F387827

General Info

Members Datasets Scaffolds Average Seq Length
287 176 253 277

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10020586|Ga0070666_100205863
Length 298
Sequence MRPGDGSDAGRNISLKKGEMFMRYYLACAAIALSAATPAMAQDEPTSPISVTGSIALVSDYRFRGVSQSDEELAVQGGITVTHESGFYVGTWGSNLSGWGTFGGSNTELDLFGGYAVPLGGATVDVGLTWYMYPGGADKTDFAEPYVKVSGTVGPAKLLAGVAYAPKQEALGRWYLSGASYGTGIPDAPGDKEDNLYIWGDISSGVPSTPLTLKAHLGYSNGNAGLGPNGTSVAPTGKYLDWMVGGDFAVGPLTLGVAYVDTNISKSESVYLQPNFSSTKDGSSIASGQVVFSVSAAF

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
5 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
6 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
7 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
8 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
9 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
10 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
11 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
12 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
13 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
14 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
15 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
16 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
17 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
18 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
19 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
20 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
21 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
22 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
23 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
24 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
25 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
26 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
27 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
28 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
29 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
30 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
31 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
32 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
33 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
34 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
35 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
36 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
64 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
65 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
66 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
93 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
94 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
95 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
96 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
97 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
98 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
99 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
100 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
101 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
102 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
103 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
104 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
105 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
106 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
107 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
108 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
109 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
110 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
111 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
114 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
115 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
116 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
117 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
118 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
119 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
120 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
125 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
126 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
129 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
139 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
140 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
151 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
152 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
153 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
158 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
