F387959

General Info

Members Datasets Scaffolds Average Seq Length
287 158 574 161

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100823632|Ga0075428_1008236321
Length 171
Sequence MTTPTLETRVDEFLAQKRIAVAGVSRSNSHHPAGNLIYRRLKETGHEVFPVNPHMQTFEGDRCYPDLRSIPSGVDGVVIVTRPEATERIVHDCRDAGLRRVWMHQSMGKKASSVSPAAVEYCRQHDINVIAGACPMMYGESVDLGHTCMRWILKLTGGLPTRRKCAASPGS

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
102 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
103 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
104 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
112 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
113 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
141 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.39
Rhizosphere 98.61
Stem 0
Stem Tuber 0
Unclassified 22.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100823632 3300006844 Unclassified 986
2 Ga0065712_10164303 3300005290 Bacteria 1282
3 Ga0065715_10145257 3300005293 Bacteria 1797
4 Ga0065715_10228833 3300005293 Bacteria 1241
5 Ga0065707_10004900 3300005295 Bacteria 3920
6 Ga0070676_10361744 3300005328 Bacteria 1000
7 Ga0070670_100621504 3300005331 Bacteria 968
8 Ga0068869_100133841 3300005334 Bacteria 1908
9 Ga0068869_100649828 3300005334 Bacteria 895
10 Ga0068868_101259981 3300005338 Bacteria 686
11 Ga0068868_101268192 3300005338 Bacteria 683
12 Ga0070689_100009291 3300005340 Bacteria 6967
13 Ga0070692_10254353 3300005345 Bacteria 1053
14 Ga0070668_100543070 3300005347 Bacteria 1011
15 Ga0070669_100179072 3300005353 Bacteria 1657
16 Ga0070669_100449533 3300005353 Bacteria 1062
17 Ga0070669_100495100 3300005353 Bacteria 1013
18 Ga0070669_100614272 3300005353 Bacteria 912
19 Ga0070675_100002853 3300005354 Bacteria 13030
20 Ga0070675_100020011 3300005354 Bacteria 5340
21 Ga0070671_100135173 3300005355 Bacteria 2079
22 Ga0070674_100329316 3300005356 Bacteria 1227
23 Ga0070673_100004551 3300005364 Bacteria 8783
24 Ga0070673_100135857 3300005364 Unclassified 2070
25 Ga0070673_101407691 3300005364 Bacteria 656
26 Ga0070688_100018578 3300005365 Bacteria 4014
27 Ga0070667_100020179 3300005367 Bacteria 5533
28 Ga0070709_10084621 3300005434 Bacteria 2078
29 Ga0070713_100232866 3300005436 Bacteria 1675
30 Ga0070701_10032577 3300005438 Unclassified 2597
31 Ga0070701_10384197 3300005438 Bacteria 886
32 Ga0070711_100142257 3300005439 Bacteria 1800
33 Ga0070700_100078490 3300005441 Bacteria 2125
34 Ga0070700_100319011 3300005441 Unclassified 1141
35 Ga0070694_100376442 3300005444 Bacteria 1106
36 Ga0070678_100613807 3300005456 Bacteria 972
37 Ga0070662_100155091 3300005457 Unclassified 1787
38 Ga0070662_100510734 3300005457 Bacteria 1003
39 Ga0070685_10011464 3300005466 Bacteria 4640
40 Ga0070685_10529501 3300005466 Bacteria 838
41 Ga0070698_100131899 3300005471 Bacteria 2454
42 Ga0070699_101441472 3300005518 Unclassified 631
