F387955

General Info

Members Datasets Scaffolds Average Seq Length
287 152 574 255

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100028124|Ga0075428_1000281243
Length 280
Sequence MLPRTSLRGAASVASSVASRERYSRAMNIAWKALTDVGRKRKGNEDSLVANAEQKLFVVADGMGGHAAGEVASKVAVDSINEFVQLTGGDEEITWPFGLDDSMSYDGNRLKTAVRFANRKVLDATKEKTEYEGMATTVAAVLVDEQTANLAHVGDSRIYLFRAGELSQLTSDHSWVNEQLQSGIISPEQARTHPLRNVVTRALGGRADLQVDMAAHDLKVEDMLLLCSDGLTTMVPDEHIARLLNDNDGDIEKGAEALVAEANARGGEDNITVVLLRFKG

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
104 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
105 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
106 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
107 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
110 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
113 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
114 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
128 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
137 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
138 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
139 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
140 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
141 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.27
Nodule 0
Rhizoplane 0.7
Rhizosphere 91.99
Stem 0
Stem Tuber 0
Unclassified 6.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100028124 3300006844 Bacteria 6219
2 Ga0065707_10089450 3300005295 Bacteria 4365
3 Ga0070676_10011923 3300005328 Bacteria 4737
4 Ga0070676_10333384 3300005328 Bacteria 1038
5 Ga0068869_100030984 3300005334 Bacteria 3760
6 Ga0068869_100051572 3300005334 Bacteria 2985
7 Ga0070689_100004702 3300005340 Bacteria 9259
8 Ga0070689_100069272 3300005340 Bacteria 2752
9 Ga0070687_100252635 3300005343 Bacteria 1096
10 Ga0070661_100228670 3300005344 Bacteria 1429
11 Ga0070668_100097354 3300005347 Bacteria 2327
12 Ga0070669_100088477 3300005353 Bacteria 2318
13 Ga0070674_100019443 3300005356 Bacteria 4314
14 Ga0070673_100039488 3300005364 Bacteria 3613
15 Ga0070673_100121601 3300005364 Bacteria 2179
16 Ga0070688_100084776 3300005365 Bacteria 2058
17 Ga0070667_100132705 3300005367 Bacteria 2175
18 Ga0070701_10031447 3300005438 Bacteria 2633
19 Ga0070705_100003624 3300005440 Bacteria 7559
20 Ga0070705_100095529 3300005440 Bacteria 1864
21 Ga0070705_100232334 3300005440 Bacteria 1284
22 Ga0070700_100020463 3300005441 Bacteria 3833
23 Ga0070694_100017013 3300005444 Unclassified 4588
24 Ga0070694_100023578 3300005444 Bacteria 3961
25 Ga0070694_100295021 3300005444 Bacteria 1241
26 Ga0070694_100336976 3300005444 Bacteria 1165
27 Ga0070708_100029613 3300005445 Bacteria 4722
28 Ga0070708_100398903 3300005445 Unclassified 1297
29 Ga0070663_100309552 3300005455 Bacteria 1267
30 Ga0068867_100003598 3300005459 Bacteria 10903
31 Ga0070685_10032112 3300005466 Bacteria 2939
32 Ga0070706_100016609 3300005467 Bacteria 6800
33 Ga0070706_100016840 3300005467 Bacteria 6750
34 Ga0070706_100119445 3300005467 Bacteria 2457
35 Ga0070706_100280375 3300005467 Bacteria 1555
36 Ga0070707_100042026 3300005468 Bacteria 4376
37 Ga0070698_100022812 3300005471 Bacteria 6544