159 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
160 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
161 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
162 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
163 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
164 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
165 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
166 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
167 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
170 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
171 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
172 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
173 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
174 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
175 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
176 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.15
Metatranscriptomes 0
Isolates 11.85

Biome Distribution

Category Percentage (%)
Aerial Root 1.39
Bulb 0
Endosphere 23
Nodule 0.35
Rhizoplane 4.53
Rhizosphere 49.48
Stem 0
Stem Tuber 0
Unclassified 21.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_281986 2162886007 Bacteria 4512
2 ARcpr5oldR_c000812 3300000041 Bacteria 3510
3 ARcpr5yngRDRAFT_c005223 3300000043 Bacteria 1203
4 JGI25153J46596_10031321 3300003215 Bacteria 1793
5 Ga0055524_1000103 3300003775 Bacteria 105196
6 Ga0055530_10000043 3300003791 Bacteria 111112
7 Ga0055530_10000049 3300003791 Bacteria 107051
8 Ga0055530_10003667 3300003791 Bacteria 8586
9 Ga0055530_10003919 3300003791 Bacteria 8077
10 Ga0055530_10004454 3300003791 Bacteria 7195
11 Ga0055531_10000008 3300003794 Bacteria 222269
12 Ga0055531_10000017 3300003794 Bacteria 177036
13 Ga0055531_10005407 3300003794 Bacteria 7486
14 Ga0065165_1007590 3300005262 Bacteria 5284
15 Ga0065704_10070388 3300005289 Bacteria 27599
16 Ga0065704_10245158 3300005289 Bacteria 1004
17 Ga0070666_10017146 3300005335 Bacteria 4641
18 Ga0070666_10020586 3300005335 Bacteria 4266
19 Ga0070666_10071235 3300005335 Bacteria 2366
20 Ga0070668_100000010 3300005347 Bacteria 132833
21 Ga0070668_100051738 3300005347 Bacteria 3166
22 Ga0070669_100000394 3300005353 Bacteria 33428
23 Ga0070669_100233261 3300005353 Bacteria 1459
24 Ga0070671_100315962 3300005355 Bacteria 1331
25 Ga0070667_100000013 3300005367 Bacteria 255674
26 Ga0070667_100000984 3300005367 Bacteria 26179
27 Ga0070667_100001187 3300005367 Bacteria 23675
28 Ga0070667_100001326 3300005367 Bacteria 22234
29 Ga0070667_100216661 3300005367 Bacteria 1703
30 Ga0070665_100002110 3300005548 Bacteria 22226
31 Ga0070665_100006374 3300005548 Bacteria 12029
32 Ga0070665_100496411 3300005548 Bacteria 1232
33 Ga0068857_100005024 3300005577 Bacteria 11243
34 Ga0068857_100264284 3300005577 Bacteria 1580
35 Ga0068854_100010078 3300005578 Bacteria 6120
36 Ga0068864_100015354 3300005618 Bacteria 6367
37 Ga0068863_100000005 3300005841 Bacteria 269757
38 Ga0068863_100000192 3300005841 Bacteria 64858
39 Ga0068863_100012020 3300005841 Bacteria 8364
40 Ga0068863_100039455 3300005841 Bacteria 4492
41 Ga0068858_100177342 3300005842 Bacteria 2011
42 Ga0068858_100212717 3300005842 Bacteria 1830
43 Ga0068858_100263087 3300005842 Bacteria 1640
44 Ga0068860_100000192 3300005843 Bacteria 97363
45 Ga0068860_100009225 3300005843 Bacteria 9806
46 Ga0068860_100075244 3300005843 Bacteria 3211
47 Ga0068860_100136440 3300005843 Bacteria 2356
48 Ga0068860_100137577 3300005843 Bacteria 2346
49 Ga0068862_100072689 3300005844 Bacteria 2971
50 Ga0068862_100248175 3300005844 Bacteria 1621
51 Ga0075365_10114922 3300006038 Bacteria 1852
52 Ga0075368_10000830 3300006042 Bacteria 9511
53 Ga0075366_10031715 3300006195 Bacteria 3111
54 Ga0075370_10060910 3300006353 Bacteria 2150
55 Ga0079104_1017190 3300006946 Bacteria 2087
56 Ga0105250_10031771 3300009092 Bacteria 2120
57 Ga0105248_10077220 3300009177 Bacteria 3744
58 Ga0105248_10302080 3300009177 Bacteria 1802
59 Ga0105237_10054743 3300009545 Bacteria 3997
60 Ga0105237_10117201 3300009545 Bacteria 2657
61 Ga0163162_10008796 3300013306 Bacteria 9819
62 Ga0163162_10013261 3300013306 Bacteria 8049
63 Ga0163162_10400973 3300013306 Bacteria 1504
64 Ga0183363_1002 3300015690 Bacteria 425040
65 Ga0183363_1008 3300015690 Bacteria 194027
66 Ga0183361_11064 3300016635 Bacteria 1360
67 Ga0207425_1017771 3300025245 Bacteria 1555
68 Ga0209565_1000011 3300025263 Bacteria 637062
69 Ga0209673_1001559 3300025273 Bacteria 20610
70 Ga0209675_1002101 3300025291 Bacteria 10557
71 Ga0209564_1023953 3300025295 Bacteria 2102