43 Ga0068853_100978384 3300005539 Bacteria 814
44 Ga0070672_100042540 3300005543 Bacteria 3498
45 Ga0070672_100085534 3300005543 Bacteria 2534
46 Ga0070672_100325968 3300005543 Bacteria 1306
47 Ga0070686_100001035 3300005544 Bacteria 16004
48 Ga0070686_100533354 3300005544 Bacteria 916
49 Ga0070665_101932641 3300005548 Unclassified 596
50 Ga0070704_101375314 3300005549 Bacteria 647
51 Ga0070664_100024303 3300005564 Bacteria 5011
52 Ga0070664_100520450 3300005564 Bacteria 1098
53 Ga0068856_100543127 3300005614 Bacteria 1183
54 Ga0068864_100025186 3300005618 Bacteria 5009
55 Ga0068861_100520472 3300005719 Bacteria 1079
56 Ga0068870_10456898 3300005840 Archaea 843
57 Ga0068870_10517774 3300005840 Unclassified 798
58 Ga0068863_100000876 3300005841 Bacteria 30194
59 Ga0068863_100221899 3300005841 Bacteria 1821
60 Ga0068863_101060331 3300005841 Unclassified 814
61 Ga0068858_100015266 3300005842 Bacteria 7227
62 Ga0068858_100114747 3300005842 Bacteria 2517
63 Ga0068858_100397471 3300005842 Bacteria 1324
64 Ga0068860_100030798 3300005843 Bacteria 5159
65 Ga0068860_100115797 3300005843 Bacteria 2564
66 Ga0068860_100281804 3300005843 Bacteria 1624
67 Ga0068862_100420136 3300005844 Bacteria 1254
68 Ga0081455_10571222 3300005937 Bacteria 743
69 Ga0068871_100262237 3300006358 Unclassified 1507
70 Ga0075428_100006226 3300006844 Bacteria 13273
71 Ga0075428_100090725 3300006844 Bacteria 3333
72 Ga0075428_100119748 3300006844 Bacteria 2866
73 Ga0075428_100233153 3300006844 Bacteria 1986
74 Ga0075430_100001337 3300006846 Bacteria 19912
75 Ga0075430_100009425 3300006846 Bacteria 8248
76 Ga0075430_100021745 3300006846 Bacteria 5452
77 Ga0075431_100005990 3300006847 Bacteria 12046
78 Ga0075431_100048076 3300006847 Unclassified 4400
79 Ga0075431_100077763 3300006847 Bacteria 3424
80 Ga0075431_100256555 3300006847 Bacteria 1775
81 Ga0075431_100607355 3300006847 Unclassified 1077
82 Ga0075433_10053855 3300006852 Unclassified 3509
83 Ga0075433_10330816 3300006852 Bacteria 1347
84 Ga0075429_100007945 3300006880 Bacteria 9220
85 Ga0075429_100067597 3300006880 Bacteria 3110
86 Ga0075429_100067691 3300006880 Bacteria 3108
87 Ga0075429_100770901 3300006880 Unclassified 842
88 Ga0068865_100002973 3300006881 Bacteria 10114
89 Ga0105240_10068089 3300009093 Bacteria 4410
90 Ga0111539_10025360 3300009094 Bacteria 7267
91 Ga0111539_10156343 3300009094 Bacteria 2668
92 Ga0111539_10753732 3300009094 Bacteria 1133
93 Ga0105247_10017074 3300009101 Bacteria 4357
94 Ga0105247_10555158 3300009101 Unclassified 845
95 Ga0114129_10012039 3300009147 Bacteria 12304
96 Ga0114129_10190288 3300009147 Bacteria 2787
97 Ga0114129_10239094 3300009147 Bacteria 2442
98 Ga0114129_10276204 3300009147 Bacteria 2246
99 Ga0114129_10467434 3300009147 Unclassified 1652
100 Ga0114129_10518173 3300009147 Bacteria 1555
101 Ga0105243_11202346 3300009148 Bacteria 771