38 Ga0070698_100051532 3300005471 Bacteria 4192
39 Ga0070698_100052127 3300005471 Unclassified 4164
40 Ga0070698_100107318 3300005471 Unclassified 2760
41 Ga0070698_100239301 3300005471 Unclassified 1748
42 Ga0070699_100000007 3300005518 Bacteria 310847
43 Ga0070699_100012412 3300005518 Bacteria 7350
44 Ga0070699_100085081 3300005518 Bacteria 2760
45 Ga0070699_100162844 3300005518 Bacteria 1975
46 Ga0070672_100033684 3300005543 Bacteria 3881
47 Ga0070686_100010585 3300005544 Bacteria 5206
48 Ga0070695_100080603 3300005545 Unclassified 2152
49 Ga0070696_100111993 3300005546 Bacteria 1966
50 Ga0070704_100012698 3300005549 Bacteria 5211
51 Ga0070704_100025192 3300005549 Bacteria 3914
52 Ga0070704_100108875 3300005549 Bacteria 2104
53 Ga0068857_100192062 3300005577 Bacteria 1860
54 Ga0070702_100019022 3300005615 Bacteria 3573
55 Ga0068859_100012555 3300005617 Bacteria 8523
56 Ga0068859_100055942 3300005617 Bacteria 3970
57 Ga0068866_10041945 3300005718 Bacteria 2274
58 Ga0068861_100016235 3300005719 Bacteria 5264
59 Ga0068861_100043126 3300005719 Bacteria 3383
60 Ga0068863_100008889 3300005841 Bacteria 9809
61 Ga0068858_100011942 3300005842 Bacteria 8184
62 Ga0068860_100192803 3300005843 Bacteria 1972
63 Ga0068862_100060429 3300005844 Bacteria 3255
64 Ga0068862_100126609 3300005844 Bacteria 2256
65 Ga0075365_10218876 3300006038 Bacteria 1336
66 Ga0075365_10223764 3300006038 Bacteria 1320
67 Ga0075363_100020543 3300006048 Bacteria 3314
68 Ga0075362_10043437 3300006177 Unclassified 1990
69 Ga0075367_10016688 3300006178 Unclassified 4013
70 Ga0075367_10060719 3300006178 Bacteria 2255
71 Ga0075366_10001739 3300006195 Bacteria 10954
72 Ga0097621_100220798 3300006237 Bacteria 1651
73 Ga0068871_100490133 3300006358 Bacteria 1107
74 Ga0075428_100001539 3300006844 Bacteria 24689
75 Ga0075428_100032246 3300006844 Bacteria 5786
76 Ga0075428_100085049 3300006844 Bacteria 3450
77 Ga0075428_100281267 3300006844 Bacteria 1790
78 Ga0075428_100403991 3300006844 Bacteria 1464
79 Ga0075430_100040184 3300006846 Bacteria 3960
80 Ga0075430_100441100 3300006846 Bacteria 1075
81 Ga0075431_100010049 3300006847 Bacteria 9506
82 Ga0075431_100026695 3300006847 Bacteria 5923
83 Ga0075431_100367819 3300006847 Bacteria 1443
84 Ga0075431_100454014 3300006847 Bacteria 1277
85 Ga0075431_100475895 3300006847 Unclassified 1242
86 Ga0075431_100532767 3300006847 Bacteria 1163
87 Ga0075433_10002940 3300006852 Bacteria 13073
88 Ga0075433_10042701 3300006852 Bacteria 3935
89 Ga0075433_10104017 3300006852 Bacteria 2516
90 Ga0075433_10176850 3300006852 Unclassified 1899
91 Ga0075433_10231871 3300006852 Bacteria 1639
92 Ga0075433_10265326 3300006852 Bacteria 1522
93 Ga0075434_100023565 3300006871 Bacteria 6001
94 Ga0075434_100035538 3300006871 Unclassified 4926
95 Ga0075434_100132909 3300006871 Bacteria 2508
96 Ga0075434_100273367 3300006871 Bacteria 1709
97 Ga0075429_100000604 3300006880 Bacteria 27577
98 Ga0075429_100010110 3300006880 Bacteria 8175
99 Ga0075429_100031534 3300006880 Bacteria 4607
100 Ga0075429_100052676 3300006880 Bacteria 3541
101 Ga0075436_100169017 3300006914 Bacteria 1544
102 Ga0097620_100012555 3300006931 Bacteria 8523
103 Ga0097620_100055937 3300006931 Bacteria 3970
