F387787
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 287 | 164 | 269 | 160 |
Family's Representative Sequence
| Representative Sequence | 3300003323|rootH1_10168466|rootH1_101684663 |
| Length | 176 |
| Sequence | MTTKLHSEVNNLIALYMQFSENSRVWIYQSDRKLTDDEVQQVQQHLNKFTTQWTAHNNQLKAKGEVRYNRFLILIVDESHAGASGCSIDKSVHFMKQLEQEFNINLFDRFNLAYREGEEVLSLPRHDFEELLKQGKLNKESIVYNNLVQNLAELNTKWEVPFKDSWHIQLFGNLVQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 3 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 4 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 5 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 6 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 7 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 8 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 9 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 10 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 11 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 12 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 13 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 14 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 15 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 16 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 17 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 18 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 19 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 20 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 21 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 22 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 23 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 24 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 25 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 26 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 27 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 28 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 29 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 30 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 70 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 71 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 72 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 75 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 79 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 104 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 105 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 106 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 107 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 108 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 109 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 110 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 111 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 112 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 113 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 114 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 115 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 116 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 117 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 118 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 119 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 120 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 121 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 122 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 123 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 124 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 153 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 154 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 156 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 157 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 158 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 159 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 160 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 161 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 162 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 163 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 164 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.68 |
| Metatranscriptomes | 0.7 |
| Isolates | 6.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.15 |
| Nodule | 0 |
| Rhizoplane | 2.09 |
| Rhizosphere | 77.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10051845 | 3300001979 | Bacteria | 1172 |
| 2 | JGI24737J22298_10001256 | 3300001990 | Bacteria | 8983 |
| 3 | JGI24737J22298_10005387 | 3300001990 | Bacteria | 4418 |
| 4 | JGI24735J21928_10000015 | 3300002067 | Bacteria | 167231 |
| 5 | JGI25162J39368_1000047 | 3300002737 | Viruses | 167507 |
| 6 | JGI25162J39368_1003374 | 3300002737 | Bacteria | 4718 |
| 7 | JGI25164J39214_1001118 | 3300002772 | Bacteria | 7644 |
| 8 | JGI25165J46597_1001696 | 3300003214 | Bacteria | 9921 |
| 9 | rootH1_10010672 | 3300003316 | Bacteria | 12359 |
| 10 | rootH1_10010672 | 3300003323 | Bacteria | 1707 |
| 11 | rootH2_10008596 | 3300003320 | Bacteria | 5264 |
| 12 | rootH2_10017421 | 3300003320 | Bacteria | 26803 |
| 13 | rootL2_10268507 | 3300003322 | Bacteria | 1260 |
| 14 | rootH1_10009220 | 3300003323 | Bacteria | 22214 |
| 15 | rootH1_10009221 | 3300003323 | Bacteria | 3380 |
| 16 | rootH1_10026050 | 3300003323 | Bacteria | 2302 |
| 17 | rootH1_10168466 | 3300003323 | Bacteria | 2667 |
| 18 | Ga0055530_10003073 | 3300003791 | Bacteria | 9924 |
| 19 | Ga0065714_10106413 | 3300005288 | Bacteria | 1543 |
| 20 | Ga0065714_10221592 | 3300005288 | Bacteria | 839 |
| 21 | Ga0065714_10299240 | 3300005288 | Bacteria | 696 |
| 22 | Ga0065714_10510171 | 3300005288 | Bacteria | 518 |
| 23 | Ga0070658_10578866 | 3300005327 | Bacteria | 972 |
| 24 | Ga0070680_100011377 | 3300005336 | Bacteria | 6882 |
| 25 | Ga0070691_10156066 | 3300005341 | Bacteria | 1173 |
| 26 | Ga0070671_100008871 | 3300005355 | Bacteria | 8069 |
| 27 | Ga0070674_100660723 | 3300005356 | Unclassified | 889 |
| 28 | Ga0070663_100016565 | 3300005455 | Bacteria | 4792 |
| 29 | Ga0070681_10022138 | 3300005458 | Bacteria | 6378 |
| 30 | Ga0070679_100036558 | 3300005530 | Bacteria | 4873 |
| 31 | Ga0068853_100124518 | 3300005539 | Bacteria | 2302 |
| 32 | Ga0068853_100156749 | 3300005539 | Bacteria | 2052 |
| 33 | Ga0068855_100000043 | 3300005563 | Bacteria | 149118 |
| 34 | Ga0068855_100004378 | 3300005563 | Bacteria | 17254 |
| 35 | Ga0068855_100112248 | 3300005563 | Bacteria | 3128 |
| 36 | Ga0068855_100621651 | 3300005563 | Bacteria | 1163 |
| 37 | Ga0068857_100014917 | 3300005577 | Bacteria | 6777 |
| 38 | Ga0068854_100591208 | 3300005578 | Bacteria | 946 |
| 39 | Ga0068856_100000824 | 3300005614 | Bacteria | 33487 |
| 40 | Ga0068856_100058154 | 3300005614 | Bacteria | 3818 |
| 41 | Ga0068856_100139279 | 3300005614 | Bacteria | 2433 |
| 42 | Ga0068852_100306651 | 3300005616 | Bacteria | 1538 |
| 43 | Ga0068864_100146033 | 3300005618 | Bacteria | 2138 |
| 44 | Ga0068851_10265547 | 3300005834 | Bacteria | 977 |
