F387789

General Info

Members Datasets Scaffolds Average Seq Length
287 198 574 263

Family's Representative Sequence

Representative Sequence 3300003373|JGI25407J50210_10012417|JGI25407J50210_100124173
Length 286
Sequence MTAPTTQTPYLPVVATPPMPETPLQRLRWAVVDAWTVTGRDLAHWIREPATLVMNLLFMVMVVLMFGYLFGGAMTVPGGGDYREFLLPGMFALSMLFGVESTMVAVTTDAARGVTDRFRSMPMARSAVVAGRGLADMLXSVLGLGVLLACGLLVGWSWHNGAAEALAAVALLLLLRFALIWVGVYLGLLVRNPEAVMAVQILVWPLGFLSNAIAPTATMPGWLGAVAEWNPVSATVSATRELFGNPGWGGASWADQHAPLLAVLWPLLILAVFVPLAVRRWQRLSR

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
35 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
58 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
59 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
60 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
61 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
62 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
75 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
76 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
77 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
78 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
80 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
83 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
98 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
99 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
100 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
101 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
102 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
103 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
104 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
105 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
106 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
107 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
108 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
165 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
166 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
167 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
168 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
172 2547132424 Nocardia nova SH22a Isolate Unclassified
173 2558860280 Kutzneria sp. 744 Isolate Unclassified
174 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
175 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
176 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
177 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
178 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
179 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
180 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
181 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
182 2858868258 Micromonospora sp. MH33 Isolate Unclassified
183 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
184 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
185 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
186 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
187 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
188 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
189 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