104 Ga0075435_100081710 3300007076 Bacteria 2655
105 Ga0075435_100095107 3300007076 Unclassified 2464
106 Ga0111539_10000218 3300009094 Bacteria 68900
107 Ga0111539_10030265 3300009094 Bacteria 6582
108 Ga0111539_10034330 3300009094 Bacteria 6152
109 Ga0111539_10466309 3300009094 Bacteria 1471
110 Ga0111539_10537594 3300009094 Bacteria 1361
111 Ga0105245_10008573 3300009098 Bacteria 8915
112 Ga0114129_10002655 3300009147 Bacteria 24885
113 Ga0114129_10018330 3300009147 Bacteria 9972
114 Ga0114129_10030426 3300009147 Bacteria 7639
115 Ga0114129_10043319 3300009147 Bacteria 6332
116 Ga0114129_10055838 3300009147 Bacteria 5534
117 Ga0114129_10130400 3300009147 Bacteria 3453
118 Ga0114129_10140884 3300009147 Bacteria 3306
119 Ga0114129_10244614 3300009147 Bacteria 2411
120 Ga0114129_10533146 3300009147 Bacteria 1529
121 Ga0105243_10412756 3300009148 Bacteria 1257
122 Ga0105241_10137602 3300009174 Bacteria 1985
123 Ga0105242_10004593 3300009176 Bacteria 10704
124 Ga0105248_10067565 3300009177 Bacteria 4014
125 Ga0105248_10095577 3300009177 Bacteria 3345
126 Ga0105246_10089469 3300011119 Bacteria 2215
127 Ga0157375_10021120 3300013308 Bacteria 5963
128 Ga0157375_10837553 3300013308 Bacteria 1067
129 Ga0157380_10002189 3300014326 Bacteria 13133
130 Ga0157380_10104561 3300014326 Bacteria 2365
131 Ga0157379_10134936 3300014968 Bacteria 2223
132 Ga0163161_10498880 3300017792 Bacteria 991
133 Ga0213876_10074755 3300021384 Bacteria 1790
134 Ga0207653_10010710 3300025885 Bacteria 2861
135 Ga0207653_10060495 3300025885 Bacteria 1276
136 Ga0207642_10027310 3300025899 Bacteria 2334
137 Ga0207645_10060933 3300025907 Bacteria 2410
138 Ga0207645_10242640 3300025907 Bacteria 1190
139 Ga0207643_10107686 3300025908 Bacteria 1639
140 Ga0207684_10004119 3300025910 Bacteria 13841
141 Ga0207684_10018267 3300025910 Bacteria 6003
142 Ga0207684_10032843 3300025910 Bacteria 4413
143 Ga0207684_10142631 3300025910 Bacteria 2060
144 Ga0207660_10073363 3300025917 Bacteria 2495
145 Ga0207649_10215809 3300025920 Bacteria 1364
146 Ga0207646_10035010 3300025922 Bacteria 4538
147 Ga0207646_10054352 3300025922 Bacteria 3582
148 Ga0207681_10180906 3300025923 Bacteria 1606
149 Ga0207681_10209623 3300025923 Bacteria 1501
150 Ga0207650_10175551 3300025925 Bacteria 1705
151 Ga0207644_10158056 3300025931 Bacteria 1760
152 Ga0207706_10297910 3300025933 Bacteria 1405
153 Ga0207686_10014353 3300025934 Bacteria 4407
154 Ga0207670_10009529 3300025936 Bacteria 5545
155 Ga0207670_10057947 3300025936 Bacteria 2629
156 Ga0207669_10017660 3300025937 Bacteria 3666
157 Ga0207704_10084996 3300025938 Bacteria 2058
158 Ga0207691_10074144 3300025940 Bacteria 3069
159 Ga0207711_10038037 3300025941 Bacteria 4091
160 Ga0207689_10006825 3300025942 Bacteria 10038
161 Ga0207689_10007126 3300025942 Bacteria 9832
162 Ga0207679_10510550 3300025945 Bacteria 1074
163 Ga0207651_10141840 3300025960 Bacteria 1857
164 Ga0207651_10152610 3300025960 Bacteria 1800
165 Ga0207668_10049310 3300025972 Bacteria 2894
166 Ga0207658_10055259 3300025986 Bacteria 2942
167 Ga0207677_10022107 3300026023 Bacteria 3901
168 Ga0207703_10234045 3300026035 Bacteria 1648
169 Ga0207678_10020210 3300026067 Bacteria 5846