| 45 | Ga0068858_100062835 | 3300005842 | Bacteria | 3434 |
| 46 | Ga0070715_10154591 | 3300006163 | Bacteria | 1127 |
| 47 | Ga0075366_10002961 | 3300006195 | Bacteria | 8842 |
| 48 | Ga0075366_10005018 | 3300006195 | Bacteria | 7148 |
| 49 | Ga0075366_10023157 | 3300006195 | Bacteria | 3618 |
| 50 | Ga0097621_100590297 | 3300006237 | Viruses | 1014 |
| 51 | Ga0105244_10026368 | 3300009036 | Bacteria | 3146 |
| 52 | Ga0105244_10251007 | 3300009036 | Bacteria | 825 |
| 53 | Ga0105240_10000173 | 3300009093 | Bacteria | 131281 |
| 54 | Ga0105240_10012925 | 3300009093 | Bacteria | 11499 |
| 55 | Ga0105240_10042668 | 3300009093 | Bacteria | 5779 |
| 56 | Ga0105240_10072460 | 3300009093 | Bacteria | 4257 |
| 57 | Ga0105240_10179140 | 3300009093 | Bacteria | 2503 |
| 58 | Ga0105240_10381862 | 3300009093 | Bacteria | 1591 |
| 59 | Ga0105245_10141394 | 3300009098 | Bacteria | 2267 |
| 60 | Ga0105241_10079187 | 3300009174 | Bacteria | 2569 |
| 61 | Ga0105241_10141653 | 3300009174 | Bacteria | 1958 |
| 62 | Ga0105241_10151416 | 3300009174 | Bacteria | 1898 |
| 63 | Ga0105241_10806223 | 3300009174 | Bacteria | 865 |
| 64 | Ga0105241_10806226 | 3300009174 | Bacteria | 865 |
| 65 | Ga0105242_10179856 | 3300009176 | Bacteria | 1865 |
| 66 | Ga0105237_10006614 | 3300009545 | Bacteria | 12813 |
| 67 | Ga0105237_10009764 | 3300009545 | Bacteria | 10266 |
| 68 | Ga0105237_10050483 | 3300009545 | Viruses | 4180 |
| 69 | Ga0105237_10093733 | 3300009545 | Viruses | 2992 |
| 70 | Ga0105237_10388422 | 3300009545 | Bacteria | 1401 |
| 71 | Ga0105237_11196531 | 3300009545 | Unclassified | 766 |
| 72 | Ga0105238_10053480 | 3300009551 | Bacteria | 4057 |
| 73 | Ga0105238_10265577 | 3300009551 | Bacteria | 1696 |
| 74 | Ga0105249_10454660 | 3300009553 | Bacteria | 1320 |
| 75 | Ga0105239_10000015 | 3300010375 | Bacteria | 319892 |
| 76 | Ga0105239_10000222 | 3300010375 | Bacteria | 83623 |
| 77 | Ga0105239_10027959 | 3300010375 | Bacteria | 6205 |
| 78 | Ga0105239_10035191 | 3300010375 | Bacteria | 5500 |
| 79 | Ga0105239_10099441 | 3300010375 | Viruses | 3216 |
| 80 | Ga0105239_10107981 | 3300010375 | Bacteria | 3083 |
| 81 | Ga0105239_10129657 | 3300010375 | Bacteria | 2804 |
| 82 | Ga0105239_11850207 | 3300010375 | Bacteria | 700 |
| 83 | Ga0157373_10002151 | 3300013100 | Bacteria | 14917 |
| 84 | Ga0157373_11117393 | 3300013100 | Bacteria | 592 |
| 85 | Ga0157371_10000180 | 3300013102 | Bacteria | 92616 |
| 86 | Ga0157371_10001187 | 3300013102 | Bacteria | 27903 |
| 87 | Ga0157371_10002167 | 3300013102 | Bacteria | 19107 |
| 88 | Ga0157371_10003500 | 3300013102 | Bacteria | 14192 |
| 89 | Ga0157370_10011048 | 3300013104 | Bacteria | 9469 |
| 90 | Ga0157370_10011928 | 3300013104 | Bacteria | 9060 |
| 91 | Ga0157370_10016025 | 3300013104 | Bacteria | 7602 |
| 92 | Ga0157370_10074362 | 3300013104 | Bacteria | 3205 |
| 93 | Ga0157370_10090647 | 3300013104 | Bacteria | 2870 |
| 94 | Ga0157370_10171295 | 3300013104 | Bacteria | 2018 |
| 95 | Ga0157370_10218801 | 3300013104 | Unclassified | 1764 |
| 96 | Ga0157370_10381228 | 3300013104 | Bacteria | 1299 |
| 97 | Ga0157370_10562202 | 3300013104 | Bacteria | 1045 |
| 98 | Ga0157370_11080226 | 3300013104 | Bacteria | 725 |
| 99 | Ga0157370_11283552 | 3300013104 | Bacteria | 660 |
| 100 | Ga0157369_10000566 | 3300013105 | Bacteria | 48674 |
| 101 | Ga0157369_10030669 | 3300013105 | Bacteria | 5928 |
| 102 | Ga0157369_10297283 | 3300013105 | Bacteria | 1680 |
| 103 | Ga0157374_10512615 | 3300013296 | Bacteria | 1205 |