190 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
191 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
192 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
193 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
194 2902582711 Micromonospora sp. AP08 Isolate Unclassified
195 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
196 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
197 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
198 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.9
Metatranscriptomes 0.35
Isolates 9.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 1.74
Rhizosphere 85.02
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10012417 3300003373 Bacteria 2184
2 JGI25406J46586_10007183 3300003203 Bacteria 5100
3 JGI25407J50210_10024056 3300003373 Bacteria 1581
4 JGI25407J50210_10024115 3300003373 Bacteria 1578
5 JGI25407J50210_10025017 3300003373 Bacteria 1548
6 Ga0070658_10041901 3300005327 Bacteria 3694
7 Ga0070683_100181717 3300005329 Bacteria 1997
8 Ga0070680_100002587 3300005336 Bacteria 13390
9 Ga0070668_100042540 3300005347 Bacteria 3482
10 Ga0070674_100102315 3300005356 Bacteria 2089
11 Ga0070714_100003541 3300005435 Bacteria 11673
12 Ga0070714_100023382 3300005435 Bacteria 5076
13 Ga0070714_100048883 3300005435 Bacteria 3599
14 Ga0070714_100194780 3300005435 Bacteria 1851
15 Ga0070713_100005374 3300005436 Bacteria 8749
16 Ga0070713_100172696 3300005436 Bacteria 1937
17 Ga0070710_10022419 3300005437 Bacteria 3302
18 Ga0070711_100123239 3300005439 Bacteria 1920
19 Ga0070681_10032295 3300005458 Bacteria 5253
20 Ga0070706_100025707 3300005467 Bacteria 5419
21 Ga0070707_100097258 3300005468 Bacteria 2851
22 Ga0070707_100503914 3300005468 Bacteria 1172
23 Ga0070698_100028219 3300005471 Bacteria 5832
24 Ga0070698_100485642 3300005471 Bacteria 1172
25 Ga0070699_100054663 3300005518 Bacteria 3456
26 Ga0070679_100126433 3300005530 Bacteria 2539
27 Ga0070665_100081683 3300005548 Bacteria 3237
28 Ga0068856_100352705 3300005614 Bacteria 1490
29 Ga0068852_100076827 3300005616 Bacteria 2949
30 Ga0068852_100563872 3300005616 Bacteria 1140
31 Ga0068860_100262079 3300005843 Bacteria 1685
32 Ga0081455_10311587 3300005937 Bacteria 1125
33 Ga0081538_10000248 3300005981 Bacteria 61111
34 Ga0081538_10004325 3300005981 Bacteria 13131
35 Ga0081538_10007298 3300005981 Bacteria 9581
36 Ga0081538_10008227 3300005981 Bacteria 8892
37 Ga0081538_10009449 3300005981 Bacteria 8143
38 Ga0081538_10018786 3300005981 Bacteria 5172
39 Ga0081538_10020394 3300005981 Bacteria 4880
40 Ga0081538_10021477 3300005981 Bacteria 4711
41 Ga0081538_10036158 3300005981 Bacteria 3229
42 Ga0081538_10036204 3300005981 Bacteria 3225
43 Ga0081540_1032656 3300005983 Bacteria 2838
44 Ga0081539_10000086 3300005985 Bacteria 217801
45 Ga0070717_10010674 3300006028 Bacteria 6944
46 Ga0070717_10073041 3300006028 Bacteria 2866
47 Ga0070717_10088414 3300006028 Bacteria 2611
48 Ga0070717_10161607 3300006028 Bacteria 1943
49 Ga0070716_100064872 3300006173 Bacteria 2125
50 Ga0070712_100059985 3300006175 Bacteria 2681
51 Ga0070712_100483293 3300006175 Bacteria 1036