170 Ga0207708_10022266 3300026075 Bacteria 4785
171 Ga0207708_10085634 3300026075 Bacteria 2424
172 Ga0207708_10479054 3300026075 Bacteria 1040
173 Ga0207708_10492483 3300026075 Bacteria 1026
174 Ga0207641_10006518 3300026088 Bacteria 9823
175 Ga0207648_10002153 3300026089 Bacteria 21414
176 Ga0207674_10057897 3300026116 Bacteria 3928
177 Ga0207675_100012444 3300026118 Bacteria 7951
178 Ga0207675_100023782 3300026118 Bacteria 5701
179 Ga0207683_10005242 3300026121 Bacteria 11129
180 Ga0209813_10009192 3300027866 Bacteria 2519
181 Ga0207428_10000032 3300027907 Bacteria 232162
182 Ga0207428_10011818 3300027907 Bacteria 7695
183 Ga0268265_10112907 3300028380 Bacteria 2222
184 Ga0268265_10231409 3300028380 Bacteria 1624
185 Ga0316576_10000768 3300031727 Bacteria 16007
186 Ga0316576_10001526 3300031727 Bacteria 12537
187 Ga0316576_10007945 3300031727 Bacteria 6718
188 Ga0316576_10096637 3300031727 Bacteria 2205
189 Ga0316578_10027837 3300031728 Bacteria 3197
190 Ga0316578_10086339 3300031728 Bacteria 1871
191 Ga0316577_10010947 3300031733 Bacteria 4908
192 Ga0316577_10013515 3300031733 Bacteria 4465
193 Ga0316577_10038025 3300031733 Bacteria 2691
194 Ga0316583_10048534 3300032133 Bacteria 1495
195 Ga0316574_0089081 3300035398 Bacteria 1966
196 Ga0373931_0355815 3300035691 Bacteria 918
197 Ga0316582_0025573 3300036647 Bacteria 3546
198 Ga0316582_0143850 3300036647 Bacteria 1609
199 Ga0316584_0000394 3300036712 Bacteria 22706
200 Ga0316584_0170636 3300036712 Unclassified 1614
201 Ga0316584_0182304 3300036712 Bacteria 1554
202 Ga0436365_1936245 3300039437 Bacteria 2038
203 Ga0451807_0207311 3300041486 Bacteria 3318
204 Ga0451807_1571637 3300041486 Bacteria 1132
205 Ga0451853_1844337 3300041512 Bacteria 23540
206 Ga0453683_0030916 3300044673 Unclassified 3384
207 Ga0453684_0004322 3300044712 Bacteria 30230
208 Ga0453684_0215602 3300044712 Bacteria 2227
209 Ga0451576_0331979 3300045051 Unclassified 1591
210 Ga0495638_0013092 3300046460 Bacteria 5662
211 Ga0495644_0104267 3300046523 Bacteria 1074
212 Ga0495672_0002050 3300047320 Bacteria 18931
213 Ga0501033_0414070 3300049570 Bacteria 939
214 Ga0501039_0492822 3300049575 Bacteria 962
215 Ga0501040_0275673 3300049576 Bacteria 1201
216 Ga0501041_0206240 3300049577 Bacteria 1233
217 Ga0501042_0024348 3300049578 Bacteria 4245
218 Ga0501046_0248843 3300049580 Bacteria 1309
219 Ga0501048_0141604 3300049582 Bacteria 1700
220 Ga0501067_0072108 3300049583 Bacteria 1913
221 Ga0501071_0002627 3300049587 Bacteria 10991
222 Ga0501071_0154797 3300049587 Bacteria 1711
223 Ga0501072_0186612 3300049588 Bacteria 1654
224 Ga0501072_0412696 3300049588 Bacteria 1071
225 Ga0501074_0145029 3300049590 Bacteria 1698
226 Ga0501075_0139346 3300049591 Bacteria 1848
227 Ga0501079_0200148 3300049741 Bacteria 1560
228 Ga0501079_0324607 3300049741 Bacteria 1205
229 Ga0501080_0181377 3300049742 Bacteria 1937
230 Ga0501080_0601409 3300049742 Bacteria 976
231 Ga0501081_0036315 3300049743 Bacteria 3360
232 Ga0501081_0186947 3300049743 Bacteria 1499
233 Ga0501081_0368818 3300049743 Bacteria 1060
234 Ga0501045_0431116 3300049824 Bacteria 980
235 nmdc:mga03683_52667_c1 3300050489 Unclassified 1702
