F387840

General Info

Members Datasets Scaffolds Average Seq Length
287 200 230 326

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100128274|Ga0070660_1001282742
Length 356
Sequence MNTFKMLVITASMGMYSNGMAATNVKGTISFNSQIADKNVSVSERNKNYSKMDTLKSNQTIINLGGHQVPVLKGGLYDRFRSNPPLSVVEKEAPEIDLSWFKTIQKQKKEVGFTTYSPNFYYSNSSITAIYTADMTMLKKLIPAEVRDIVKPISITPGRGLVAITAYAYHYCDNDSYNELSISIVTTKPNSTNWGVFSLMKELKNKNLWGYVLKLPVDTELARVRGVVGYNLPKWLIPMKYSDQGEMMKFDFYDESGKMDFSMGGKKLAIGDVQPDIVRSNFINKDRNGQLTHGYTDVKAIKKASSKKKEDVQLNLTNGPLSMFIKSLDLGKLMRYDYQPEFQAALYTPELTERSK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231011 Pseudomonas sp. GM30 Isolate Nodule
3 2511231017 Pseudomonas sp. GM55 Isolate Nodule
4 2511231018 Pseudomonas sp. GM60 Isolate Nodule
5 2511231019 Pseudomonas sp. GM67 Isolate Nodule
6 2511231021 Pseudomonas sp. GM78 Isolate Nodule
7 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
8 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
9 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
10 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
11 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
12 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
13 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
14 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
15 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
16 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
17 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
18 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
19 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
20 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
21 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
22 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
23 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
24 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
25 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
26 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
27 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
28 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
29 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
30 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
31 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
32 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
33 2773857673 Pseudomonas sp. 443 Isolate Unclassified
34 2784132063 Pseudomonas sp. 424 Isolate Unclassified
35 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
36 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
37 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
38 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
39 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
40 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
41 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
42 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
43 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
44 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
45 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
46 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
47 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
48 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
49 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
50 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
51 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
52 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
53 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
54 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
55 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
56 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
57 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
58 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
59 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
60 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
61 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
62 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
63 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
64 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
65 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
66 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
67 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
68 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
69 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
70 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
71 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