102 Ga0105248_10000888 3300009177 Bacteria 33497
103 Ga0105248_10086487 3300009177 Bacteria 3528
104 Ga0105248_10218134 3300009177 Bacteria 2148
105 Ga0105237_10147712 3300009545 Bacteria 2346
106 Ga0105246_12175096 3300011119 Bacteria 539
107 Ga0157378_10044543 3300013297 Bacteria 3940
108 Ga0157378_10257695 3300013297 Bacteria 1672
109 Ga0157378_11004841 3300013297 Bacteria 868
110 Ga0163162_10010216 3300013306 Bacteria 9121
111 Ga0163162_10011419 3300013306 Bacteria 8661
112 Ga0163162_12618837 3300013306 Unclassified 580
113 Ga0157375_10001072 3300013308 Bacteria 23694
114 Ga0157375_10050512 3300013308 Bacteria 4079
115 Ga0157375_10576256 3300013308 Bacteria 1286
116 Ga0163163_10072246 3300014325 Bacteria 3439
117 Ga0157380_10129889 3300014326 Bacteria 2147
118 Ga0157380_10154008 3300014326 Unclassified 1990
119 Ga0157377_11377031 3300014745 Unclassified 555
120 Ga0157379_10004162 3300014968 Bacteria 12350
121 Ga0157379_10121155 3300014968 Bacteria 2353
122 Ga0157379_11117316 3300014968 Unclassified 755
123 Ga0157376_10177867 3300014969 Bacteria 1942
124 Ga0207710_10125136 3300025900 Bacteria 1231
125 Ga0207680_10114898 3300025903 Bacteria 1752
126 Ga0207699_10068039 3300025906 Bacteria 2167
127 Ga0207645_10002395 3300025907 Bacteria 14760
128 Ga0207681_10100363 3300025923 Bacteria 2086
129 Ga0207681_10309657 3300025923 Bacteria 1252
130 Ga0207659_10001555 3300025926 Bacteria 13627
131 Ga0207659_10031876 3300025926 Bacteria 3612
132 Ga0207700_10229512 3300025928 Bacteria 1577
133 Ga0207644_10024006 3300025931 Bacteria 4182
134 Ga0207706_10142552 3300025933 Unclassified 2108
135 Ga0207706_10509241 3300025933 Bacteria 1039
136 Ga0207706_10683315 3300025933 Bacteria 878
137 Ga0207670_10276656 3300025936 Bacteria 1307
138 Ga0207670_10611405 3300025936 Unclassified 896
139 Ga0207704_10022937 3300025938 Unclassified 3355
140 Ga0207691_10006293 3300025940 Bacteria 11464
141 Ga0207691_10013388 3300025940 Bacteria 7852
142 Ga0207691_10124325 3300025940 Bacteria 2284
143 Ga0207711_10004332 3300025941 Bacteria 12120
144 Ga0207711_10458236 3300025941 Bacteria 1187
145 Ga0207689_10349672 3300025942 Bacteria 1229
146 Ga0207679_10098663 3300025945 Bacteria 2279
147 Ga0207679_10915844 3300025945 Bacteria 802
148 Ga0207651_10005556 3300025960 Bacteria 6490
149 Ga0207651_10218764 3300025960 Bacteria 1538
150 Ga0207651_10893051 3300025960 Bacteria 791
151 Ga0207658_10013662 3300025986 Bacteria 5555
152 Ga0207703_10031655 3300026035 Bacteria 4184
153 Ga0207703_10037136 3300026035 Bacteria 3880
154 Ga0207703_10347322 3300026035 Bacteria 1365
155 Ga0207639_10943072 3300026041 Bacteria 807
156 Ga0207678_10520907 3300026067 Bacteria 1038
157 Ga0207708_11058465 3300026075 Unclassified 706
158 Ga0207641_10002879 3300026088 Bacteria 15594
159 Ga0207641_10226045 3300026088 Bacteria 1738
160 Ga0207676_10033502 3300026095 Bacteria 3882