236 nmdc:mga00v17_112512_c1 3300050491 Unclassified 1728
237 nmdc:mga0yw44_210620_c1 3300050492 Bacteria 1286
238 nmdc:mga0k408_131239_c1 3300050493 Bacteria 1487
239 nmdc:mga0k408_6875_c1 3300050493 Bacteria 6070
240 nmdc:mga06z11_125997_c1 3300050494 Bacteria 1433
241 nmdc:mga06z11_84075_c1 3300050494 Bacteria 1714
242 nmdc:mga06z11_9944_c1 3300050494 Unclassified 4031
243 nmdc:mga04h51_101327_c1 3300050495 Bacteria 1050
244 nmdc:mga04h51_16501_c1 3300050495 Bacteria 2144
245 nmdc:mga05p37_127146_c1 3300050507 Bacteria 3129
246 nmdc:mga05p37_1453_c1 3300050507 Bacteria 27550
247 nmdc:mga05p37_254709_c1 3300050507 Bacteria 2104
248 nmdc:mga05p37_306910_c1 3300050507 Bacteria 1883
249 nmdc:mga05p37_318543_c1 3300050507 Bacteria 1841
250 nmdc:mga05p37_409015_c1 3300050507 Bacteria 1582
251 nmdc:mga05p37_430865_c1 3300050507 Bacteria 1532
252 nmdc:mga05p37_5515_c1 3300050507 Bacteria 14857
253 nmdc:mga05p37_594197_c1 3300050507 Bacteria 1251
254 nmdc:mga09592_148870_c1 3300050508 Bacteria 2019
255 nmdc:mga09592_212377_c1 3300050508 Bacteria 1677
256 nmdc:mga09592_294387_c1 3300050508 Bacteria 1407
257 nmdc:mga09592_4399_c1 3300050508 Bacteria 11399
258 nmdc:mga09592_55255_c1 3300050508 Bacteria 3355
259 nmdc:mga0qj67_8513_c1 3300050509 Bacteria 7612
260 nmdc:mga06r32_249537_c1 3300050510 Bacteria 1762
261 nmdc:mga06r32_43241_c1 3300050510 Bacteria 4286
262 nmdc:mga06r32_52936_c1 3300050510 Bacteria 3888
263 nmdc:mga06r32_556605_c1 3300050510 Bacteria 1120
264 nmdc:mga06r32_57051_c1 3300050510 Bacteria 3751
265 nmdc:mga06r32_8205_c1 3300050510 Bacteria 9400
266 nmdc:mga08y16_1057_c1 3300050511 Bacteria 27094
267 nmdc:mga08y16_182455_c1 3300050511 Bacteria 2179
268 nmdc:mga08y16_20635_c1 3300050511 Bacteria 6953
269 nmdc:mga08y16_8135_c1 3300050511 Bacteria 10971
270 nmdc:mga0n895_303634_c1 3300050512 Bacteria 1618
271 nmdc:mga0n895_327668_c1 3300050512 Bacteria 1552
272 nmdc:mga0n895_44619_c1 3300050512 Bacteria 4323
273 nmdc:mga0rr50_69310_c1 3300050513 Bacteria 2684
274 nmdc:mga0a205_11091_c1 3300050515 Bacteria 8293
275 nmdc:mga0a205_114975_c1 3300050515 Bacteria 2589
276 nmdc:mga0a205_118116_c1 3300050515 Unclassified 1792
277 nmdc:mga0a205_19641_c1 3300050515 Bacteria 6374
278 nmdc:mga0a205_40654_c2 3300050515 Bacteria 3666
279 nmdc:mga0a205_675686_c1 3300050515 Bacteria 883
280 nmdc:mga0a205_96598_c1 3300050515 Bacteria 1695
281 Ga0501084_0067979 3300054114 Bacteria 2983
282 Ga0501084_0070489 3300054114 Bacteria 2927
283 Ga0501084_0104154 3300054114 Bacteria 2383
284 Ga0501082_0136558 3300060353 Bacteria 2128
285 Ga0501082_0146496 3300060353 Bacteria 2050
286 Ga0501082_0175320 3300060353 Bacteria 1864
287 Ga0530510_0068432 3300061734 Bacteria 2576
288 Ga0075428_100028124
289 Ga0065707_10089450
290 Ga0070676_10011923
291 Ga0070676_10333384
292 Ga0068869_100030984
293 Ga0068869_100051572
294 Ga0070689_100004702
295 Ga0070689_100069272
296 Ga0070687_100252635
297 Ga0070661_100228670
298 Ga0070668_100097354
299 Ga0070669_100088477
300 Ga0070674_100019443
301 Ga0070673_100039488
302 Ga0070673_100121601
303 Ga0070688_100084776
304 Ga0070667_100132705
305 Ga0070701_10031447
306 Ga0070705_100003624
307 Ga0070705_100095529