72 Ga0209758_1032451 3300025297 Bacteria 2119
73 Ga0209050_1000026 3300025298 Bacteria 499134
74 Ga0209050_1000059 3300025298 Bacteria 325258
75 Ga0209050_1000102 3300025298 Bacteria 229971
76 Ga0209050_1000388 3300025298 Bacteria 82715
77 Ga0209050_1002377 3300025298 Bacteria 16352
78 Ga0209256_1000016 3300025299 Bacteria 599092
79 Ga0209257_1000009 3300025304 Bacteria 1205047
80 Ga0209257_1000112 3300025304 Bacteria 234058
81 Ga0209257_1001877 3300025304 Bacteria 22761
82 Ga0209257_1002624 3300025304 Bacteria 17350
83 Ga0207680_10044168 3300025903 Bacteria 2619
84 Ga0207680_10075050 3300025903 Bacteria 2108
85 Ga0207680_10267963 3300025903 Bacteria 1184
86 Ga0207681_10000164 3300025923 Bacteria 54644
87 Ga0207644_10257100 3300025931 Bacteria 1395
88 Ga0207711_10099270 3300025941 Bacteria 2573
89 Ga0207711_10243057 3300025941 Bacteria 1651
90 Ga0207712_10162472 3300025961 Bacteria 1737
91 Ga0207668_10000020 3300025972 Bacteria 140737
92 Ga0207668_10028141 3300025972 Bacteria 3671
93 Ga0207640_10007232 3300025981 Bacteria 6124
94 Ga0207658_10000068 3300025986 Bacteria 113745
95 Ga0207658_10000344 3300025986 Bacteria 46055
96 Ga0207658_10000366 3300025986 Bacteria 44437
97 Ga0207658_10000967 3300025986 Bacteria 23707
98 Ga0207658_10212105 3300025986 Bacteria 1623
99 Ga0207703_10090131 3300026035 Bacteria 2577
100 Ga0207703_10138887 3300026035 Bacteria 2107
101 Ga0207641_10000064 3300026088 Bacteria 156652
102 Ga0207641_10000074 3300026088 Bacteria 145908
103 Ga0207641_10001414 3300026088 Bacteria 23667
104 Ga0207641_10051100 3300026088 Bacteria 3500
105 Ga0207676_10031047 3300026095 Bacteria 4015
106 Ga0207674_10057298 3300026116 Bacteria 3950
107 Ga0207674_10070945 3300026116 Bacteria 3502
108 Ga0209813_10000457 3300027866 Bacteria 9883
109 Ga0268266_10002815 3300028379 Bacteria 18142
110 Ga0268266_10033793 3300028379 Bacteria 4347
111 Ga0268266_10105884 3300028379 Bacteria 2486
112 Ga0268266_10154316 3300028379 Bacteria 2072
113 Ga0268265_10132706 3300028380 Bacteria 2073
114 Ga0268264_10000018 3300028381 Bacteria 495324
115 Ga0268264_10006519 3300028381 Bacteria 9831
116 Ga0268264_10058640 3300028381 Bacteria 3224
117 Ga0268264_10111386 3300028381 Bacteria 2398
118 Ga0307412_10552323 3300031911 Bacteria 967
119 Ga0307414_10000374 3300032004 Bacteria 24543
120 Ga0307414_10024673 3300032004 Bacteria 3838
121 Ga0307414_10155968 3300032004 Bacteria 1807
122 Ga0439436_0016235 3300041404 Bacteria 2235
123 Ga0439439_0095802 3300041406 Bacteria 814
124 Ga0439461_0001846 3300041410 Bacteria 3333
125 Ga0439465_0009114 3300041413 Bacteria 3127
126 Ga0451789_0279219 3300041443 Bacteria 1008
127 Ga0451802_0045053 3300041460 Bacteria 4246
128 Ga0451806_860883 3300041462 Bacteria 5336
129 Ga0451807_0253187 3300041486 Bacteria 1500
130 Ga0451841_0619673 3300041498 Bacteria 1278
131 Ga0451843_0196154 3300041509 Bacteria 752
132 Ga0451843_1710527 3300041509 Bacteria 1007
133 Ga0439431_0003606 3300041997 Bacteria 3415
134 Ga0439431_0020949 3300041997 Bacteria 1566
135 Ga0439442_003666 3300042002 Bacteria 3042
136 Ga0439445_0016203 3300042004 Bacteria 1831
137 Ga0439432_000477 3300042006 Bacteria 15004
138 Ga0439432_077553 3300042006 Bacteria 1008
139 Ga0439457_031226 3300042014 Bacteria 1181
140 Ga0439462_0000132 3300042015 Bacteria 11897
141 Ga0439446_0041656 3300042156 Bacteria 1354
142 Ga0439434_0001893 3300042435 Bacteria 6083
143 Ga0466973_0307131 3300044659 Bacteria 1058
144 Ga0495627_003983 3300046453 Bacteria 6302
145 Ga0495650_0001249 3300046471 Bacteria 26263
146 Ga0495650_0002120 3300046471 Bacteria 16967
147 Ga0495585_0059708 3300046492 Bacteria 2101
148 Ga0495596_0001234 3300046500 Bacteria 14905
149 Ga0495596_0004496 3300046500 Bacteria 6778
150 Ga0495607_0027004 3300046501 Bacteria 3556
151 Ga0495606_0029246 3300046507 Bacteria 3873
152 Ga0495610_0000033 3300046512 Bacteria 204151
153 Ga0495610_0000116 3300046512 Bacteria 90702
154 Ga0495610_0003741 3300046512 Bacteria 11646
155 Ga0495620_0021996 3300046515 Bacteria 3083
156 Ga0495632_0001393 3300046519 Bacteria 20281
157 Ga0495643_0000048 3300046522 Bacteria 212788
158 Ga0495643_0020401 3300046522 Bacteria 3820
159 Ga0495643_0023744 3300046522 Bacteria 3482
160 Ga0495648_0020997 3300046524 Bacteria 4536
161 Ga0495609_0022125 3300046538 Bacteria 2930
162 Ga0495625_0003987 3300046660 Bacteria 14147
163 Ga0495670_0169578 3300046691 Bacteria 1149
164 Ga0495671_0119882 3300046692 Bacteria 1284
165 Ga0495681_0000041 3300047470 Bacteria 119251
166 Ga0495686_0000971 3300047472 Bacteria 35272
167 Ga0495615_0000089 3300048090 Bacteria 27064