161 Ga0207675_100475928 3300026118 Unclassified 1241
162 Ga0209974_10209069 3300027876 Unclassified 723
163 Ga0209974_10226584 3300027876 Unclassified 697
164 Ga0207428_10035491 3300027907 Unclassified 4075
165 Ga0207428_10035956 3300027907 Bacteria 4044
166 Ga0268265_10039053 3300028380 Unclassified 3496
167 Ga0268264_10028348 3300028381 Bacteria 4580
168 Ga0268264_10356178 3300028381 Bacteria 1394
169 Ga0268264_10358234 3300028381 Bacteria 1391
170 Ga0268264_10787304 3300028381 Bacteria 949
171 Ga0307408_101224953 3300031548 Unclassified 701
172 Ga0307415_100150981 3300032126 Bacteria 1788
173 Ga0373923_0071450 3300035111 Bacteria 1491
174 Ga0373923_0440503 3300035111 Unclassified 631
175 Ga0373939_0077516 3300035114 Unclassified 1097
176 Ga0373933_0014679 3300035724 Bacteria 4361
177 Ga0373933_0961489 3300035724 Bacteria 563
178 Ga0373937_0048418 3300036401 Bacteria 3891
179 Ga0373937_0529644 3300036401 Bacteria 1119
180 Ga0439456_088511 3300042013 Bacteria 695
181 Ga0439435_0060777 3300042436 Bacteria 1100
182 Ga0439444_0041993 3300042437 Bacteria 902
183 Ga0439464_0044699 3300042439 Bacteria 1269
184 Ga0451577_0258859 3300042876 Bacteria 1576
185 Ga0439440_0087418 3300042993 Unclassified 832
186 Ga0495594_0063081 3300046499 Bacteria 2053
187 Ga0495630_0939420 3300046517 Bacteria 658
188 Ga0495642_0246763 3300046528 Bacteria 780
189 Ga0495586_0628592 3300046535 Unclassified 620
190 Ga0495659_0069851 3300046664 Bacteria 1314
191 Ga0495658_0598035 3300046683 Bacteria 707
192 Ga0495636_0015338 3300047318 Bacteria 3054
193 Ga0496106_0141657 3300048909 Bacteria 1892
194 Ga0496107_0287453 3300048910 Bacteria 1224
195 Ga0496110_0607640 3300048913 Bacteria 992
196 Ga0496112_0488931 3300048915 Unclassified 1167
197 Ga0501031_0189520 3300049568 Bacteria 1343
198 Ga0501031_0507103 3300049568 Unclassified 778
199 Ga0501032_0185986 3300049569 Bacteria 1359
200 Ga0501033_0121946 3300049570 Bacteria 1891
201 Ga0501036_0043467 3300049572 Bacteria 3805
202 Ga0501036_0094702 3300049572 Bacteria 2524
203 Ga0501036_1149939 3300049572 Unclassified 633
204 Ga0501037_0098765 3300049573 Bacteria 2109
205 Ga0501037_0369074 3300049573 Bacteria 988
206 Ga0501038_0048494 3300049574 Bacteria 3675
207 Ga0501039_0067152 3300049575 Unclassified 2785
208 Ga0501039_0159528 3300049575 Bacteria 1773
209 Ga0501039_0308289 3300049575 Bacteria 1244
210 Ga0501040_0008472 3300049576 Bacteria 6679
211 Ga0501040_0034586 3300049576 Unclassified 3423
212 Ga0501040_0054912 3300049576 Unclassified 2731
213 Ga0501040_0328401 3300049576 Unclassified 1094
214 Ga0501041_0087434 3300049577 Unclassified 1923
215 Ga0501041_0126497 3300049577 Unclassified 1591
216 Ga0501041_0133077 3300049577 Bacteria 1549
217 Ga0501042_0046818 3300049578 Bacteria 3083
218 Ga0501042_0155842 3300049578 Bacteria 1647
219 Ga0501042_0292444 3300049578 Unclassified 1177