72 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
73 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
74 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
75 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
76 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
77 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
78 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
79 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
80 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
81 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
102 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
112 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
113 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
115 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
116 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
139 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
140 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
141 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
142 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
143 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
144 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
145 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
146 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
147 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
148 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
149 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
150 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
151 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
152 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
153 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
154 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
158 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
180 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
192 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
193 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
194 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
195 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
196 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
197 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
198 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
199 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
200 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.14
Metatranscriptomes 0
Isolates 19.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.48
Nodule 2.79
Rhizoplane 9.76
Rhizosphere 42.16
Stem 0
Stem Tuber 0
Unclassified 18.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2934955 2162886007 Bacteria 17352
2 JGI25162J39368_1000030 3300002737 Bacteria 218717
3 JGI25154J39366_1004113 3300002738 Bacteria 2743
4 JGI25163J39215_1000059 3300002771 Bacteria 49468
5 JGI25164J39214_1000123 3300002772 Bacteria 74810
6 JGI25152J39213_1000078 3300002773 Bacteria 65830
7 JGI25150J39212_1000136 3300002774 Bacteria 41521
8 JGI25151J46595_10000896 3300003187 Bacteria 23451
9 JGI25151J46595_10003081 3300003187 Bacteria 9401
10 JGI25165J46597_1000056 3300003214 Bacteria 218721
11 JGI25153J46596_10005229 3300003215 Bacteria 6826
12 rootH1_10103052 3300003316 Bacteria 1597
13 rootL2_10009941 3300003322 Bacteria 21491
14 rootL2_10205496 3300003322 Bacteria 2446
15 Ga0055538_1000097 3300003751 Bacteria 72022
16 Ga0055539_1000143 3300003752 Bacteria 72022
17 Ga0055533_1000148 3300003756 Bacteria 72022
18 Ga0055532_1000135 3300003758 Bacteria 72223
19 Ga0055525_1000194 3300003759 Bacteria 72022
20 Ga0055526_1000031 3300003771 Bacteria 143136
21 Ga0055526_1000438 3300003771 Bacteria 33205
22 Ga0055526_1000840 3300003771 Bacteria 22974
23 Ga0055537_1007281 3300003773 Bacteria 2686
24 Ga0055537_1016182 3300003773 Bacteria 1274
25 Ga0055524_1000242 3300003775 Bacteria 57160
26 Ga0055524_1000521 3300003775 Bacteria 29596
27 Ga0055536_1000329 3300003781 Bacteria 34991
28 Ga0055536_1000389 3300003781 Bacteria 32004
29 Ga0055534_1000569 3300003784 Bacteria 19401
30 Ga0055534_1011011 3300003784 Bacteria 1859
31 Ga0055530_10000416 3300003791 Bacteria 37923
32 Ga0055530_10000563 3300003791 Bacteria 32037
33 Ga0055530_10000941 3300003791 Bacteria 23796
34 Ga0055530_10002817 3300003791 Bacteria 10679
35 Ga0055540_1000011 3300003792 Bacteria 282927
36 Ga0055540_1000369 3300003792 Bacteria 37923
37 Ga0055540_1000451 3300003792 Bacteria 32037
38 Ga0055531_10011492 3300003794 Bacteria 4260
39 Ga0055541_1000097 3300003841 Bacteria 72022
40 Ga0065165_1035552 3300005262 Bacteria 1529