168 Ga0495626_0000823 3300048091 Bacteria 27833
169 Ga0496100_0077770 3300048903 Bacteria 2231
170 Ga0496101_0547772 3300048904 Bacteria 915
171 Ga0496102_0000510 3300048905 Bacteria 42494
172 Ga0496103_0000487 3300048906 Bacteria 32998
173 Ga0496105_0000420 3300048908 Bacteria 27849
174 Ga0496111_0170587 3300048914 Bacteria 1617
175 Ga0496112_0326027 3300048915 Bacteria 1479
176 Ga0496113_0000228 3300048916 Bacteria 26391
177 Ga0496116_0000011 3300048919 Bacteria 646953
178 Ga0496116_0000195 3300048919 Bacteria 120438
179 Ga0496117_0002509 3300048920 Bacteria 23017
180 Ga0496117_0005957 3300048920 Bacteria 12569
181 Ga0496117_0082295 3300048920 Bacteria 2109
182 Ga0496118_0004102 3300048921 Bacteria 17648
183 Ga0496118_0007656 3300048921 Bacteria 11373
184 Ga0496118_0029565 3300048921 Bacteria 4592
185 Ga0496119_0000917 3300048922 Bacteria 38103
186 Ga0496120_0050946 3300048923 Bacteria 2368
187 Ga0496121_0019532 3300048924 Bacteria 6767
188 Ga0496121_0051685 3300048924 Bacteria 3459
189 Ga0496122_0001816 3300048925 Bacteria 32628
190 Ga0496122_0003405 3300048925 Bacteria 20924
191 Ga0496122_0003999 3300048925 Bacteria 18795
192 Ga0496122_0013785 3300048925 Bacteria 7877
193 Ga0496122_0232706 3300048925 Bacteria 1046
194 Ga0496123_0001206 3300048926 Bacteria 37815
195 Ga0496123_0001656 3300048926 Bacteria 29930
196 Ga0496123_0002498 3300048926 Bacteria 22653
197 Ga0496123_0002568 3300048926 Bacteria 22101
198 Ga0496123_0056679 3300048926 Bacteria 2558
199 Ga0496123_0059354 3300048926 Bacteria 2474
200 Ga0496124_0000328 3300048927 Bacteria 87848
201 Ga0496124_0002639 3300048927 Bacteria 23062
202 Ga0496124_0003000 3300048927 Bacteria 21113
203 Ga0496124_0003236 3300048927 Bacteria 20113
204 Ga0496124_0005630 3300048927 Bacteria 14008
205 Ga0496124_0007828 3300048927 Bacteria 11274
206 Ga0496124_0013641 3300048927 Bacteria 7922
207 Ga0496124_0024949 3300048927 Bacteria 5423
208 Ga0496124_0026556 3300048927 Bacteria 5218
209 Ga0496125_0004673 3300048928 Bacteria 15612
210 Ga0496125_0005339 3300048928 Bacteria 14355
211 Ga0496125_0019864 3300048928 Bacteria 6320
212 Ga0496126_0000136 3300048929 Bacteria 167497
213 Ga0496126_0000556 3300048929 Bacteria 71911
214 Ga0496126_0000903 3300048929 Bacteria 51581
215 Ga0501038_0016325 3300049574 Bacteria 6732
216 Ga0501038_0023098 3300049574 Bacteria 5565
217 Ga0501224_003895 3300049664 Bacteria 2102
218 Ga0501249_008882 3300049679 Bacteria 2088
219 Ga0501241_009318 3300049758 Bacteria 1787
220 nmdc:mga03683_930_c1 3300050489 Bacteria 8471
221 nmdc:mga00v17_3262_c2 3300050491 Bacteria 1700
222 nmdc:mga06z11_288_c1 3300050494 Bacteria 19563
223 nmdc:mga07m45_11999_c1 3300050496 Bacteria 4567
224 nmdc:mga07m45_15_c1 3300050496 Bacteria 152740
225 nmdc:mga0sz30_5580_c1 3300050516 Bacteria 4624
226 Ga0500643_000099 3300053087 Bacteria 91714
227 Ga0500643_001053 3300053087 Bacteria 16728
228 Ga0500566_0086894 3300053094 Bacteria 1732
229 Ga0500566_0096787 3300053094 Bacteria 1624
230 Ga0500562_018567 3300053108 Bacteria 1796
231 Ga0500607_000011 3300053121 Bacteria 110773
232 Ga0500607_000036 3300053121 Bacteria 87178
233 Ga0500607_000168 3300053121 Bacteria 57382
234 Ga0500608_000197 3300053122 Bacteria 24165
235 Ga0500658_0001857 3300053134 Bacteria 8304
236 Ga0500658_0011595 3300053134 Bacteria 3250
237 Ga0500559_0001554 3300053136 Bacteria 12846
238 Ga0500559_0001750 3300053136 Bacteria 11908
239 Ga0500559_0101369 3300053136 Bacteria 1327
240 Ga0500564_001451 3300053138 Bacteria 8189
241 Ga0500573_0000022 3300053140 Bacteria 154562
242 Ga0500604_0023412 3300053151 Bacteria 1761
243 Ga0500604_0041706 3300053151 Bacteria 1389
244 Ga0500616_0017086 3300053153 Bacteria 4120
245 Ga0500622_0000859 3300053156 Bacteria 25943
246 Ga0500624_000016 3300053157 Bacteria 134804
247 Ga0500637_0000007 3300053178 Bacteria 93788
248 Ga0500637_0009241 3300053178 Bacteria 5009
249 Ga0500567_003317 3300053723 Bacteria 7136
250 Ga0500625_000001 3300053729 Bacteria 395993
251 Ga0500645_004414 3300053730 Bacteria 5407
252 Ga0500645_049284 3300053730 Bacteria 1232
253 Ga0500661_000218 3300055283 Bacteria 10311

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041406 Ga0439439_0095802 Ga0439439_0095802_29_694 218
2 3300041509 Ga0451843_0196154 Ga0451843_0196154_55_723 218
3 3300032004 Ga0307414_10155968 Ga0307414_101559682 236
4 3300049679 Ga0501249_008882 Ga0501249_008882_22_762 242
5 3300032004 Ga0307414_10024673 Ga0307414_100246734 252
6 3300053108 Ga0500562_018567 Ga0500562_018567_947_1762 253
7 3300003791 Ga0055530_10000043 Ga0055530_1000004365 256