220 Ga0501043_0161760 3300049579 Bacteria 1749
221 Ga0501043_0326364 3300049579 Bacteria 1169
222 Ga0501046_0390957 3300049580 Bacteria 1005
223 Ga0501048_0047347 3300049582 Unclassified 3068
224 Ga0501048_0047849 3300049582 Bacteria 3051
225 Ga0501068_0086314 3300049584 Bacteria 1932
226 Ga0501070_0156903 3300049586 Unclassified 1877
227 Ga0501071_0065443 3300049587 Bacteria 2639
228 Ga0501072_0004575 3300049588 Bacteria 10529
229 Ga0501072_0047867 3300049588 Bacteria 3367
230 Ga0501072_0233362 3300049588 Bacteria 1466
231 Ga0501072_0928758 3300049588 Bacteria 679
232 Ga0501073_0166613 3300049589 Bacteria 1526
233 Ga0501074_0025880 3300049590 Bacteria 4257
234 Ga0501075_0047883 3300049591 Bacteria 3212
235 Ga0501075_0060327 3300049591 Unclassified 2858
236 Ga0501075_0430889 3300049591 Bacteria 1006
237 Ga0501076_0032017 3300049592 Bacteria 4103
238 Ga0501076_0284584 3300049592 Unclassified 1354
239 Ga0501076_1350062 3300049592 Bacteria 586
240 Ga0501077_0006089 3300049593 Bacteria 7362
241 Ga0501077_0185879 3300049593 Bacteria 1320
242 Ga0501077_0355897 3300049593 Unclassified 934
243 Ga0501249_074138 3300049679 Unclassified 797
244 Ga0501225_0026084 3300049705 Unclassified 1608
245 Ga0501079_0042872 3300049741 Bacteria 3493
246 Ga0501079_1146438 3300049741 Unclassified 612
247 Ga0501080_0234123 3300049742 Bacteria 1678
248 Ga0501081_0061746 3300049743 Bacteria 2598
249 Ga0501283_002639 3300049779 Unclassified 2334
250 Ga0501035_0061391 3300049822 Bacteria 3345
251 Ga0501045_0057599 3300049824 Bacteria 2843
252 Ga0501045_0058564 3300049824 Bacteria 2821
253 Ga0501045_0114494 3300049824 Bacteria 2000
254 nmdc:mga05p37_108885_c1 3300050507 Unclassified 3408
255 nmdc:mga05p37_24077_c1 3300050507 Bacteria 7395
256 nmdc:mga05p37_242445_c1 3300050507 Bacteria 2166
257 nmdc:mga09592_27352_c1 3300050508 Bacteria 4732
258 nmdc:mga09592_60129_c1 3300050508 Bacteria 3212
259 nmdc:mga09592_6080_c1 3300050508 Bacteria 9838
260 nmdc:mga09592_74796_c1 3300050508 Unclassified 2879
261 nmdc:mga09592_93778_c1 3300050508 Unclassified 2567
262 nmdc:mga0qj67_4861_c1 3300050509 Bacteria 9772
263 nmdc:mga0qj67_79894_c1 3300050509 Bacteria 2620
264 nmdc:mga06r32_181190_c1 3300050510 Bacteria 2092
265 nmdc:mga06r32_261102_c1 3300050510 Unclassified 1720
266 nmdc:mga06r32_374033_c1 3300050510 Bacteria 1408
267 nmdc:mga06r32_3768_c1 3300050510 Bacteria 13559
268 nmdc:mga08y16_1015_c1 3300050511 Bacteria 27493
269 nmdc:mga08y16_1116297_c1 3300050511 Unclassified 763
270 nmdc:mga08y16_20516_c1 3300050511 Bacteria 6975
271 nmdc:mga08y16_301773_c1 3300050511 Bacteria 1651
272 nmdc:mga08y16_38098_c1 3300050511 Bacteria 5049
273 nmdc:mga08y16_621671_c1 3300050511 Bacteria 1087
274 nmdc:mga0n895_1280879_c1 3300050512 Unclassified 705
275 nmdc:mga08x19_109709_c1 3300050514 Bacteria 1840
276 nmdc:mga08x19_411253_c1 3300050514 Bacteria 950