52 Ga0075435_100472034 3300007076 Bacteria 1083
53 Ga0105245_10677157 3300009098 Bacteria 1063
54 Ga0114129_10010668 3300009147 Bacteria 13102
55 Ga0114129_11139909 3300009147 Bacteria 974
56 Ga0157370_10177608 3300013104 Bacteria 1979
57 Ga0206356_10742523 3300020070 Bacteria 1444
58 Ga0213875_10009346 3300021388 Bacteria 4972
59 Ga0213875_10009849 3300021388 Bacteria 4818
60 Ga0207699_10109745 3300025906 Bacteria 1766
61 Ga0207699_10204901 3300025906 Bacteria 1339
62 Ga0207684_10006268 3300025910 Bacteria 10859
63 Ga0207684_10015893 3300025910 Bacteria 6469
64 Ga0207707_10349463 3300025912 Bacteria 1274
65 Ga0207693_10079032 3300025915 Bacteria 2574
66 Ga0207693_10120885 3300025915 Bacteria 2057
67 Ga0207663_10113548 3300025916 Bacteria 1842
68 Ga0207660_10054597 3300025917 Bacteria 2852
69 Ga0207657_10050030 3300025919 Bacteria 3639
70 Ga0207646_10018306 3300025922 Bacteria 6536
71 Ga0207646_10083761 3300025922 Bacteria 2852
72 Ga0207646_10247772 3300025922 Bacteria 1609
73 Ga0207687_10289110 3300025927 Bacteria 1317
74 Ga0207700_10037660 3300025928 Bacteria 3504
75 Ga0207700_10230241 3300025928 Bacteria 1575
76 Ga0207664_10013605 3300025929 Bacteria 5849
77 Ga0207664_10017422 3300025929 Bacteria 5265
78 Ga0207664_10037648 3300025929 Bacteria 3746
79 Ga0207664_10131965 3300025929 Bacteria 2103
80 Ga0207664_10153607 3300025929 Bacteria 1957
81 Ga0207664_10580176 3300025929 Bacteria 1007
82 Ga0207669_10035457 3300025937 Bacteria 2839
83 Ga0207665_10101914 3300025939 Bacteria 2005
84 Ga0207665_10119067 3300025939 Bacteria 1863
85 Ga0207661_10262564 3300025944 Bacteria 1539
86 Ga0207668_10053257 3300025972 Bacteria 2803
87 Ga0207668_10463913 3300025972 Bacteria 1083
88 Ga0207658_10322471 3300025986 Bacteria 1338
89 Ga0207639_10156304 3300026041 Bacteria 1916
90 Ga0207678_10237033 3300026067 Bacteria 1562
91 Ga0207702_10045373 3300026078 Bacteria 3697
92 Ga0207675_100975479 3300026118 Bacteria 865
93 Ga0207698_10209290 3300026142 Bacteria 1753
94 Ga0268266_10353466 3300028379 Bacteria 1381
95 Ga0307515_10071660 3300028794 Bacteria 4692
96 Ga0307515_10096646 3300028794 Bacteria 3620
97 Ga0307515_10139013 3300028794 Bacteria 2618
98 Ga0307511_10001620 3300030521 Bacteria 23827
99 Ga0307512_10020182 3300030522 Bacteria 6042
100 Ga0307513_10000545 3300031456 Bacteria 53833
101 Ga0307513_10029725 3300031456 Bacteria 6222
102 Ga0307513_10032397 3300031456 Bacteria 5895
103 Ga0307509_10124472 3300031507 Bacteria 2548
104 Ga0307508_10018654 3300031616 Bacteria 6305
105 Ga0307405_10007485 3300031731 Bacteria 5465
106 Ga0307405_10058914 3300031731 Bacteria 2419
107 Ga0307405_10152232 3300031731 Bacteria 1628
108 Ga0307405_10272011 3300031731 Bacteria 1271
109 Ga0307413_10023451 3300031824 Bacteria 3345
110 Ga0307410_10093547 3300031852 Bacteria 2139
111 Ga0307406_10007688 3300031901 Bacteria 5986
112 Ga0307406_10051909 3300031901 Bacteria 2606
113 Ga0307406_10111158 3300031901 Bacteria 1887
114 Ga0307407_10022373 3300031903 Bacteria 3279
115 Ga0307407_10125825 3300031903 Bacteria 1632
116 Ga0307407_10245105 3300031903 Bacteria 1225
117 Ga0307412_10142551 3300031911 Bacteria 1757
118 Ga0307409_100071732 3300031995 Bacteria 2755