8 3300003794 Ga0055531_10000008 Ga0055531_1000000821 256
9 3300025298 Ga0209050_1000026 Ga0209050_1000026161 256
10 3300025304 Ga0209257_1000009 Ga0209257_1000009161 256
11 3300041486 Ga0451807_0253187 Ga0451807_0253187_405_1220 256
12 3300053730 Ga0500645_049284 Ga0500645_049284_166_1020 257
13 3300046453 Ga0495627_003983 Ga0495627_003983_1242_2087 258
14 3300046471 Ga0495650_0002120 Ga0495650_0002120_9610_10455 258
15 3300046512 Ga0495610_0000033 Ga0495610_0000033_49093_49938 258
16 3300046515 Ga0495620_0021996 Ga0495620_0021996_83_928 258
17 3300047470 Ga0495681_0000041 Ga0495681_0000041_117154_117999 258
18 3300005335 Ga0070666_10017146 Ga0070666_100171463 259
19 3300005367 Ga0070667_100001187 Ga0070667_1000011874 259
20 3300005841 Ga0068863_100012020 Ga0068863_10001202010 259
21 3300005843 Ga0068860_100009225 Ga0068860_10000922511 259
22 3300005844 Ga0068862_100248175 Ga0068862_1002481752 259
23 3300025903 Ga0207680_10267963 Ga0207680_102679632 259
24 3300025986 Ga0207658_10000967 Ga0207658_100009674 259
25 3300026088 Ga0207641_10001414 Ga0207641_1000141428 259
26 3300028380 Ga0268265_10132706 Ga0268265_101327062 259
27 3300028381 Ga0268264_10006519 Ga0268264_100065194 259
28 3300046519 Ga0495632_0001393 Ga0495632_0001393_17829_18737 259
29 3300046524 Ga0495648_0020997 Ga0495648_0020997_2904_3713 260
30 3300049758 Ga0501241_009318 Ga0501241_009318_900_1691 260
31 3300046512 Ga0495610_0000116 Ga0495610_0000116_14752_15597 263
32 3300046522 Ga0495643_0000048 Ga0495643_0000048_80060_80905 263
33 iso_pu_bacteria 2643221560 2643821151 263
34 iso_pu_bacteria 2808606401 2809065184 263
35 iso_pu_bacteria 2808606404 2809081151 263
36 iso_pu_bacteria 2808606405 2809085516 263
37 iso_pu_bacteria 2880518877 2880523325 263
38 iso_pu_bacteria 8054302542 8054307181 263
39 iso_pu_bacteria 2818991438 2819553304 264
40 3300046492 Ga0495585_0059708 Ga0495585_0059708_712_1512 265
41 iso_pu_bacteria 2599185359 2600227850 265
42 iso_pu_bacteria 2643221622 2644128010 265
43 iso_pu_bacteria 2818991466 2819714284 265
44 iso_pu_bacteria 2928526807 2928530501 265
45 iso_pu_bacteria 2928968154 2928968299 265
46 3300053151 Ga0500604_0023412 Ga0500604_0023412_553_1389 266
47 3300005842 Ga0068858_100177342 Ga0068858_1001773422 267
48 3300013306 Ga0163162_10013261 Ga0163162_100132616 267
49 3300026035 Ga0207703_10138887 Ga0207703_101388872 267
50 3300028379 Ga0268266_10033793 Ga0268266_100337936 267
51 3300041443 Ga0451789_0279219 Ga0451789_0279219_17_820 267
52 3300041460 Ga0451802_0045053 Ga0451802_0045053_3111_3914 267
53 3300041462 Ga0451806_860883 Ga0451806_860883_3693_4496 267
54 3300047472 Ga0495686_0000971 Ga0495686_0000971_5184_5987 267
55 3300048920 Ga0496117_0005957 Ga0496117_0005957_10251_11057 267
56 3300050496 nmdc:mga07m45_11999_c1 nmdc:mga07m45_11999_c1_3726_4544 267
57 3300053087 Ga0500643_000099 Ga0500643_000099_84656_85465 267
58 3300053136 Ga0500559_0001750 Ga0500559_0001750_6244_7053 267
59 3300053153 Ga0500616_0017086 Ga0500616_0017086_1445_2248 267
60 3300053156 Ga0500622_0000859 Ga0500622_0000859_18435_19238 267
61 3300055283 Ga0500661_000218 Ga0500661_000218_6251_7060 267
62 3300003791 Ga0055530_10000049 Ga0055530_100000493 268
63 3300003791 Ga0055530_10003667 Ga0055530_100036677 268
64 3300003794 Ga0055531_10000017 Ga0055531_1000001771 268
65 3300005262 Ga0065165_1007590 Ga0065165_10075904 268
66 3300005289 Ga0065704_10245158 Ga0065704_102451581 268
67 3300005548 Ga0070665_100496411 Ga0070665_1004964112 268
68 3300025298 Ga0209050_1000102 Ga0209050_100010271 268
69 3300025298 Ga0209050_1000388 Ga0209050_100038858 268
70 3300025304 Ga0209257_1000112 Ga0209257_100011271 268
71 3300028379 Ga0268266_10105884 Ga0268266_101058841 268
72 3300041404 Ga0439436_0016235 Ga0439436_0016235_724_1539 268
73 3300041410 Ga0439461_0001846 Ga0439461_0001846_1134_1949 268
74 3300041413 Ga0439465_0009114 Ga0439465_0009114_1670_2485 268
75 3300041997 Ga0439431_0003606 Ga0439431_0003606_1187_2002 268
76 3300042004 Ga0439445_0016203 Ga0439445_0016203_852_1667 268
77 3300042006 Ga0439432_000477 Ga0439432_000477_1498_2313 268
78 3300042015 Ga0439462_0000132 Ga0439462_0000132_9941_10756 268
79 3300042435 Ga0439434_0001893 Ga0439434_0001893_4417_5232 268
80 3300048924 Ga0496121_0019532 Ga0496121_0019532_641_1462 268
81 3300048927 Ga0496124_0003236 Ga0496124_0003236_7336_8157 268
82 3300053094 Ga0500566_0086894 Ga0500566_0086894_422_1237 268
83 3300000041 ARcpr5oldR_c000812 ARcpr5oldR_0008121 269
84 3300000043 ARcpr5yngRDRAFT_c005223 ARcpr5yngRDRAFT_0052231 269
85 3300003215 JGI25153J46596_10031321 JGI25153J46596_100313212 269