308 Ga0070705_100232334
309 Ga0070700_100020463
310 Ga0070694_100017013
311 Ga0070694_100023578
312 Ga0070694_100295021
313 Ga0070694_100336976
314 Ga0070708_100029613
315 Ga0070708_100398903
316 Ga0070663_100309552
317 Ga0068867_100003598
318 Ga0070685_10032112
319 Ga0070706_100016609
320 Ga0070706_100016840
321 Ga0070706_100119445
322 Ga0070706_100280375
323 Ga0070707_100042026
324 Ga0070698_100022812
325 Ga0070698_100051532
326 Ga0070698_100052127
327 Ga0070698_100107318
328 Ga0070698_100239301
329 Ga0070699_100000007
330 Ga0070699_100012412
331 Ga0070699_100085081
332 Ga0070699_100162844
333 Ga0070672_100033684
334 Ga0070686_100010585
335 Ga0070695_100080603
336 Ga0070696_100111993
337 Ga0070704_100012698
338 Ga0070704_100025192
339 Ga0070704_100108875
340 Ga0068857_100192062
341 Ga0070702_100019022
342 Ga0068859_100012555
343 Ga0068859_100055942
344 Ga0068866_10041945
345 Ga0068861_100016235
346 Ga0068861_100043126
347 Ga0068863_100008889
348 Ga0068858_100011942
349 Ga0068860_100192803
350 Ga0068862_100060429
351 Ga0068862_100126609
352 Ga0075365_10218876
353 Ga0075365_10223764
354 Ga0075363_100020543
355 Ga0075362_10043437
356 Ga0075367_10016688
357 Ga0075367_10060719
358 Ga0075366_10001739
359 Ga0097621_100220798
360 Ga0068871_100490133
361 Ga0075428_100001539
362 Ga0075428_100032246
363 Ga0075428_100085049
364 Ga0075428_100281267
365 Ga0075428_100403991
366 Ga0075430_100040184
367 Ga0075430_100441100
368 Ga0075431_100010049
369 Ga0075431_100026695
370 Ga0075431_100367819
371 Ga0075431_100454014
372 Ga0075431_100475895
373 Ga0075431_100532767
374 Ga0075433_10002940
375 Ga0075433_10042701
376 Ga0075433_10104017
377 Ga0075433_10176850
378 Ga0075433_10231871
379 Ga0075433_10265326
380 Ga0075434_100023565
381 Ga0075434_100035538
382 Ga0075434_100132909
383 Ga0075434_100273367
384 Ga0075429_100000604
385 Ga0075429_100010110
386 Ga0075429_100031534
387 Ga0075429_100052676
388 Ga0075436_100169017
389 Ga0097620_100012555
390 Ga0097620_100055937
391 Ga0075435_100081710
392 Ga0075435_100095107
393 Ga0111539_10000218
394 Ga0111539_10030265
395 Ga0111539_10034330
396 Ga0111539_10466309
397 Ga0111539_10537594
398 Ga0105245_10008573
399 Ga0114129_10002655
400 Ga0114129_10018330
401 Ga0114129_10030426
402 Ga0114129_10043319
403 Ga0114129_10055838
404 Ga0114129_10130400
405 Ga0114129_10140884
406 Ga0114129_10244614
407 Ga0114129_10533146
408 Ga0105243_10412756
409 Ga0105241_10137602
410 Ga0105242_10004593
411 Ga0105248_10067565
412 Ga0105248_10095577
413 Ga0105246_10089469
414 Ga0157375_10021120
415 Ga0157375_10837553
416 Ga0157380_10002189
417 Ga0157380_10104561
418 Ga0157379_10134936
419 Ga0163161_10498880
420 Ga0213876_10074755
421 Ga0207653_10010710
422 Ga0207653_10060495
423 Ga0207642_10027310
424 Ga0207645_10060933
425 Ga0207645_10242640
426 Ga0207643_10107686
427 Ga0207684_10004119
428 Ga0207684_10018267
429 Ga0207684_10032843
430 Ga0207684_10142631
431 Ga0207660_10073363
432 Ga0207649_10215809
433 Ga0207646_10035010
434 Ga0207646_10054352
435 Ga0207681_10180906
436 Ga0207681_10209623
437 Ga0207650_10175551
438 Ga0207644_10158056
439 Ga0207706_10297910
440 Ga0207686_10014353
441 Ga0207670_10009529
442 Ga0207670_10057947
443 Ga0207669_10017660
