF16224, DUF4883 0.7211 30 66 3.30.1490.410
af_Q4W5R2_2_230_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.7204 29 62 3.80.10.10
af_P09201_12_210_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.6738 15 54 3.30.540.10
ID Description Score Start End GO Terms
AF-A0A6P2BTT4-F1-model_v4 Uncharacterized protein 0.9553 1 154
AF-A0A6P2BTT4-F1-model_v4 Uncharacterized protein 0.9492 1 154
AF-A0A3N5M7T9-F1-model_v4 Uncharacterized protein 0.9315 81 154
AF-A0A2V7J7H6-F1-model_v4 Glycolipid-binding domain-containing protein 0.9301 66 154
AF-A0A370IH30-F1-model_v4 Putative glycolipid-binding protein 0.9243 92 154

Map