86 3300003775 Ga0055524_1000103 Ga0055524_10001035 269
87 3300003791 Ga0055530_10003919 Ga0055530_100039193 269
88 3300003794 Ga0055531_10005407 Ga0055531_100054071 269
89 3300005353 Ga0070669_100233261 Ga0070669_1002332612 269
90 3300005577 Ga0068857_100264284 Ga0068857_1002642842 269
91 3300005578 Ga0068854_100010078 Ga0068854_1000100783 269
92 3300009545 Ga0105237_10054743 Ga0105237_100547435 269
93 3300025245 Ga0207425_1017771 Ga0207425_10177712 269
94 3300025263 Ga0209565_1000011 Ga0209565_1000011424 269
95 3300025273 Ga0209673_1001559 Ga0209673_10015593 269
96 3300025291 Ga0209675_1002101 Ga0209675_10021019 269
97 3300025295 Ga0209564_1023953 Ga0209564_10239532 269
98 3300025297 Ga0209758_1032451 Ga0209758_10324512 269
99 3300025298 Ga0209050_1002377 Ga0209050_100237710 269
100 3300025299 Ga0209256_1000016 Ga0209256_1000016175 269
101 3300025304 Ga0209257_1001877 Ga0209257_100187713 269
102 3300025304 Ga0209257_1002624 Ga0209257_10026245 269
103 3300025981 Ga0207640_10007232 Ga0207640_100072324 269
104 3300026116 Ga0207674_10057298 Ga0207674_100572984 269
105 3300031911 Ga0307412_10552323 Ga0307412_105523231 269
106 3300041997 Ga0439431_0020949 Ga0439431_0020949_216_1034 269
107 3300042002 Ga0439442_003666 Ga0439442_003666_277_1095 269
108 3300042006 Ga0439432_077553 Ga0439432_077553_77_895 269
109 3300042014 Ga0439457_031226 Ga0439457_031226_273_1091 269
110 3300042156 Ga0439446_0041656 Ga0439446_0041656_62_880 269
111 3300048904 Ga0496101_0547772 Ga0496101_0547772_62_877 269
112 3300048923 Ga0496120_0050946 Ga0496120_0050946_1031_1846 269
113 3300048925 Ga0496122_0232706 Ga0496122_0232706_129_944 269
114 3300048926 Ga0496123_0056679 Ga0496123_0056679_479_1294 269
115 3300048926 Ga0496123_0059354 Ga0496123_0059354_1158_1973 269
116 3300048927 Ga0496124_0000328 Ga0496124_0000328_48615_49430 269
117 3300048927 Ga0496124_0005630 Ga0496124_0005630_3597_4412 269
118 3300048927 Ga0496124_0026556 Ga0496124_0026556_3890_4705 269
119 3300049664 Ga0501224_003895 Ga0501224_003895_291_1121 269
120 3300053134 Ga0500658_0001857 Ga0500658_0001857_4763_5581 269
121 3300053134 Ga0500658_0011595 Ga0500658_0011595_295_1113 269
122 3300053151 Ga0500604_0041706 Ga0500604_0041706_411_1229 269
123 3300053157 Ga0500624_000016 Ga0500624_000016_82574_83386 269
124 3300053178 Ga0500637_0000007 Ga0500637_0000007_82592_83404 269
125 3300006038 Ga0075365_10114922 Ga0075365_101149222 270
126 3300006042 Ga0075368_10000830 Ga0075368_100008302 270
127 3300006195 Ga0075366_10031715 Ga0075366_100317153 270
128 3300009545 Ga0105237_10117201 Ga0105237_101172013 270
129 3300027866 Ga0209813_10000457 Ga0209813_100004579 270
130 3300050489 nmdc:mga03683_930_c1 nmdc:mga03683_930_c1_4525_5346 270
131 3300050491 nmdc:mga00v17_3262_c2 nmdc:mga00v17_3262_c2_115_936 270
132 3300050494 nmdc:mga06z11_288_c1 nmdc:mga06z11_288_c1_5632_6453 270
133 3300050496 nmdc:mga07m45_15_c1 nmdc:mga07m45_15_c1_67198_68019 270
134 3300050516 nmdc:mga0sz30_5580_c1 nmdc:mga0sz30_5580_c1_327_1148 270
135 3300053094 Ga0500566_0096787 Ga0500566_0096787_364_1191 270
136 3300053121 Ga0500607_000036 Ga0500607_000036_81353_82180 270
137 3300053121 Ga0500607_000168 Ga0500607_000168_43528_44355 270
138 3300053136 Ga0500559_0001554 Ga0500559_0001554_1603_2430 270
139 3300053178 Ga0500637_0009241 Ga0500637_0009241_3830_4657 270
140 3300053730 Ga0500645_004414 Ga0500645_004414_1019_1846 270
141 iso_pu_bacteria 2848297114 2848298761 270
142 3300053140 Ga0500573_0000022 Ga0500573_0000022_51570_52385 271
143 iso_pu_bacteria 2928027323 2928029157 271
144 iso_pu_bacteria 2984555340 2984555401 271
145 iso_pu_bacteria 2984564862 2984566461 271
146 iso_pu_bacteria 2993356040 2993357500 271
147 3300048919 Ga0496116_0000195 Ga0496116_0000195_91072_91905 272
148 3300048921 Ga0496118_0007656 Ga0496118_0007656_7445_8278 272
149 3300048925 Ga0496122_0013785 Ga0496122_0013785_2090_2923 272
150 3300048926 Ga0496123_0001656 Ga0496123_0001656_564_1397 272
151 3300048927 Ga0496124_0013641 Ga0496124_0013641_6874_7707 272
152 3300048928 Ga0496125_0019864 Ga0496125_0019864_3359_4192 272
153 3300048929 Ga0496126_0000136 Ga0496126_0000136_66913_67746 272
154 3300053122 Ga0500608_000197 Ga0500608_000197_15402_16253 272
155 3300053136 Ga0500559_0101369 Ga0500559_0101369_349_1200 272
156 3300053723 Ga0500567_003317 Ga0500567_003317_5206_6057 272
157 iso_pu_bacteria 2990265787 2990267359 272
158 iso_pu_bacteria 2643221541 2643727783 273
159 iso_pu_bacteria 2643221606 2644043267 273
160 iso_pu_bacteria 2643221671 2644395302 273
161 iso_pu_bacteria 2739367664 2739649010 273