41 Ga0065714_10107478 3300005288 Bacteria 1531
42 Ga0065704_10070316 3300005289 Bacteria 33673
43 Ga0065715_10145753 3300005293 Bacteria 1791
44 Ga0070660_100128274 3300005339 Bacteria 2028
45 Ga0070662_100262182 3300005457 Bacteria 1392
46 Ga0075432_10013084 3300006058 Bacteria 2820
47 Ga0075370_10000029 3300006353 Bacteria 48038
48 Ga0075436_100098362 3300006914 Bacteria 2036
49 Ga0099823_1000022 3300006944 Bacteria 75580
50 Ga0105251_10004224 3300009011 Bacteria 9930
51 Ga0105250_10000515 3300009092 Bacteria 27043
52 Ga0105250_10009870 3300009092 Bacteria 4007
53 Ga0105243_10000143 3300009148 Bacteria 81998
54 Ga0157371_10000198 3300013102 Bacteria 88364
55 Ga0157371_10008182 3300013102 Bacteria 8360
56 Ga0157370_10011870 3300013104 Bacteria 9087
57 Ga0157370_10024056 3300013104 Bacteria 6038
58 Ga0163162_10494105 3300013306 Bacteria 1354
59 Ga0157372_10002005 3300013307 Bacteria 22123
60 Ga0157375_10009201 3300013308 Bacteria 8660
61 Ga0182008_10000340 3300014497 Bacteria 36365
62 Ga0182008_10001507 3300014497 Bacteria 15547
63 Ga0182008_10005980 3300014497 Bacteria 6851
64 Ga0182006_1000006 3300015261 Bacteria 555811
65 Ga0182006_1000038 3300015261 Bacteria 212127
66 Ga0182006_1001781 3300015261 Bacteria 12438
67 Ga0182006_1007060 3300015261 Bacteria 5167
68 Ga0182007_10000107 3300015262 Bacteria 58957
69 Ga0182007_10007596 3300015262 Bacteria 4526
70 Ga0182005_1000001 3300015265 Bacteria 1014869
71 Ga0182005_1000585 3300015265 Bacteria 17936
72 Ga0183362_10013 3300015683 Bacteria 44128
73 Ga0163161_10002676 3300017792 Bacteria 12659
74 Ga0163161_10011963 3300017792 Bacteria 6020
75 Ga0213872_10000437 3300021361 Bacteria 34175
76 Ga0209435_100781 3300025206 Bacteria 5157
77 Ga0209760_100016 3300025207 Bacteria 173755
78 Ga0209784_100017 3300025224 Bacteria 472003
79 Ga0209566_100014 3300025225 Bacteria 472003
80 Ga0209674_100028 3300025226 Bacteria 472003
81 Ga0209147_100105 3300025229 Bacteria 157437
82 Ga0209563_100032 3300025230 Bacteria 472003
83 Ga0207427_100022 3300025231 Bacteria 469701
84 Ga0209437_100002 3300025233 Bacteria 1574801
85 Ga0209258_100558 3300025242 Bacteria 32759
86 Ga0207425_1000014 3300025245 Bacteria 481113
87 Ga0207425_1017153 3300025245 Bacteria 1596
88 Ga0209646_1000225 3300025246 Bacteria 60062
89 Ga0209677_100018 3300025253 Bacteria 472003
90 Ga0209129_1000017 3300025258 Bacteria 480935
91 Ga0209233_1000004 3300025261 Bacteria 1574798
92 Ga0209565_1001245 3300025263 Bacteria 11925
93 Ga0209675_1000167 3300025291 Bacteria 79477
94 Ga0209675_1001250 3300025291 Bacteria 15248
95 Ga0209675_1004220 3300025291 Bacteria 6487
96 Ga0209676_1000003 3300025292 Bacteria 1454178
97 Ga0209676_1000121 3300025292 Bacteria 198920
98 Ga0209676_1005307 3300025292 Bacteria 6791
99 Ga0209025_1000029 3300025294 Bacteria 488571
100 Ga0209025_1000051 3300025294 Bacteria 330080
101 Ga0209564_1000038 3300025295 Bacteria 414357
102 Ga0209564_1000071 3300025295 Bacteria 301332
103 Ga0209564_1000133 3300025295 Bacteria 189140
104 Ga0209758_1000038 3300025297 Bacteria 433771
105 Ga0209050_1000004 3300025298 Bacteria 1600040
106 Ga0209050_1000227 3300025298 Bacteria 123743
107 Ga0209050_1000240 3300025298 Bacteria 118992
108 Ga0209050_1000416 3300025298 Bacteria 78976
109 Ga0209256_1000092 3300025299 Bacteria 210547
110 Ga0209256_1000478 3300025299 Bacteria 59792
111 Ga0209051_1000006 3300025303 Bacteria 1015785
112 Ga0209051_1000020 3300025303 Bacteria 508628
113 Ga0209051_1000164 3300025303 Bacteria 124186
114 Ga0209257_1000085 3300025304 Bacteria 291117
115 Ga0209257_1002844 3300025304 Bacteria 16206
116 Ga0207696_1000376 3300025711 Bacteria 43744
117 Ga0207655_1001610 3300025728 Bacteria 20100
118 Ga0207713_1011327 3300025735 Bacteria 4860
119 Ga0207657_10138611 3300025919 Bacteria 1989
120 Ga0207709_10000184 3300025935 Bacteria 83205
121 Ga0209389_1000103 3300027296 Bacteria 75590
122 Ga0207428_10009941 3300027907 Bacteria 8522
123 Ga0207428_10010482 3300027907 Bacteria 8272
124 Ga0265316_10000337 3300031344 Bacteria 52655
125 Ga0307408_100004557 3300031548 Bacteria 9386
126 Ga0307412_10005131 3300031911 Bacteria 7334
127 Ga0307412_10008524 3300031911 Bacteria 5857
128 Ga0307412_10140965 3300031911 Bacteria 1765
129 Ga0307414_10159185 3300032004 Bacteria 1791
130 Ga0436361_0918291 3300039447 Bacteria 12268
131 Ga0439436_0002829 3300041404 Bacteria 5255
132 Ga0439438_000188 3300041405 Bacteria 27781
133 Ga0439438_005157 3300041405 Bacteria 4857
134 Ga0439438_008432 3300041405 Bacteria 3420
135 Ga0439447_002193 3300041407 Bacteria 7156