119 Ga0307409_100086589 3300031995 Bacteria 2551
120 Ga0307416_100000537 3300032002 Bacteria 19365
121 Ga0307416_100139878 3300032002 Bacteria 2198
122 Ga0307416_100256639 3300032002 Bacteria 1705
123 Ga0307414_10656621 3300032004 Bacteria 946
124 Ga0307411_10145495 3300032005 Bacteria 1754
125 Ga0307415_100000060 3300032126 Bacteria 45727
126 Ga0307415_100130639 3300032126 Bacteria 1901
127 Ga0307415_100168939 3300032126 Bacteria 1703
128 Ga0307415_100405810 3300032126 Bacteria 1165
129 Ga0307507_10013871 3300033179 Bacteria 9706
130 Ga0373938_0009925 3300034957 Bacteria 1735
131 Ga0373934_0008829 3300035086 Bacteria 3765
132 Ga0373944_0000897 3300035089 Bacteria 7325
133 Ga0373923_0005561 3300035111 Bacteria 4285
134 Ga0373923_0256136 3300035111 Bacteria 820
135 Ga0373936_0027773 3300035113 Bacteria 2220
136 Ga0373945_0000012 3300035116 Bacteria 37996
137 Ga0373953_0105719 3300035117 Bacteria 1187
138 Ga0373956_0030634 3300035119 Bacteria 2353
139 Ga0373957_0038371 3300035120 Bacteria 1793
140 Ga0373943_0000289 3300035170 Bacteria 20838
141 Ga0373946_0000039 3300035171 Bacteria 33079
142 Ga0373955_0021171 3300035172 Bacteria 3278
143 Ga0373955_0086134 3300035172 Bacteria 1784
144 Ga0373924_0006321 3300035410 Bacteria 4239
145 Ga0373924_0049172 3300035410 Bacteria 1744
146 Ga0373935_0000294 3300035692 Bacteria 24704
147 Ga0373935_0302865 3300035692 Bacteria 1130
148 Ga0373927_0002206 3300035695 Bacteria 14316
149 Ga0373947_0000351 3300035725 Bacteria 26026
150 Ga0373937_0026087 3300036401 Bacteria 5280
151 Ga0373937_0078725 3300036401 Bacteria 3046
152 Ga0373925_0000114 3300037068 Bacteria 86389
153 Ga0373925_0206021 3300037068 Bacteria 1565
154 Ga0395900_0018852 3300037418 Bacteria 7037
155 Ga0395905_0021177 3300037471 Bacteria 6154
156 Ga0436364_0037760 3300037853 Bacteria 3316
157 Ga0436364_1415843 3300037853 Bacteria 9614
158 Ga0436364_1469067 3300037853 Bacteria 7820
159 Ga0395901_0036370 3300038443 Bacteria 5089
160 Ga0439443_017457 3300042003 Bacteria 1104
161 Ga0439448_0017760 3300042005 Bacteria 2175
162 Ga0439448_0042640 3300042005 Bacteria 1471
163 Ga0439451_006827 3300042009 Bacteria 2336
164 Ga0439456_017952 3300042013 Bacteria 1484
165 Ga0439463_024403 3300042016 Bacteria 1515
166 Ga0450900_010907 3300042136 Bacteria 1172
167 Ga0439444_0016253 3300042437 Bacteria 1265
168 Ga0439460_0006328 3300042461 Bacteria 2933
169 Ga0439440_0003850 3300042993 Bacteria 2919
170 Ga0466969_0003439 3300044656 Bacteria 8423
171 Ga0466972_0003778 3300044658 Bacteria 7531
172 Ga0466965_0001463 3300044683 Bacteria 9548
173 Ga0466966_0018246 3300044684 Bacteria 4629
174 Ga0466966_0173524 3300044684 Bacteria 1310
175 Ga0466968_0002407 3300044735 Bacteria 6858
176 Ga0466970_0143682 3300044765 Bacteria 1315
177 Ga0466957_0314512 3300044842 Bacteria 1055
178 Ga0466960_0001517 3300044901 Bacteria 8460
179 Ga0466959_0020137 3300045049 Bacteria 4911
180 Ga0495629_0136329 3300046459 Bacteria 1709
181 Ga0495641_0004585 3300046461 Bacteria 9678
182 Ga0495651_0024255 3300046462 Bacteria 4721
183 Ga0495651_0035692 3300046462 Bacteria 3870
184 Ga0495651_0278324 3300046462 Bacteria 1131