277 nmdc:mga08x19_411991_c1 3300050514 Bacteria 949
278 Ga0495619_0211536 3300053085 Unclassified 1343
279 Ga0501084_0114706 3300054114 Unclassified 2265
280 Ga0501084_0648299 3300054114 Bacteria 892
281 Ga0501082_0083686 3300060353 Unclassified 2752
282 Ga0501082_0105022 3300060353 Unclassified 2444
283 Ga0530510_0007503 3300061734 Bacteria 7597
284 Ga0530510_0045382 3300061734 Unclassified 3175
285 Ga0530510_0153778 3300061734 Bacteria 1699
286 Ga0530510_0301694 3300061734 Unclassified 1198
287 Ga0530510_0516294 3300061734 Bacteria 906
288 Ga0075428_100823632
289 Ga0065712_10164303
290 Ga0065715_10145257
291 Ga0065715_10228833
292 Ga0065707_10004900
293 Ga0070676_10361744
294 Ga0070670_100621504
295 Ga0068869_100133841
296 Ga0068869_100649828
297 Ga0068868_101259981
298 Ga0068868_101268192
299 Ga0070689_100009291
300 Ga0070692_10254353
301 Ga0070668_100543070
302 Ga0070669_100179072
303 Ga0070669_100449533
304 Ga0070669_100495100
305 Ga0070669_100614272
306 Ga0070675_100002853
307 Ga0070675_100020011
308 Ga0070671_100135173
309 Ga0070674_100329316
310 Ga0070673_100004551
311 Ga0070673_100135857
312 Ga0070673_101407691
313 Ga0070688_100018578
314 Ga0070667_100020179
315 Ga0070709_10084621
316 Ga0070713_100232866
317 Ga0070701_10032577
318 Ga0070701_10384197
319 Ga0070711_100142257
320 Ga0070700_100078490
321 Ga0070700_100319011
322 Ga0070694_100376442
323 Ga0070678_100613807
324 Ga0070662_100155091
325 Ga0070662_100510734
326 Ga0070685_10011464
327 Ga0070685_10529501
328 Ga0070698_100131899
329 Ga0070699_101441472
330 Ga0068853_100978384
331 Ga0070672_100042540
332 Ga0070672_100085534
333 Ga0070672_100325968
334 Ga0070686_100001035
335 Ga0070686_100533354
336 Ga0070665_101932641
337 Ga0070704_101375314
338 Ga0070664_100024303
339 Ga0070664_100520450
340 Ga0068856_100543127
341 Ga0068864_100025186
342 Ga0068861_100520472
343 Ga0068870_10456898
344 Ga0068870_10517774
345 Ga0068863_100000876
346 Ga0068863_100221899
347 Ga0068863_101060331
348 Ga0068858_100015266
349 Ga0068858_100114747
350 Ga0068858_100397471
351 Ga0068860_100030798
352 Ga0068860_100115797
353 Ga0068860_100281804
354 Ga0068862_100420136
355 Ga0081455_10571222
356 Ga0068871_100262237
357 Ga0075428_100006226
358 Ga0075428_100090725
359 Ga0075428_100119748
360 Ga0075428_100233153
361 Ga0075430_100001337
362 Ga0075430_100009425
363 Ga0075430_100021745
364 Ga0075431_100005990
365 Ga0075431_100048076
366 Ga0075431_100077763
367 Ga0075431_100256555
368 Ga0075431_100607355
369 Ga0075433_10053855
370 Ga0075433_10330816
371 Ga0075429_100007945
372 Ga0075429_100067597
373 Ga0075429_100067691
374 Ga0075429_100770901
375 Ga0068865_100002973
376 Ga0105240_10068089
377 Ga0111539_10025360
378 Ga0111539_10156343
379 Ga0111539_10753732
380 Ga0105247_10017074
381 Ga0105247_10555158
382 Ga0114129_10012039
383 Ga0114129_10190288
384 Ga0114129_10239094
385 Ga0114129_10276204
386 Ga0114129_10467434