162 iso_pu_bacteria 2739367865 2740027483 273
163 3300053138 Ga0500564_001451 Ga0500564_001451_4650_5501 274
164 3300053729 Ga0500625_000001 Ga0500625_000001_357746_358597 274
165 3300005355 Ga0070671_100315962 Ga0070671_1003159622 275
166 3300005367 Ga0070667_100001326 Ga0070667_10000132613 275
167 3300005841 Ga0068863_100039455 Ga0068863_1000394552 275
168 3300005843 Ga0068860_100137577 Ga0068860_1001375772 275
169 3300025931 Ga0207644_10257100 Ga0207644_102571002 275
170 3300025986 Ga0207658_10000344 Ga0207658_1000034429 275
171 3300026088 Ga0207641_10051100 Ga0207641_100511002 275
172 iso_pu_bacteria 2510917021 2511130282 275
173 iso_pu_bacteria 2946787523 2946789702 275
174 iso_pu_bacteria 8054302542 8054303067 275
175 3300013306 Ga0163162_10400973 Ga0163162_104009732 276
176 3300016635 Ga0183361_11064 Ga0183361_110642 276
177 3300005347 Ga0070668_100000010 Ga0070668_100000010106 277
178 3300005367 Ga0070667_100000013 Ga0070667_10000001333 277
179 3300005841 Ga0068863_100000192 Ga0068863_10000019236 277
180 3300005843 Ga0068860_100136440 Ga0068860_1001364402 277
181 3300006353 Ga0075370_10060910 Ga0075370_100609102 277
182 3300009177 Ga0105248_10302080 Ga0105248_103020802 277
183 3300015690 Ga0183363_1008 Ga0183363_1008151 277
184 3300025903 Ga0207680_10044168 Ga0207680_100441683 277
185 3300025941 Ga0207711_10243057 Ga0207711_102430572 277
186 3300025972 Ga0207668_10000020 Ga0207668_10000020108 277
187 3300025986 Ga0207658_10000068 Ga0207658_1000006833 277
188 3300026088 Ga0207641_10000074 Ga0207641_1000007437 277
189 3300044659 Ga0466973_0307131 Ga0466973_0307131_91_933 277
190 3300048090 Ga0495615_0000089 Ga0495615_0000089_24888_25733 277
191 3300048925 Ga0496122_0003999 Ga0496122_0003999_2294_3139 277
192 3300048926 Ga0496123_0002498 Ga0496123_0002498_10613_11458 277
193 3300048927 Ga0496124_0024949 Ga0496124_0024949_2475_3320 277
194 3300046500 Ga0495596_0001234 Ga0495596_0001234_3821_4669 278
195 3300046512 Ga0495610_0003741 Ga0495610_0003741_8403_9251 278
196 3300048091 Ga0495626_0000823 Ga0495626_0000823_10306_11154 278
197 3300005577 Ga0068857_100005024 Ga0068857_1000050248 279
198 3300006946 Ga0079104_1017190 Ga0079104_10171903 279
199 3300015690 Ga0183363_1002 Ga0183363_1002343 279
200 3300026116 Ga0207674_10070945 Ga0207674_100709452 279
201 3300032004 Ga0307414_10000374 Ga0307414_100003747 279
202 3300041498 Ga0451841_0619673 Ga0451841_0619673_113_952 279
203 3300041509 Ga0451843_1710527 Ga0451843_1710527_13_852 279
204 3300046471 Ga0495650_0001249 Ga0495650_0001249_8036_8875 279
205 3300046500 Ga0495596_0004496 Ga0495596_0004496_4536_5387 279
206 3300046501 Ga0495607_0027004 Ga0495607_0027004_1752_2609 279
207 3300046507 Ga0495606_0029246 Ga0495606_0029246_2349_3200 279
208 3300046522 Ga0495643_0020401 Ga0495643_0020401_1161_2012 279
209 3300046522 Ga0495643_0023744 Ga0495643_0023744_1084_1935 279
210 3300046538 Ga0495609_0022125 Ga0495609_0022125_2012_2863 279
211 3300046660 Ga0495625_0003987 Ga0495625_0003987_10983_11834 279
212 3300046691 Ga0495670_0169578 Ga0495670_0169578_108_959 279
213 3300046692 Ga0495671_0119882 Ga0495671_0119882_248_1099 279
214 3300049574 Ga0501038_0016325 Ga0501038_0016325_119_973 279
215 3300049574 Ga0501038_0023098 Ga0501038_0023098_3867_4715 279
216 3300053121 Ga0500607_000011 Ga0500607_000011_3442_4308 279
217 3300003791 Ga0055530_10004454 Ga0055530_100044542 281
218 3300005335 Ga0070666_10020586 Ga0070666_100205863 281
219 3300025298 Ga0209050_1000059 Ga0209050_100005965 281
220 3300028381 Ga0268264_10111386 Ga0268264_101113861 281
221 3300048919 Ga0496116_0000011 Ga0496116_0000011_529508_530392 281
222 3300048920 Ga0496117_0082295 Ga0496117_0082295_1215_2099 281
223 3300048921 Ga0496118_0029565 Ga0496118_0029565_1850_2734 281
224 3300048925 Ga0496122_0001816 Ga0496122_0001816_21285_22169 281
225 3300048926 Ga0496123_0001206 Ga0496123_0001206_32747_33631 281
226 3300048927 Ga0496124_0003000 Ga0496124_0003000_7717_8601 281
227 3300048927 Ga0496124_0007828 Ga0496124_0007828_2021_2905 281
228 3300048928 Ga0496125_0005339 Ga0496125_0005339_13200_14084 281
229 3300048929 Ga0496126_0000556 Ga0496126_0000556_41387_42271 281
230 3300053087 Ga0500643_001053 Ga0500643_001053_14198_15094 281
231 iso_pu_bacteria 2818991438 2819551590 281
232 3300005335 Ga0070666_10071235 Ga0070666_100712352 284
233 3300005367 Ga0070667_100216661 Ga0070667_1002166612 284
234 3300005548 Ga0070665_100002110 Ga0070665_10000211021 284
235 3300005618 Ga0068864_100015354 Ga0068864_1000153542 284
236 3300005841 Ga0068863_100000005 Ga0068863_10000000512 284