185 Ga0495653_0040607 3300046463 Bacteria 3635
186 Ga0495653_0048603 3300046463 Bacteria 3273
187 Ga0495653_0106742 3300046463 Bacteria 2019
188 Ga0495664_0000598 3300046477 Bacteria 18297
189 Ga0495664_0315965 3300046477 Bacteria 942
190 Ga0495606_0000527 3300046507 Bacteria 61814
191 Ga0495608_0061881 3300046511 Bacteria 2460
192 Ga0495608_0127688 3300046511 Bacteria 1628
193 Ga0495618_0004280 3300046514 Bacteria 8792
194 Ga0495618_0103474 3300046514 Bacteria 1823
195 Ga0495628_0076847 3300046516 Bacteria 2598
196 Ga0495630_0021350 3300046517 Bacteria 4781
197 Ga0495652_0012846 3300046529 Bacteria 7544
198 Ga0495652_0064019 3300046529 Bacteria 3095
199 Ga0495652_0167441 3300046529 Bacteria 1699
200 Ga0495665_0012366 3300046531 Bacteria 4617
201 Ga0495640_0024864 3300046533 Bacteria 4352
202 Ga0495667_0039795 3300046559 Bacteria 3123
203 Ga0495667_0056195 3300046559 Bacteria 2588
204 Ga0495668_0000415 3300046616 Bacteria 55706
205 Ga0495634_0017411 3300046642 Bacteria 5126
206 Ga0495625_0000363 3300046660 Bacteria 69433
207 Ga0495635_0000209 3300046663 Bacteria 37055
208 Ga0495635_0025564 3300046663 Bacteria 4113
209 Ga0495635_0058150 3300046663 Bacteria 2660
210 Ga0495657_0015562 3300046675 Bacteria 5562
211 Ga0495657_0015687 3300046675 Bacteria 5537
212 Ga0495657_0107681 3300046675 Bacteria 1769
213 Ga0495599_0027305 3300046678 Bacteria 3578
214 Ga0495646_0075989 3300046680 Bacteria 1968
215 Ga0495624_0002182 3300046690 Bacteria 14940
216 Ga0495624_0299553 3300046690 Bacteria 970
217 Ga0495600_0013941 3300046809 Bacteria 5065
218 Ga0495600_0017711 3300046809 Bacteria 4534
219 Ga0495581_0024885 3300047315 Bacteria 3468
220 Ga0495581_0084808 3300047315 Bacteria 1836
221 Ga0495604_0034267 3300047317 Bacteria 4018
222 Ga0495674_0000512 3300047319 Bacteria 35529
223 Ga0495680_0036261 3300047322 Bacteria 3961
224 Ga0495680_0044442 3300047322 Bacteria 3512
225 Ga0495683_0109072 3300047323 Bacteria 1323
226 Ga0495684_0001001 3300047471 Bacteria 23006
227 Ga0495684_0035478 3300047471 Bacteria 3825
228 Ga0495684_0035645 3300047471 Bacteria 3814
229 Ga0495602_0389518 3300048088 Bacteria 996
230 Ga0495626_0000052 3300048091 Bacteria 156421
231 Ga0496108_0000158 3300048911 Bacteria 64742
232 Ga0496108_0409934 3300048911 Bacteria 1184
233 Ga0496109_0217025 3300048912 Bacteria 1799
234 Ga0496109_0307694 3300048912 Bacteria 1495
235 Ga0496115_0002744 3300048918 Bacteria 12643
236 Ga0496126_0264354 3300048929 Bacteria 1430
237 Ga0501034_0479933 3300049571 Unclassified 1159
238 Ga0501037_0015758 3300049573 Bacteria 5561
239 Ga0501038_0150766 3300049574 Bacteria 1896
240 Ga0501040_0028432 3300049576 Bacteria 3770
241 Ga0501068_0223537 3300049584 Bacteria 1197
242 Ga0501071_0411850 3300049587 Bacteria 1033
243 Ga0501072_0031276 3300049588 Bacteria 4165
244 Ga0501075_0001874 3300049591 Bacteria 13872
245 Ga0501076_0037764 3300049592 Bacteria 3790
246 Ga0501079_0048190 3300049741 Bacteria 3288
247 Ga0501080_0176461 3300049742 Bacteria 1968
248 Ga0501081_0266089 3300049743 Bacteria 1253
249 Ga0501045_0081008 3300049824 Bacteria 2394
250 Ga0495601_0159568 3300053077 Bacteria 1474
251 Ga0495612_0005752 3300053078 Bacteria 5122