136 Ga0439447_005404 3300041407 Bacteria 4256
137 Ga0439466_0000440 3300041411 Bacteria 15848
138 Ga0439466_0000743 3300041411 Bacteria 12349
139 Ga0439466_0000768 3300041411 Bacteria 12148
140 Ga0439466_0001316 3300041411 Bacteria 9680
141 Ga0439432_000399 3300042006 Bacteria 16056
142 Ga0439432_002976 3300042006 Bacteria 6308
143 Ga0439451_000373 3300042009 Bacteria 8672
144 Ga0439451_002306 3300042009 Bacteria 3850
145 Ga0439452_000077 3300042010 Bacteria 84014
146 Ga0439452_001571 3300042010 Bacteria 9102
147 Ga0439452_001743 3300042010 Bacteria 8522
148 Ga0439456_003112 3300042013 Bacteria 3355
149 Ga0439456_009458 3300042013 Bacteria 2013
150 Ga0450911_000005 3300042115 Bacteria 233469
151 Ga0450904_000043 3300042139 Bacteria 28131
152 Ga0450907_000035 3300042146 Bacteria 60070
153 Ga0450907_001637 3300042146 Bacteria 4690
154 Ga0439446_0026704 3300042156 Bacteria 1655
155 Ga0450908_012736 3300042184 Bacteria 1521
156 Ga0439434_0000053 3300042435 Bacteria 28044
157 Ga0450916_002262 3300042530 Bacteria 2026
158 Ga0450893_0000845 3300042532 Bacteria 4543
159 Ga0439440_0000043 3300042993 Bacteria 15938
160 Ga0466965_0046918 3300044683 Bacteria 2139
161 Ga0495653_0000563 3300046463 Bacteria 28409
162 Ga0495650_0000421 3300046471 Bacteria 69019
163 Ga0495639_0000023 3300046475 Bacteria 70927
164 Ga0495594_0002158 3300046499 Bacteria 10241
165 Ga0495606_0003994 3300046507 Bacteria 15071
166 Ga0495610_0005603 3300046512 Bacteria 8862
167 Ga0495648_0046432 3300046524 Bacteria 2691
168 Ga0495597_0012477 3300046542 Bacteria 4100
169 Ga0495622_0000053 3300046557 Bacteria 102938
170 Ga0495622_0000135 3300046557 Bacteria 63001
171 Ga0495625_0000176 3300046660 Bacteria 99062
172 Ga0495625_0009991 3300046660 Bacteria 7893
173 Ga0495661_0001847 3300046665 Bacteria 16912
174 Ga0495649_0007135 3300046694 Bacteria 6864
175 Ga0495680_0015930 3300047322 Bacteria 6470
176 Ga0495675_0041628 3300047444 Bacteria 2927
177 Ga0495681_0000397 3300047470 Bacteria 33833
178 Ga0496102_0286644 3300048905 Bacteria 1552
179 Ga0496103_0055208 3300048906 Bacteria 2463
180 Ga0496106_0012303 3300048909 Bacteria 6315
181 Ga0496109_0007459 3300048912 Bacteria 9261
182 Ga0496110_0110775 3300048913 Bacteria 2467
183 Ga0496111_0055627 3300048914 Bacteria 2862
184 Ga0496111_0302844 3300048914 Bacteria 1185
185 Ga0496113_0015537 3300048916 Bacteria 5237
186 Ga0496114_0002518 3300048917 Bacteria 13992
187 Ga0496116_0000646 3300048919 Bacteria 45529
188 Ga0496116_0000858 3300048919 Bacteria 38019
189 Ga0496116_0026857 3300048919 Bacteria 4200
190 Ga0496117_0000001 3300048920 Bacteria 2526244
191 Ga0496117_0000807 3300048920 Bacteria 48627
192 Ga0496117_0005352 3300048920 Bacteria 13525
193 Ga0496118_0000002 3300048921 Bacteria 1690764
194 Ga0496118_0001066 3300048921 Bacteria 42810
195 Ga0496118_0014760 3300048921 Bacteria 7289
196 Ga0496118_0016350 3300048921 Bacteria 6810
197 Ga0496119_0028954 3300048922 Bacteria 3767
198 Ga0496120_0013474 3300048923 Bacteria 5501
199 Ga0496120_0055958 3300048923 Bacteria 2228
200 Ga0496121_0000050 3300048924 Bacteria 318295
201 Ga0496121_0003640 3300048924 Bacteria 21694
202 Ga0496121_0042599 3300048924 Bacteria 3944
203 Ga0496122_0000988 3300048925 Bacteria 50798
204 Ga0496122_0003281 3300048925 Bacteria 21443
205 Ga0496122_0005415 3300048925 Bacteria 15220
206 Ga0496122_0010541 3300048925 Bacteria 9500
207 Ga0496122_0035633 3300048925 Bacteria 4042
208 Ga0496122_0045897 3300048925 Bacteria 3390
209 Ga0496123_0000198 3300048926 Bacteria 122508
210 Ga0496123_0001515 3300048926 Bacteria 32169
211 Ga0496123_0003669 3300048926 Bacteria 16943
212 Ga0496123_0007313 3300048926 Bacteria 10470
213 Ga0496123_0030601 3300048926 Bacteria 3937
214 Ga0496123_0041574 3300048926 Bacteria 3184
215 Ga0496124_0001884 3300048927 Bacteria 28875
216 Ga0496124_0005308 3300048927 Bacteria 14561
217 Ga0496124_0025229 3300048927 Bacteria 5387
218 Ga0496124_0045668 3300048927 Bacteria 3755
219 Ga0496124_0049560 3300048927 Bacteria 3582
220 Ga0496124_0049999 3300048927 Bacteria 3564
221 Ga0496124_0078044 3300048927 Bacteria 2730
222 Ga0496124_0214317 3300048927 Bacteria 1454
223 Ga0496125_0046307 3300048928 Bacteria 3649
224 Ga0496125_0140192 3300048928 Bacteria 1683
225 Ga0501031_0320695 3300049568 Bacteria 1004
226 Ga0501034_0000003 3300049571 Bacteria 471748
227 Ga0501034_0090360 3300049571 Bacteria 3060
228 Ga0501241_000037 3300049758 Bacteria 43438
229 nmdc:mga07m45_44_c1 3300050496 Bacteria 58129
230 Ga0500659_0007235 3300053135 Bacteria 6132

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2932410948 2932416616 275