387 Ga0114129_10518173
388 Ga0105243_11202346
389 Ga0105248_10000888
390 Ga0105248_10086487
391 Ga0105248_10218134
392 Ga0105237_10147712
393 Ga0105246_12175096
394 Ga0157378_10044543
395 Ga0157378_10257695
396 Ga0157378_11004841
397 Ga0163162_10010216
398 Ga0163162_10011419
399 Ga0163162_12618837
400 Ga0157375_10001072
401 Ga0157375_10050512
402 Ga0157375_10576256
403 Ga0163163_10072246
404 Ga0157380_10129889
405 Ga0157380_10154008
406 Ga0157377_11377031
407 Ga0157379_10004162
408 Ga0157379_10121155
409 Ga0157379_11117316
410 Ga0157376_10177867
411 Ga0207710_10125136
412 Ga0207680_10114898
413 Ga0207699_10068039
414 Ga0207645_10002395
415 Ga0207681_10100363
416 Ga0207681_10309657
417 Ga0207659_10001555
418 Ga0207659_10031876
419 Ga0207700_10229512
420 Ga0207644_10024006
421 Ga0207706_10142552
422 Ga0207706_10509241
423 Ga0207706_10683315
424 Ga0207670_10276656
425 Ga0207670_10611405
426 Ga0207704_10022937
427 Ga0207691_10006293
428 Ga0207691_10013388
429 Ga0207691_10124325
430 Ga0207711_10004332
431 Ga0207711_10458236
432 Ga0207689_10349672
433 Ga0207679_10098663
434 Ga0207679_10915844
435 Ga0207651_10005556
436 Ga0207651_10218764
437 Ga0207651_10893051
438 Ga0207658_10013662
439 Ga0207703_10031655
440 Ga0207703_10037136
441 Ga0207703_10347322
442 Ga0207639_10943072
443 Ga0207678_10520907
444 Ga0207708_11058465
445 Ga0207641_10002879
446 Ga0207641_10226045
447 Ga0207676_10033502
448 Ga0207675_100475928
449 Ga0209974_10209069
450 Ga0209974_10226584
451 Ga0207428_10035491
452 Ga0207428_10035956
453 Ga0268265_10039053
454 Ga0268264_10028348
455 Ga0268264_10356178
456 Ga0268264_10358234
457 Ga0268264_10787304
458 Ga0307408_101224953
459 Ga0307415_100150981
460 Ga0373923_0071450
461 Ga0373923_0440503
462 Ga0373939_0077516
463 Ga0373933_0014679
464 Ga0373933_0961489
465 Ga0373937_0048418
466 Ga0373937_0529644
467 Ga0439456_088511
468 Ga0439435_0060777
469 Ga0439444_0041993
470 Ga0439464_0044699
471 Ga0451577_0258859
472 Ga0439440_0087418
473 Ga0495594_0063081
474 Ga0495630_0939420
475 Ga0495642_0246763
476 Ga0495586_0628592
477 Ga0495659_0069851
478 Ga0495658_0598035
479 Ga0495636_0015338
480 Ga0496106_0141657
481 Ga0496107_0287453
482 Ga0496110_0607640
483 Ga0496112_0488931
484 Ga0501031_0189520
485 Ga0501031_0507103
486 Ga0501032_0185986
487 Ga0501033_0121946
488 Ga0501036_0043467
489 Ga0501036_0094702
490 Ga0501036_1149939
491 Ga0501037_0098765
492 Ga0501037_0369074
493 Ga0501038_0048494
494 Ga0501039_0067152
495 Ga0501039_0159528
496 Ga0501039_0308289
497 Ga0501040_0008472
498 Ga0501040_0034586
499 Ga0501040_0054912
500 Ga0501040_0328401
501 Ga0501041_0087434
502 Ga0501041_0126497
503 Ga0501041_0133077
504 Ga0501042_0046818
505 Ga0501042_0155842
506 Ga0501042_0292444
507 Ga0501043_0161760
508 Ga0501043_0326364
509 Ga0501046_0390957
510 Ga0501048_0047347
511 Ga0501048_0047849
512 Ga0501068_0086314