444 Ga0207704_10084996
445 Ga0207691_10074144
446 Ga0207711_10038037
447 Ga0207689_10006825
448 Ga0207689_10007126
449 Ga0207679_10510550
450 Ga0207651_10141840
451 Ga0207651_10152610
452 Ga0207668_10049310
453 Ga0207658_10055259
454 Ga0207677_10022107
455 Ga0207703_10234045
456 Ga0207678_10020210
457 Ga0207708_10022266
458 Ga0207708_10085634
459 Ga0207708_10479054
460 Ga0207708_10492483
461 Ga0207641_10006518
462 Ga0207648_10002153
463 Ga0207674_10057897
464 Ga0207675_100012444
465 Ga0207675_100023782
466 Ga0207683_10005242
467 Ga0209813_10009192
468 Ga0207428_10000032
469 Ga0207428_10011818
470 Ga0268265_10112907
471 Ga0268265_10231409
472 Ga0316576_10000768
473 Ga0316576_10001526
474 Ga0316576_10007945
475 Ga0316576_10096637
476 Ga0316578_10027837
477 Ga0316578_10086339
478 Ga0316577_10010947
479 Ga0316577_10013515
480 Ga0316577_10038025
481 Ga0316583_10048534
482 Ga0316574_0089081
483 Ga0373931_0355815
484 Ga0316582_0025573
485 Ga0316582_0143850
486 Ga0316584_0000394
487 Ga0316584_0170636
488 Ga0316584_0182304
489 Ga0436365_1936245
490 Ga0451807_0207311
491 Ga0451807_1571637
492 Ga0451853_1844337
493 Ga0453683_0030916
494 Ga0453684_0004322
495 Ga0453684_0215602
496 Ga0451576_0331979
497 Ga0495638_0013092
498 Ga0495644_0104267
499 Ga0495672_0002050
500 Ga0501033_0414070
501 Ga0501039_0492822
502 Ga0501040_0275673
503 Ga0501041_0206240
504 Ga0501042_0024348
505 Ga0501046_0248843
506 Ga0501048_0141604
507 Ga0501067_0072108
508 Ga0501071_0002627
509 Ga0501071_0154797
510 Ga0501072_0186612
511 Ga0501072_0412696
512 Ga0501074_0145029
513 Ga0501075_0139346
514 Ga0501079_0200148
515 Ga0501079_0324607
516 Ga0501080_0181377
517 Ga0501080_0601409
518 Ga0501081_0036315
519 Ga0501081_0186947
520 Ga0501081_0368818
521 Ga0501045_0431116
522 nmdc:mga03683_52667_c1
523 nmdc:mga00v17_112512_c1
524 nmdc:mga0yw44_210620_c1
525 nmdc:mga0k408_131239_c1
526 nmdc:mga0k408_6875_c1
527 nmdc:mga06z11_125997_c1
528 nmdc:mga06z11_84075_c1
529 nmdc:mga06z11_9944_c1
530 nmdc:mga04h51_101327_c1
531 nmdc:mga04h51_16501_c1
532 nmdc:mga05p37_127146_c1
533 nmdc:mga05p37_1453_c1
534 nmdc:mga05p37_254709_c1
535 nmdc:mga05p37_306910_c1
536 nmdc:mga05p37_318543_c1
537 nmdc:mga05p37_409015_c1
538 nmdc:mga05p37_430865_c1
539 nmdc:mga05p37_5515_c1
540 nmdc:mga05p37_594197_c1
541 nmdc:mga09592_148870_c1
542 nmdc:mga09592_212377_c1
543 nmdc:mga09592_294387_c1
544 nmdc:mga09592_4399_c1
545 nmdc:mga09592_55255_c1
546 nmdc:mga0qj67_8513_c1
547 nmdc:mga06r32_249537_c1
548 nmdc:mga06r32_43241_c1
549 nmdc:mga06r32_52936_c1
550 nmdc:mga06r32_556605_c1
551 nmdc:mga06r32_57051_c1
552 nmdc:mga06r32_8205_c1
553 nmdc:mga08y16_1057_c1
554 nmdc:mga08y16_182455_c1
555 nmdc:mga08y16_20635_c1
556 nmdc:mga08y16_8135_c1
557 nmdc:mga0n895_303634_c1
558 nmdc:mga0n895_327668_c1
559 nmdc:mga0n895_44619_c1
560 nmdc:mga0rr50_69310_c1
561 nmdc:mga0a205_11091_c1
562 nmdc:mga0a205_114975_c1
563 nmdc:mga0a205_118116_c1
564 nmdc:mga0a205_19641_c1
565 nmdc:mga0a205_40654_c2
566 nmdc:mga0a205_675686_c1
567 nmdc:mga0a205_96598_c1
568 Ga0501084_0067979
569 Ga0501084_0070489
570 Ga0501084_0104154
571 Ga0501082_0136558
572 Ga0501082_0146496
573 Ga0501082_0175320
574 Ga0530510_0068432