2 iso_pu_bacteria 2932416698 2932418149 275
3 3300042156 Ga0439446_0026704 Ga0439446_0026704_771_1643 286
4 3300003771 Ga0055526_1000031 Ga0055526_100003147 291
5 3300025295 Ga0209564_1000038 Ga0209564_1000038144 291
6 3300003316 rootH1_10103052 rootH1_101030522 292
7 3300049568 Ga0501031_0320695 Ga0501031_0320695_20_922 296
8 3300049571 Ga0501034_0090360 Ga0501034_0090360_1920_2822 296
9 3300021361 Ga0213872_10000437 Ga0213872_1000043718 297
10 3300039447 Ga0436361_0918291 Ga0436361_0918291_4647_5552 297
11 3300015683 Ga0183362_10013 Ga0183362_1001330 298
12 iso_pu_bacteria 2511231011 2511296828 300
13 iso_pu_bacteria 2599185160 2599352538 300
14 iso_pu_bacteria 2599185161 2599358880 300
15 iso_pu_bacteria 2599185162 2599365599 300
16 iso_pu_bacteria 2599185163 2599371523 300
17 iso_pu_bacteria 2599185164 2599377646 300
18 iso_pu_bacteria 2599185165 2599384977 300
19 iso_pu_bacteria 2599185166 2599390432 300
20 iso_pu_bacteria 2599185168 2599402566 300
21 iso_pu_bacteria 2599185181 2599459372 300
22 iso_pu_bacteria 2599185182 2599466291 300
23 iso_pu_bacteria 2599185186 2599488393 300
24 iso_pu_bacteria 2599185356 2600211976 300
25 iso_pu_bacteria 2600254931 2600367618 300
26 iso_pu_bacteria 2600255313 2601772144 300
27 iso_pu_bacteria 2667528171 2671095888 300
28 iso_pu_bacteria 2773857673 2774138361 300
29 iso_pu_bacteria 2784132063 2784264884 300
30 iso_pu_bacteria 2818991464 2819700632 300
31 iso_pu_bacteria 2842826826 2842829550 300
32 iso_pu_bacteria 2842837860 2842840878 300
33 iso_pu_bacteria 2904518522 2904523461 300
34 iso_pu_bacteria 637000220 637320794 300
35 3300002737 JGI25162J39368_1000030 JGI25162J39368_100003037 304
36 3300002771 JGI25163J39215_1000059 JGI25163J39215_100005915 304
37 3300002772 JGI25164J39214_1000123 JGI25164J39214_100012349 304
38 3300003214 JGI25165J46597_1000056 JGI25165J46597_1000056181 304
39 3300003781 Ga0055536_1000389 Ga0055536_100038912 304
40 3300003791 Ga0055530_10000563 Ga0055530_1000056312 304
41 3300003792 Ga0055540_1000451 Ga0055540_100045118 304
42 3300005457 Ga0070662_100262182 Ga0070662_1002621822 304
43 3300025207 Ga0209760_100016 Ga0209760_100016158 304
44 3300025231 Ga0207427_100022 Ga0207427_100022318 304
45 3300025233 Ga0209437_100002 Ga0209437_1000021330 304
46 3300025261 Ga0209233_1000004 Ga0209233_100000495 304
47 3300025292 Ga0209676_1000003 Ga0209676_1000003949 304
48 3300025298 Ga0209050_1000004 Ga0209050_1000004931 304
49 3300025303 Ga0209051_1000006 Ga0209051_100000644 304
50 3300025728 Ga0207655_1001610 Ga0207655_100161012 304
51 3300025735 Ga0207713_1011327 Ga0207713_10113273 304
52 3300041411 Ga0439466_0000768 Ga0439466_0000768_1401_2327 304
53 3300048920 Ga0496117_0000807 Ga0496117_0000807_16494_17420 304
54 3300048921 Ga0496118_0001066 Ga0496118_0001066_21426_22352 304
55 3300048927 Ga0496124_0214317 Ga0496124_0214317_69_992 304
56 iso_pu_bacteria 2513237165 2514040449 310
57 3300002773 JGI25152J39213_1000078 JGI25152J39213_100007823 312
58 3300002774 JGI25150J39212_1000136 JGI25150J39212_10001363 312
59 3300003215 JGI25153J46596_10005229 JGI25153J46596_100052294 312
60 3300003771 Ga0055526_1000438 Ga0055526_10004382 312
61 3300003773 Ga0055537_1007281 Ga0055537_10072812 312
62 3300003775 Ga0055524_1000521 Ga0055524_100052126 312
63 3300003784 Ga0055534_1011011 Ga0055534_10110112 312
64 3300003791 Ga0055530_10000941 Ga0055530_1000094125 312
65 3300006353 Ga0075370_10000029 Ga0075370_1000002935 312
66 3300025245 Ga0207425_1000014 Ga0207425_1000014410 312
67 3300025258 Ga0209129_1000017 Ga0209129_100001750 312
68 3300025291 Ga0209675_1001250 Ga0209675_10012504 312
69 3300025295 Ga0209564_1000071 Ga0209564_1000071240 312
70 3300025297 Ga0209758_1000038 Ga0209758_1000038410 312
71 3300025298 Ga0209050_1000240 Ga0209050_100024051 312
72 3300025299 Ga0209256_1000478 Ga0209256_10004785 312
73 3300048927 Ga0496124_0078044 Ga0496124_0078044_1149_2153 312
74 3300050496 nmdc:mga07m45_44_c1 nmdc:mga07m45_44_c1_30246_31229 312
75 3300046471 Ga0495650_0000421 Ga0495650_0000421_27586_28542 313
76 3300046660 Ga0495625_0000176 Ga0495625_0000176_67034_67990 313
77 3300046665 Ga0495661_0001847 Ga0495661_0001847_9472_10527 313
78 3300048912 Ga0496109_0007459 Ga0496109_0007459_2263_3318 313
79 3300048916 Ga0496113_0015537 Ga0496113_0015537_1284_2339 313
80 3300048925 Ga0496122_0000988 Ga0496122_0000988_26691_27746 313
81 3300048926 Ga0496123_0000198 Ga0496123_0000198_9935_10990 313
82 3300003773 Ga0055537_1016182 Ga0055537_10161822 314
83 3300025263 Ga0209565_1001245 Ga0209565_10012453 314