252 Ga0495619_0071732 3300053085 Bacteria 2318
253 Ga0500658_0187572 3300053134 Bacteria 943
254 Ga0590071_025817 3300059421 Bacteria 1393
255 Ga0590075_001252 3300059424 Bacteria 6381
256 Ga0590077_001624 3300059426 Bacteria 5156
257 Ga0501082_0043338 3300060353 Bacteria 3880
258 Ga0530510_0001155 3300061734 Bacteria 17526
259 Ga0530510_0115085 3300061734 Bacteria 1971
260 2548698942 2547132424 Bacteria 8348532
261 2559427192 2558860280 Bacteria 11429938
262 2676496275 2675903060 Bacteria 10051191
263 2753039116 2751185725 Bacteria 5740550
264 2753268766 2751185782 Bacteria 11227053
265 2753327627 2751185792 Bacteria 5739090
266 2768642057 2767802112 Bacteria 6465194
267 2791910590 2791354901 Bacteria 8322202
268 2795786913 2795385470 Bacteria 8317180
269 2795797491 2795385472 Bacteria 6627535
270 2858873019 2858868258 Bacteria 7683772
271 2861528038 2861520306 Bacteria 8348283
272 2866618539 2866612099 Bacteria 7543886
273 2867307377 2867302475 Bacteria 7087181
274 2873319653 2873314349 Bacteria 8512634
275 2884695747 2884693830 Bacteria 11273186
276 2887485116 2887478801 Bacteria 8972725
277 2891398860 2891395885 Bacteria 9251614
278 2891403163 2891395885 Bacteria 9251614
279 2891559969 2891554331 Bacteria 8812224
280 2895438807 2895427314 Bacteria 13147766
281 2895445541 2895442618 Bacteria 11027144
282 2899370014 2899359706 Bacteria 10940472
283 2902584924 2902582711 Bacteria 6187705
284 2925329164 2925326138 Bacteria 9652120
285 3003000376 3002998708 Bacteria 11715108
286 8055067602 8055066027 Bacteria 9479577
287 8055176612 8055172936 Bacteria 9305943
288 JGI25407J50210_10012417
289 JGI25406J46586_10007183
290 JGI25407J50210_10024056
291 JGI25407J50210_10024115
292 JGI25407J50210_10025017
293 Ga0070658_10041901
294 Ga0070683_100181717
295 Ga0070680_100002587
296 Ga0070668_100042540
297 Ga0070674_100102315
298 Ga0070714_100003541
299 Ga0070714_100023382
300 Ga0070714_100048883
301 Ga0070714_100194780
302 Ga0070713_100005374
303 Ga0070713_100172696
304 Ga0070710_10022419
305 Ga0070711_100123239
306 Ga0070681_10032295
307 Ga0070706_100025707
308 Ga0070707_100097258
309 Ga0070707_100503914
310 Ga0070698_100028219
311 Ga0070698_100485642
312 Ga0070699_100054663
313 Ga0070679_100126433
314 Ga0070665_100081683
315 Ga0068856_100352705
316 Ga0068852_100076827
317 Ga0068852_100563872
318 Ga0068860_100262079
319 Ga0081455_10311587
320 Ga0081538_10000248
321 Ga0081538_10004325
322 Ga0081538_10007298
323 Ga0081538_10008227
324 Ga0081538_10009449
325 Ga0081538_10018786
326 Ga0081538_10020394
327 Ga0081538_10021477
328 Ga0081538_10036158
329 Ga0081538_10036204
330 Ga0081540_1032656
331 Ga0081539_10000086
332 Ga0070717_10010674
333 Ga0070717_10073041
334 Ga0070717_10088414
335 Ga0070717_10161607
336 Ga0070716_100064872
337 Ga0070712_100059985
338 Ga0070712_100483293
339 Ga0075435_100472034
340 Ga0105245_10677157
341 Ga0114129_10010668
342 Ga0114129_11139909
343 Ga0157370_10177608
344 Ga0206356_10742523
345 Ga0213875_10009346
346 Ga0213875_10009849
347 Ga0207699_10109745
348 Ga0207699_10204901
349 Ga0207684_10006268
350 Ga0207684_10015893
351 Ga0207707_10349463
352 Ga0207693_10079032
353 Ga0207693_10120885