237 3300005842 Ga0068858_100263087 Ga0068858_1002630872 284
238 3300005843 Ga0068860_100000192 Ga0068860_10000019212 284
239 3300025903 Ga0207680_10075050 Ga0207680_100750501 284
240 3300025986 Ga0207658_10212105 Ga0207658_102121052 284
241 3300026035 Ga0207703_10090131 Ga0207703_100901312 284
242 3300026088 Ga0207641_10000064 Ga0207641_1000006479 284
243 3300026095 Ga0207676_10031047 Ga0207676_100310473 284
244 3300028379 Ga0268266_10154316 Ga0268266_101543162 284
245 3300028381 Ga0268264_10000018 Ga0268264_1000001884 284
246 3300048924 Ga0496121_0051685 Ga0496121_0051685_57_944 284
247 iso_pu_bacteria 2738541275 2738712332 288
248 iso_pu_bacteria 2738541301 2738850757 288
249 iso_pu_bacteria 2738541304 2738866486 288
250 iso_pu_bacteria 2738543022 2739299004 288
251 iso_pu_bacteria 2738543033 2739360682 288
252 iso_pu_bacteria 2928100450 2928103341 288
253 iso_pu_bacteria 2928959182 2928962577 288
254 2162886007 SwRhRL2b_contig_281986 SwRhRL2b_0301.00002900 292
255 3300005289 Ga0065704_10070388 Ga0065704_1007038827 292
256 3300005347 Ga0070668_100051738 Ga0070668_1000517382 292
257 3300005353 Ga0070669_100000394 Ga0070669_10000039421 292
258 3300005367 Ga0070667_100000984 Ga0070667_10000098411 292
259 3300005548 Ga0070665_100006374 Ga0070665_1000063746 292
260 3300005842 Ga0068858_100212717 Ga0068858_1002127171 292
261 3300005843 Ga0068860_100075244 Ga0068860_1000752443 292
262 3300005844 Ga0068862_100072689 Ga0068862_1000726893 292
263 3300009092 Ga0105250_10031771 Ga0105250_100317712 292
264 3300009177 Ga0105248_10077220 Ga0105248_100772203 292
265 3300013306 Ga0163162_10008796 Ga0163162_100087962 292
266 3300025923 Ga0207681_10000164 Ga0207681_1000016417 292
267 3300025941 Ga0207711_10099270 Ga0207711_100992702 292
268 3300025961 Ga0207712_10162472 Ga0207712_101624721 292
269 3300025972 Ga0207668_10028141 Ga0207668_100281413 292
270 3300025986 Ga0207658_10000366 Ga0207658_1000036611 292
271 3300028379 Ga0268266_10002815 Ga0268266_1000281515 292
272 3300028381 Ga0268264_10058640 Ga0268264_100586402 292
273 3300048903 Ga0496100_0077770 Ga0496100_0077770_1015_1893 292
274 3300048905 Ga0496102_0000510 Ga0496102_0000510_13155_14033 292
275 3300048906 Ga0496103_0000487 Ga0496103_0000487_19017_19895 292
276 3300048908 Ga0496105_0000420 Ga0496105_0000420_19810_20688 292
277 3300048914 Ga0496111_0170587 Ga0496111_0170587_330_1208 292
278 3300048915 Ga0496112_0326027 Ga0496112_0326027_251_1129 292
279 3300048916 Ga0496113_0000228 Ga0496113_0000228_8635_9513 292
280 3300048920 Ga0496117_0002509 Ga0496117_0002509_12933_13811 292
281 3300048921 Ga0496118_0004102 Ga0496118_0004102_8074_8952 292
282 3300048922 Ga0496119_0000917 Ga0496119_0000917_35434_36312 292
283 3300048925 Ga0496122_0003405 Ga0496122_0003405_4695_5573 292
284 3300048926 Ga0496123_0002568 Ga0496123_0002568_15352_16230 292
285 3300048927 Ga0496124_0002639 Ga0496124_0002639_13371_14249 292
286 3300048928 Ga0496125_0004673 Ga0496125_0004673_1664_2542 292
287 3300048929 Ga0496126_0000903 Ga0496126_0000903_37483_38361 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09694

Gcw_chp

Bacterial protein of unknown function (Gcw_chp)

42

298

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o21-assembly1.cif.gz_B structure of bdellovibrio bacteriovorus bd1075 0.7218 106 146
7o21-assembly1.cif.gz_A structure of bdellovibrio bacteriovorus bd1075 0.7104 106 146
4e1t-assembly1.cif.gz_A x-ray crystal structure of the transmembrane beta-domain from invasin from yersinia pseudotuberculosis 0.6708 44 292
7pge-assembly1.cif.gz_B copper transporter pcob 0.6028 42 292
7pge-assembly1.cif.gz_B copper transporter pcob 0.5982 42 292
ID Description Score Start End Superfamily
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.8239 44 292 2.40.160.40
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.8106 44 292 2.40.160.40
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7149 106 145 3.10.450.50
2wjrA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.7103 42 292 2.40.160.40
2wjrA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.7016 42 292 2.40.160.40
ID Description Score Start End GO Terms
AF-A0A520HEY2-F1-model_v4 Porin 0.9485 45 292
AF-A0A4R2T1E3-F1-model_v4 Uncharacterized protein (TIGR02001 family) 0.946 33 292
AF-A0A1H7CFS8-F1-model_v4 MetA-pathway of phenol degradation 0.9455 33 292
AF-A0A4Q3ICG3-F1-model_v4 Porin 0.9444 33 292
AF-F6IMJ1-F1-model_v4 Porin domain-containing protein 0.9439 33 292

Feature Viewer

pLDDT pTM Quality
81.5 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map