84 3300009092 Ga0105250_10000515 Ga0105250_1000051514 315
85 3300048905 Ga0496102_0286644 Ga0496102_0286644_472_1461 315
86 3300048906 Ga0496103_0055208 Ga0496103_0055208_799_1788 315
87 3300048919 Ga0496116_0000858 Ga0496116_0000858_11178_12137 315
88 3300048921 Ga0496118_0014760 Ga0496118_0014760_1477_2436 315
89 3300048927 Ga0496124_0025229 Ga0496124_0025229_3960_4919 315
90 3300044683 Ga0466965_0046918 Ga0466965_0046918_86_1051 318
91 3300048925 Ga0496122_0005415 Ga0496122_0005415_8297_9262 318
92 3300048926 Ga0496123_0003669 Ga0496123_0003669_6134_7099 318
93 3300013102 Ga0157371_10000198 Ga0157371_1000019850 320
94 3300014497 Ga0182008_10005980 Ga0182008_100059803 320
95 3300048924 Ga0496121_0000050 Ga0496121_0000050_269430_270404 320
96 3300048928 Ga0496125_0140192 Ga0496125_0140192_640_1611 320
97 3300003775 Ga0055524_1000242 Ga0055524_100024240 321
98 3300025299 Ga0209256_1000092 Ga0209256_100009288 321
99 3300003791 Ga0055530_10002817 Ga0055530_100028172 322
100 3300003792 Ga0055540_1000011 Ga0055540_1000011245 322
101 3300003794 Ga0055531_10011492 Ga0055531_100114924 322
102 3300005262 Ga0065165_1035552 Ga0065165_10355522 322
103 3300025298 Ga0209050_1000416 Ga0209050_100041655 322
104 3300025303 Ga0209051_1000020 Ga0209051_1000020244 322
105 3300025304 Ga0209257_1000085 Ga0209257_1000085244 322
106 3300048914 Ga0496111_0302844 Ga0496111_0302844_180_1157 322
107 3300048927 Ga0496124_0045668 Ga0496124_0045668_106_1083 322
108 iso_pu_bacteria 2857547612 2857550759 322
109 iso_pu_bacteria 2806310737 2807408392 323
110 iso_pu_bacteria 2806310745 2807456706 323
111 iso_pu_bacteria 8056115690 8056118853 323
112 iso_pu_bacteria 8056120720 8056123197 323
113 iso_pu_bacteria 8057798959 8057800394 324
114 iso_pu_bacteria 8011350971 8011351562 325
115 3300015261 Ga0182006_1000006 Ga0182006_1000006385 326
116 3300015262 Ga0182007_10000107 Ga0182007_100001079 326
117 3300015265 Ga0182005_1000001 Ga0182005_1000001608 326
118 3300025245 Ga0207425_1017153 Ga0207425_10171532 326
119 3300048914 Ga0496111_0055627 Ga0496111_0055627_995_1993 326
120 3300048920 Ga0496117_0000001 Ga0496117_0000001_499613_500602 326
121 3300048921 Ga0496118_0000002 Ga0496118_0000002_499613_500602 326
122 3300048924 Ga0496121_0042599 Ga0496121_0042599_2168_3157 326
123 3300048925 Ga0496122_0003281 Ga0496122_0003281_14805_15794 326
124 3300048926 Ga0496123_0007313 Ga0496123_0007313_7958_8947 326
125 3300048927 Ga0496124_0049999 Ga0496124_0049999_324_1313 326
126 iso_pu_bacteria 2511231017 2511333063 326
127 iso_pu_bacteria 2511231018 2511338591 326
128 iso_pu_bacteria 2511231019 2511344197 326
129 iso_pu_bacteria 2511231021 2511359962 326
130 iso_pu_bacteria 2599185189 2599509311 326
131 iso_pu_bacteria 2600255296 2601689773 326
132 iso_pu_bacteria 2643221713 2644621711 326
133 iso_pu_bacteria 2721755607 2723249705 326
134 iso_pu_bacteria 2818991456 2819659585 326
135 iso_pu_bacteria 2852657418 2852662189 326
136 iso_pu_bacteria 2904550169 2904550513 326
137 iso_pu_bacteria 2939636861 2939639079 326
138 iso_pu_bacteria 3007855910 3007856569 326
139 iso_pu_bacteria 8054347763 8054350897 326
140 3300003187 JGI25151J46595_10000896 JGI25151J46595_100008968 327
141 3300003187 JGI25151J46595_10003081 JGI25151J46595_100030812 327
142 3300003322 rootL2_10205496 rootL2_102054962 327
143 3300003771 Ga0055526_1000840 Ga0055526_100084018 327
144 3300003781 Ga0055536_1000329 Ga0055536_100032921 327
145 3300003784 Ga0055534_1000569 Ga0055534_100056918 327
146 3300025291 Ga0209675_1000167 Ga0209675_100016737 327
147 3300025292 Ga0209676_1000121 Ga0209676_100012119 327
148 3300025294 Ga0209025_1000029 Ga0209025_100002963 327
149 3300025294 Ga0209025_1000051 Ga0209025_1000051169 327
150 3300025295 Ga0209564_1000133 Ga0209564_100013314 327
151 3300048927 Ga0496124_0005308 Ga0496124_0005308_1648_2634 327
152 3300048927 Ga0496124_0049560 Ga0496124_0049560_539_1525 327
153 iso_pu_bacteria 2600255389 2602010238 327
154 iso_pu_bacteria 2842805378 2842805840 327
155 3300014497 Ga0182008_10000340 Ga0182008_100003406 328
156 3300046512 Ga0495610_0005603 Ga0495610_0005603_5112_6110 328
157 3300046524 Ga0495648_0046432 Ga0495648_0046432_815_1813 328
158 3300046557 Ga0495622_0000053 Ga0495622_0000053_11461_12459 328
159 3300046660 Ga0495625_0009991 Ga0495625_0009991_2433_3431 328
160 3300046694 Ga0495649_0007135 Ga0495649_0007135_3229_4227 328
161 3300048928 Ga0496125_0046307 Ga0496125_0046307_1624_2622 328
162 iso_pu_bacteria 8019769354 8019773955 328
163 3300046507 Ga0495606_0003994 Ga0495606_0003994_8104_9141 329