354 Ga0207663_10113548
355 Ga0207660_10054597
356 Ga0207657_10050030
357 Ga0207646_10018306
358 Ga0207646_10083761
359 Ga0207646_10247772
360 Ga0207687_10289110
361 Ga0207700_10037660
362 Ga0207700_10230241
363 Ga0207664_10013605
364 Ga0207664_10017422
365 Ga0207664_10037648
366 Ga0207664_10131965
367 Ga0207664_10153607
368 Ga0207664_10580176
369 Ga0207669_10035457
370 Ga0207665_10101914
371 Ga0207665_10119067
372 Ga0207661_10262564
373 Ga0207668_10053257
374 Ga0207668_10463913
375 Ga0207658_10322471
376 Ga0207639_10156304
377 Ga0207678_10237033
378 Ga0207702_10045373
379 Ga0207675_100975479
380 Ga0207698_10209290
381 Ga0268266_10353466
382 Ga0307515_10071660
383 Ga0307515_10096646
384 Ga0307515_10139013
385 Ga0307511_10001620
386 Ga0307512_10020182
387 Ga0307513_10000545
388 Ga0307513_10029725
389 Ga0307513_10032397
390 Ga0307509_10124472
391 Ga0307508_10018654
392 Ga0307405_10007485
393 Ga0307405_10058914
394 Ga0307405_10152232
395 Ga0307405_10272011
396 Ga0307413_10023451
397 Ga0307410_10093547
398 Ga0307406_10007688
399 Ga0307406_10051909
400 Ga0307406_10111158
401 Ga0307407_10022373
402 Ga0307407_10125825
403 Ga0307407_10245105
404 Ga0307412_10142551
405 Ga0307409_100071732
406 Ga0307409_100086589
407 Ga0307416_100000537
408 Ga0307416_100139878
409 Ga0307416_100256639
410 Ga0307414_10656621
411 Ga0307411_10145495
412 Ga0307415_100000060
413 Ga0307415_100130639
414 Ga0307415_100168939
415 Ga0307415_100405810
416 Ga0307507_10013871
417 Ga0373938_0009925
418 Ga0373934_0008829
419 Ga0373944_0000897
420 Ga0373923_0005561
421 Ga0373923_0256136
422 Ga0373936_0027773
423 Ga0373945_0000012
424 Ga0373953_0105719
425 Ga0373956_0030634
426 Ga0373957_0038371
427 Ga0373943_0000289
428 Ga0373946_0000039
429 Ga0373955_0021171
430 Ga0373955_0086134
431 Ga0373924_0006321
432 Ga0373924_0049172
433 Ga0373935_0000294
434 Ga0373935_0302865
435 Ga0373927_0002206
436 Ga0373947_0000351
437 Ga0373937_0026087
438 Ga0373937_0078725
439 Ga0373925_0000114
440 Ga0373925_0206021
441 Ga0395900_0018852
442 Ga0395905_0021177
443 Ga0436364_0037760
444 Ga0436364_1415843
445 Ga0436364_1469067
446 Ga0395901_0036370
447 Ga0439443_017457
448 Ga0439448_0017760
449 Ga0439448_0042640
450 Ga0439451_006827
451 Ga0439456_017952
452 Ga0439463_024403
453 Ga0450900_010907
454 Ga0439444_0016253
455 Ga0439460_0006328
456 Ga0439440_0003850
457 Ga0466969_0003439
458 Ga0466972_0003778
459 Ga0466965_0001463
460 Ga0466966_0018246
461 Ga0466966_0173524
462 Ga0466968_0002407
463 Ga0466970_0143682
464 Ga0466957_0314512
465 Ga0466960_0001517
466 Ga0466959_0020137
467 Ga0495629_0136329
468 Ga0495641_0004585
469 Ga0495651_0024255
470 Ga0495651_0035692
471 Ga0495651_0278324
472 Ga0495653_0040607
473 Ga0495653_0048603
474 Ga0495653_0106742
475 Ga0495664_0000598
476 Ga0495664_0315965
477 Ga0495606_0000527
478 Ga0495608_0061881
479 Ga0495608_0127688
480 Ga0495618_0004280
481 Ga0495618_0103474
482 Ga0495628_0076847
483 Ga0495630_0021350
484 Ga0495652_0012846
485 Ga0495652_0064019
486 Ga0495652_0167441
487 Ga0495665_0012366
488 Ga0495640_0024864
489 Ga0495667_0039795
490 Ga0495667_0056195
491 Ga0495668_0000415
492 Ga0495634_0017411
493 Ga0495625_0000363