513 Ga0501070_0156903
514 Ga0501071_0065443
515 Ga0501072_0004575
516 Ga0501072_0047867
517 Ga0501072_0233362
518 Ga0501072_0928758
519 Ga0501073_0166613
520 Ga0501074_0025880
521 Ga0501075_0047883
522 Ga0501075_0060327
523 Ga0501075_0430889
524 Ga0501076_0032017
525 Ga0501076_0284584
526 Ga0501076_1350062
527 Ga0501077_0006089
528 Ga0501077_0185879
529 Ga0501077_0355897
530 Ga0501249_074138
531 Ga0501225_0026084
532 Ga0501079_0042872
533 Ga0501079_1146438
534 Ga0501080_0234123
535 Ga0501081_0061746
536 Ga0501283_002639
537 Ga0501035_0061391
538 Ga0501045_0057599
539 Ga0501045_0058564
540 Ga0501045_0114494
541 nmdc:mga05p37_108885_c1
542 nmdc:mga05p37_24077_c1
543 nmdc:mga05p37_242445_c1
544 nmdc:mga09592_27352_c1
545 nmdc:mga09592_60129_c1
546 nmdc:mga09592_6080_c1
547 nmdc:mga09592_74796_c1
548 nmdc:mga09592_93778_c1
549 nmdc:mga0qj67_4861_c1
550 nmdc:mga0qj67_79894_c1
551 nmdc:mga06r32_181190_c1
552 nmdc:mga06r32_261102_c1
553 nmdc:mga06r32_374033_c1
554 nmdc:mga06r32_3768_c1
555 nmdc:mga08y16_1015_c1
556 nmdc:mga08y16_1116297_c1
557 nmdc:mga08y16_20516_c1
558 nmdc:mga08y16_301773_c1
559 nmdc:mga08y16_38098_c1
560 nmdc:mga08y16_621671_c1
561 nmdc:mga0n895_1280879_c1
562 nmdc:mga08x19_109709_c1
563 nmdc:mga08x19_411253_c1
564 nmdc:mga08x19_411991_c1
565 Ga0495619_0211536
566 Ga0501084_0114706
567 Ga0501084_0648299
568 Ga0501082_0083686
569 Ga0501082_0105022
570 Ga0530510_0007503
571 Ga0530510_0045382
572 Ga0530510_0153778
573 Ga0530510_0301694
574 Ga0530510_0516294

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13380

CoA_binding_2

CoA binding domain

17

140

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d5a-assembly1.cif.gz_A hypothetical protein from pyrococcus horikoshii ot3 0.9297 8 138
1y81-assembly1.cif.gz_A conserved hypothetical protein pfu-723267-001 from pyrococcus furiosus 0.9033 20 135
3q9n-assembly2.cif.gz_B in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.8946 8 133
3q9n-assembly1.cif.gz_A in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.8907 8 133
3q9u-assembly1.cif.gz_A in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.8881 8 136
ID Description Score Start End Superfamily
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9033 20 135 3.40.50.720
3q9nB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8946 8 133 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8553 8 136 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.845 20 135 3.40.50.720
2csuB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8158 20 135 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7V4HC14-F1-model_v4 CoA-binding protein 0.9643 8 159
AF-A0A849M667-F1-model_v4 CoA-binding protein 0.9639 10 160
AF-A0A2E9FW92-F1-model_v4 deleted 0.963 11 159
AF-A0A2E0ZE19-F1-model_v4 CoA-binding protein 0.961 11 162
AF-A0A1G0PHE0-F1-model_v4 CoA-binding domain-containing protein 0.9594 10 163

Map