164 3300002738 JGI25154J39366_1004113 JGI25154J39366_10041133 330
165 3300003751 Ga0055538_1000097 Ga0055538_100009758 330
166 3300003752 Ga0055539_1000143 Ga0055539_100014358 330
167 3300003756 Ga0055533_1000148 Ga0055533_100014858 330
168 3300003758 Ga0055532_1000135 Ga0055532_100013559 330
169 3300003759 Ga0055525_1000194 Ga0055525_100019458 330
170 3300003791 Ga0055530_10000416 Ga0055530_1000041630 330
171 3300003792 Ga0055540_1000369 Ga0055540_100036930 330
172 3300003841 Ga0055541_1000097 Ga0055541_100009758 330
173 3300005293 Ga0065715_10145753 Ga0065715_101457532 330
174 3300006058 Ga0075432_10013084 Ga0075432_100130841 330
175 3300006914 Ga0075436_100098362 Ga0075436_1000983621 330
176 3300006944 Ga0099823_1000022 Ga0099823_100002213 330
177 3300009011 Ga0105251_10004224 Ga0105251_100042247 330
178 3300009092 Ga0105250_10009870 Ga0105250_100098703 330
179 3300013104 Ga0157370_10024056 Ga0157370_100240564 330
180 3300013306 Ga0163162_10494105 Ga0163162_104941052 330
181 3300013307 Ga0157372_10002005 Ga0157372_1000200511 330
182 3300013308 Ga0157375_10009201 Ga0157375_100092017 330
183 3300014497 Ga0182008_10001507 Ga0182008_100015073 330
184 3300015261 Ga0182006_1001781 Ga0182006_10017812 330
185 3300015261 Ga0182006_1007060 Ga0182006_10070603 330
186 3300015262 Ga0182007_10007596 Ga0182007_100075965 330
187 3300015265 Ga0182005_1000585 Ga0182005_10005855 330
188 3300017792 Ga0163161_10002676 Ga0163161_100026763 330
189 3300017792 Ga0163161_10011963 Ga0163161_100119634 330
190 3300025206 Ga0209435_100781 Ga0209435_1007815 330
191 3300025224 Ga0209784_100017 Ga0209784_10001723 330
192 3300025225 Ga0209566_100014 Ga0209566_10001423 330
193 3300025226 Ga0209674_100028 Ga0209674_10002823 330
194 3300025229 Ga0209147_100105 Ga0209147_10010523 330
195 3300025230 Ga0209563_100032 Ga0209563_10003223 330
196 3300025242 Ga0209258_100558 Ga0209258_10055823 330
197 3300025246 Ga0209646_1000225 Ga0209646_100022558 330
198 3300025253 Ga0209677_100018 Ga0209677_10001823 330
199 3300025291 Ga0209675_1004220 Ga0209675_10042205 330
200 3300025292 Ga0209676_1005307 Ga0209676_10053075 330
201 3300025298 Ga0209050_1000227 Ga0209050_100022755 330
202 3300025303 Ga0209051_1000164 Ga0209051_100016456 330
203 3300025304 Ga0209257_1002844 Ga0209257_10028446 330
204 3300025711 Ga0207696_1000376 Ga0207696_100037614 330
205 3300027296 Ga0209389_1000103 Ga0209389_100010312 330
206 3300027907 Ga0207428_10009941 Ga0207428_100099417 330
207 3300027907 Ga0207428_10010482 Ga0207428_100104823 330
208 3300031548 Ga0307408_100004557 Ga0307408_1000045575 330
209 3300031911 Ga0307412_10005131 Ga0307412_100051319 330
210 3300031911 Ga0307412_10008524 Ga0307412_100085242 330
211 3300031911 Ga0307412_10140965 Ga0307412_101409651 330
212 3300032004 Ga0307414_10159185 Ga0307414_101591851 330
213 3300041405 Ga0439438_000188 Ga0439438_000188_4306_5310 330
214 3300041405 Ga0439438_008432 Ga0439438_008432_396_1400 330
215 3300041407 Ga0439447_005404 Ga0439447_005404_2197_3201 330
216 3300041411 Ga0439466_0000440 Ga0439466_0000440_2021_3025 330
217 3300041411 Ga0439466_0001316 Ga0439466_0001316_3722_4726 330
218 3300042006 Ga0439432_000399 Ga0439432_000399_1584_2630 330
219 3300042006 Ga0439432_002976 Ga0439432_002976_1359_2363 330
220 3300042009 Ga0439451_000373 Ga0439451_000373_3723_4727 330
221 3300042009 Ga0439451_002306 Ga0439451_002306_2765_3769 330
222 3300042010 Ga0439452_000077 Ga0439452_000077_4370_5374 330
223 3300042010 Ga0439452_001743 Ga0439452_001743_3190_4194 330
224 3300042013 Ga0439456_003112 Ga0439456_003112_2021_3025 330
225 3300042146 Ga0450907_000035 Ga0450907_000035_7895_8899 330
226 3300042146 Ga0450907_001637 Ga0450907_001637_3460_4464 330
227 3300042184 Ga0450908_012736 Ga0450908_012736_443_1447 330
228 3300042435 Ga0439434_0000053 Ga0439434_0000053_7867_8871 330
229 3300042993 Ga0439440_0000043 Ga0439440_0000043_7658_8662 330
230 3300046463 Ga0495653_0000563 Ga0495653_0000563_25966_26970 330
231 3300046475 Ga0495639_0000023 Ga0495639_0000023_22026_23030 330
232 3300046499 Ga0495594_0002158 Ga0495594_0002158_1220_2224 330
233 3300046542 Ga0495597_0012477 Ga0495597_0012477_1560_2564 330
234 3300046557 Ga0495622_0000135 Ga0495622_0000135_39964_40968 330
235 3300047322 Ga0495680_0015930 Ga0495680_0015930_1703_2707 330
236 3300047444 Ga0495675_0041628 Ga0495675_0041628_1440_2444 330
237 3300047470 Ga0495681_0000397 Ga0495681_0000397_21940_22944 330
238 3300048909 Ga0496106_0012303 Ga0496106_0012303_4314_5318 330
239 3300048913 Ga0496110_0110775 Ga0496110_0110775_655_1659 330