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13672

PP2C_2

Protein phosphatase 2C

37

248

0.78

PF00481

PP2C

Protein phosphatase 2C

24

184

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xzv-assembly1.cif.gz_A the cyanobacterial pp2c-like phosphatase tppha requires three metals in the catalytic center for efficient catalysis 0.9448 4 252
2j86-assembly1.cif.gz_A structural analysis of the pp2c family phosphatase tppha of thermosynechococcus elongatus 0.9417 4 253
2y09-assembly1.cif.gz_A the cyanobacterial pp2c-like phosphatase tppha requires three metals in the catalytic center for efficient catalysis 0.9413 4 252
2j82-assembly1.cif.gz_A-2 structural analysis of the pp2c family phosphatase tppha from thermosynechococcus elongatus 0.9407 4 252
2j86-assembly2.cif.gz_B structural analysis of the pp2c family phosphatase tppha of thermosynechococcus elongatus 0.9402 4 253
ID Description Score Start End Superfamily
2cm1A00 Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain 0.926 3 251 3.60.40.10
5d2uA00 Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain 0.9246 4 253 3.60.40.10
5d2uA00 Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain 0.9171 4 253 3.60.40.10
2v06A00 Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain 0.9107 4 251 3.60.40.10
2pk0D00 Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain 0.9 3 252 3.60.40.10
ID Description Score Start End GO Terms
AF-A0A0K1PE80-F1-model_v4 Serine/threonine phosphatase PrpC 0.9836 1 252 GO:0004722
AF-A0A6V8P921-F1-model_v4 PPM family protein phosphatase 0.9786 8 212 GO:0004722
GO:0016539
AF-A0A7V6E8A9-F1-model_v4 Stp1/IreP family PP2C-type Ser/Thr phosphatase 0.9771 1 252 GO:0004722
AF-A0A7Z9GB59-F1-model_v4 Serine/threonine-protein phosphatase 0.9749 2 251 GO:0004722
AF-A0A3N5IJ57-F1-model_v4 Serine/threonine-protein phosphatase 0.9747 113 252

Map