494 Ga0495635_0000209
495 Ga0495635_0025564
496 Ga0495635_0058150
497 Ga0495657_0015562
498 Ga0495657_0015687
499 Ga0495657_0107681
500 Ga0495599_0027305
501 Ga0495646_0075989
502 Ga0495624_0002182
503 Ga0495624_0299553
504 Ga0495600_0013941
505 Ga0495600_0017711
506 Ga0495581_0024885
507 Ga0495581_0084808
508 Ga0495604_0034267
509 Ga0495674_0000512
510 Ga0495680_0036261
511 Ga0495680_0044442
512 Ga0495683_0109072
513 Ga0495684_0001001
514 Ga0495684_0035478
515 Ga0495684_0035645
516 Ga0495602_0389518
517 Ga0495626_0000052
518 Ga0496108_0000158
519 Ga0496108_0409934
520 Ga0496109_0217025
521 Ga0496109_0307694
522 Ga0496115_0002744
523 Ga0496126_0264354
524 Ga0501034_0479933
525 Ga0501037_0015758
526 Ga0501038_0150766
527 Ga0501040_0028432
528 Ga0501068_0223537
529 Ga0501071_0411850
530 Ga0501072_0031276
531 Ga0501075_0001874
532 Ga0501076_0037764
533 Ga0501079_0048190
534 Ga0501080_0176461
535 Ga0501081_0266089
536 Ga0501045_0081008
537 Ga0495601_0159568
538 Ga0495612_0005752
539 Ga0495619_0071732
540 Ga0500658_0187572
541 Ga0590071_025817
542 Ga0590075_001252
543 Ga0590077_001624
544 Ga0501082_0043338
545 Ga0530510_0001155
546 Ga0530510_0115085
547 2548698942
548 2559427192
549 2676496275
550 2753039116
551 2753268766
552 2753327627
553 2768642057
554 2791910590
555 2795786913
556 2795797491
557 2858873019
558 2861528038
559 2866618539
560 2867307377
561 2873319653
562 2884695747
563 2887485116
564 2891398860
565 2891403163
566 2891559969
567 2895438807
568 2895445541
569 2899370014
570 2902584924
571 2925329164
572 3003000376
573 8055067602
574 8055176612

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

33

243

0.89

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

78

279

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hbu-assembly1.cif.gz_A cryo-em structure of the abcg2 e211q mutant bound to atp and magnesium 0.7355 7 257
8p8j-assembly1.cif.gz_B structure of 5d3-fab and nanobody(nb96)-bound abcg2 0.7097 7 257
6hbu-assembly1.cif.gz_A cryo-em structure of the abcg2 e211q mutant bound to atp and magnesium 0.7092 7 257
7nez-assembly1.cif.gz_B structure of topotecan-bound abcg2 0.7064 5 257
6hco-assembly1.cif.gz_A cryo-em structure of the abcg2 e211q mutant bound to estrone 3-sulfate and 5d3-fab 0.7029 5 257
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7929 56 255 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7621 48 253 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7271 32 251 3.40.1710.10
af_Q2G1V6_3_205_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.63 4 256 1.10.3720.10
af_Q2G1V6_3_205_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6232 4 256 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A1M5HZZ3-F1-model_v4 Transport permease protein 0.9704 2 261 GO:0043190
GO:0140359
AF-A0A7W3TD56-F1-model_v4 Transport permease protein 0.9673 4 261 GO:0043190
GO:0140359
AF-A0A3R7I8M5-F1-model_v4 Transport permease protein 0.9672 1 261 GO:0043190
GO:0140359
AF-A0A4V6PCY3-F1-model_v4 Transport permease protein 0.9659 1 261 GO:0043190
GO:0140359
AF-A0A3R7I8M5-F1-model_v4 Transport permease protein 0.9636 1 261 GO:0043190
GO:0140359

Map