240 3300048917 Ga0496114_0002518 Ga0496114_0002518_12643_13647 330
241 3300048919 Ga0496116_0000646 Ga0496116_0000646_16558_17562 330
242 3300048920 Ga0496117_0005352 Ga0496117_0005352_2150_3154 330
243 3300048921 Ga0496118_0016350 Ga0496118_0016350_2514_3518 330
244 3300048922 Ga0496119_0028954 Ga0496119_0028954_48_1052 330
245 3300048923 Ga0496120_0013474 Ga0496120_0013474_1931_2935 330
246 3300048923 Ga0496120_0055958 Ga0496120_0055958_680_1684 330
247 3300048924 Ga0496121_0003640 Ga0496121_0003640_8430_9434 330
248 3300048925 Ga0496122_0010541 Ga0496122_0010541_1121_2125 330
249 3300048925 Ga0496122_0035633 Ga0496122_0035633_1501_2505 330
250 3300048925 Ga0496122_0045897 Ga0496122_0045897_1192_2196 330
251 3300048926 Ga0496123_0001515 Ga0496123_0001515_16006_17010 330
252 3300048926 Ga0496123_0030601 Ga0496123_0030601_512_1516 330
253 3300048926 Ga0496123_0041574 Ga0496123_0041574_1394_2398 330
254 3300048927 Ga0496124_0001884 Ga0496124_0001884_12280_13284 330
255 3300049571 Ga0501034_0000003 Ga0501034_0000003_161255_162259 330
256 3300049758 Ga0501241_000037 Ga0501241_000037_1658_2662 330
257 3300053135 Ga0500659_0007235 Ga0500659_0007235_2038_3042 330
258 3300003322 rootL2_10009941 rootL2_1000994113 331
259 3300031344 Ga0265316_10000337 Ga0265316_1000033735 331
260 3300041404 Ga0439436_0002829 Ga0439436_0002829_541_1548 331
261 3300041405 Ga0439438_005157 Ga0439438_005157_888_1895 331
262 3300041407 Ga0439447_002193 Ga0439447_002193_4052_5059 331
263 3300041411 Ga0439466_0000743 Ga0439466_0000743_3539_4546 331
264 3300042010 Ga0439452_001571 Ga0439452_001571_7024_8031 331
265 3300042013 Ga0439456_009458 Ga0439456_009458_398_1405 331
266 3300042115 Ga0450911_000005 Ga0450911_000005_204242_205249 331
267 3300042139 Ga0450904_000043 Ga0450904_000043_24949_25956 331
268 3300042530 Ga0450916_002262 Ga0450916_002262_69_1076 331
269 3300042532 Ga0450893_0000845 Ga0450893_0000845_1465_2472 331
270 3300005288 Ga0065714_10107478 Ga0065714_101074782 336
271 3300013102 Ga0157371_10008182 Ga0157371_100081823 339
272 3300013104 Ga0157370_10011870 Ga0157370_100118705 339
273 iso_pu_bacteria 2511231027 2511389943 343
274 iso_pu_bacteria 2772190705 2772606126 343
275 iso_pu_bacteria 2585428061 2587750520 344
276 iso_pu_bacteria 2772190705 2772606130 344
277 iso_pu_bacteria 2919191525 2919195395 344
278 3300009148 Ga0105243_10000143 Ga0105243_1000014324 346
279 3300025935 Ga0207709_10000184 Ga0207709_1000018425 346
280 3300005339 Ga0070660_100128274 Ga0070660_1001282742 348
281 3300025919 Ga0207657_10138611 Ga0207657_101386112 348
282 iso_pu_bacteria 2585428045 2587681217 348
283 iso_pu_bacteria 2588254255 2590600152 348
284 2162886007 SwRhRL2b_contig_2934955 SwRhRL2b_0294.00009730 352
285 3300005289 Ga0065704_10070316 Ga0065704_1007031618 352
286 3300015261 Ga0182006_1000038 Ga0182006_1000038191 352
287 3300048919 Ga0496116_0026857 Ga0496116_0026857_2804_3862 352

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c8w-assembly1.cif.gz_A crystal structure of acetoacetate decarboxylase (adc) (yp_094708.1) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.60 a resolution 0.7568 114 348
2bma-assembly1.cif.gz_B the crystal structure of plasmodium falciparum glutamate dehydrogenase, a putative target for novel antimalarial drugs 0.7559 270 297
3bh2-assembly1.cif.gz_A structural studies of acetoacetate decarboxylase 0.7454 114 347
3bgt-assembly1.cif.gz_D structural studies of acetoacetate decarboxylase 0.745 114 348
5vm1-assembly1.cif.gz_A crystal structure of a xyloylose kinase from brucella ovis 0.736 233 270
ID Description Score Start End Superfamily
af_O53564_9_236_2.40.400.10 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.8741 113 347 2.40.400.10
af_O53564_9_236_2.40.400.10 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.8456 113 347 2.40.400.10
af_P77277_21_122_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.8382 233 263 3.90.180.10
2ap1A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.819 233 264 3.30.420.40
af_A0A1D6L052_103_280_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8077 232 262 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A0D5BKS8-F1-model_v4 deleted 0.9899 52 352
AF-A0A142JRP0-F1-model_v4 Acetoacetate decarboxylase (ADC) 0.9815 74 347
AF-A0A1E5X6Q8-F1-model_v4 Acetoacetate decarboxylase (ADC) 0.9802 54 352
AF-A0A0V0Q3S6-F1-model_v4 Acetoacetate decarboxylase (ADC) 0.98 49 316
AF-A0A1E5X6Q8-F1-model_v4 Acetoacetate decarboxylase (ADC) 0.9488 54 352

Feature Viewer

pLDDT pTM Quality
81.61 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map