| 104 | Ga0157374_11626615 | 3300013296 | Bacteria | 670 |
| 105 | Ga0163162_10014253 | 3300013306 | Bacteria | 7766 |
| 106 | Ga0163162_10028471 | 3300013306 | Bacteria | 5529 |
| 107 | Ga0163162_10084824 | 3300013306 | Bacteria | 3244 |
| 108 | Ga0163162_10090725 | 3300013306 | Bacteria | 3137 |
| 109 | Ga0163162_10762946 | 3300013306 | Viruses | 1086 |
| 110 | Ga0163162_12269146 | 3300013306 | Bacteria | 623 |
| 111 | Ga0157372_10000020 | 3300013307 | Bacteria | 208056 |
| 112 | Ga0157372_10002236 | 3300013307 | Bacteria | 21010 |
| 113 | Ga0157372_10003829 | 3300013307 | Bacteria | 16174 |
| 114 | Ga0157372_10252016 | 3300013307 | Unclassified | 2049 |
| 115 | Ga0157375_10558617 | 3300013308 | Bacteria | 1306 |
| 116 | Ga0157375_13347932 | 3300013308 | Bacteria | 534 |
| 117 | Ga0182008_10002211 | 3300014497 | Bacteria | 12335 |
| 118 | Ga0182006_1002222 | 3300015261 | Bacteria | 10750 |
| 119 | Ga0182006_1114798 | 3300015261 | Bacteria | 942 |
| 120 | Ga0183373_1001 | 3300015682 | Bacteria | 1410374 |
| 121 | Ga0163161_10004072 | 3300017792 | Bacteria | 10222 |
| 122 | Ga0163161_10004396 | 3300017792 | Bacteria | 9831 |
| 123 | Ga0163161_10070351 | 3300017792 | Bacteria | 2558 |
| 124 | Ga0163161_10211923 | 3300017792 | Bacteria | 1497 |
| 125 | Ga0206351_10780580 | 3300020077 | Unclassified | 1555 |
| 126 | Ga0154015_1607702 | 3300020610 | Unclassified | 1138 |
| 127 | Ga0209563_105803 | 3300025230 | Bacteria | 2193 |
| 128 | Ga0207427_100025 | 3300025231 | Bacteria | 433726 |
| 129 | Ga0209437_100010 | 3300025233 | Bacteria | 838447 |
| 130 | Ga0209437_100089 | 3300025233 | Bacteria | 250476 |
| 131 | Ga0209026_1004148 | 3300025250 | Bacteria | 4444 |
| 132 | Ga0209026_1004203 | 3300025250 | Bacteria | 4388 |
| 133 | Ga0209129_1013080 | 3300025258 | Viruses | 1851 |
| 134 | Ga0209233_1000017 | 3300025261 | Bacteria | 898076 |
| 135 | Ga0209233_1000929 | 3300025261 | Bacteria | 12753 |
| 136 | Ga0209455_1012172 | 3300025272 | Bacteria | 2074 |
| 137 | Ga0209676_1000008 | 3300025292 | Bacteria | 991778 |
| 138 | Ga0209050_1000055 | 3300025298 | Bacteria | 339254 |
| 139 | Ga0207647_10000035 | 3300025904 | Bacteria | 99177 |
| 140 | Ga0207647_10114181 | 3300025904 | Bacteria | 1596 |
| 141 | Ga0207654_10003275 | 3300025911 | Bacteria | 8187 |
| 142 | Ga0207654_10535381 | 3300025911 | Bacteria | 830 |
| 143 | Ga0207654_10664885 | 3300025911 | Bacteria | 747 |
| 144 | Ga0207707_10007990 | 3300025912 | Bacteria | 9188 |
| 145 | Ga0207695_10000053 | 3300025913 | Bacteria | 396740 |
| 146 | Ga0207695_10038992 | 3300025913 | Bacteria | 5109 |
| 147 | Ga0207695_10045782 | 3300025913 | Bacteria | 4641 |
| 148 | Ga0207695_10050962 | 3300025913 | Bacteria | 4350 |
| 149 | Ga0207695_10170861 | 3300025913 | Bacteria | 2099 |
| 150 | Ga0207695_10186139 | 3300025913 | Bacteria | 1995 |
| 151 | Ga0207695_10223875 | 3300025913 | Viruses | 1788 |
| 152 | Ga0207695_10271171 | 3300025913 | Bacteria | 1592 |
| 153 | Ga0207671_10003316 | 3300025914 | Bacteria | 16180 |
| 154 | Ga0207671_10009242 | 3300025914 | Bacteria | 8259 |
| 155 | Ga0207671_10031236 | 3300025914 | Viruses | 3968 |
| 156 | Ga0207660_10018017 | 3300025917 | Bacteria | 4703 |
| 157 | Ga0207652_10011595 | 3300025921 | Bacteria | 7110 |
| 158 | Ga0207694_10178078 | 3300025924 | Unclassified | 1723 |
| 159 | Ga0207694_10240824 | 3300025924 | Bacteria | 1478 |
| 160 | Ga0207687_10425338 | 3300025927 | Bacteria | 1097 |
| 161 | Ga0207644_10001419 | 3300025931 | Bacteria | 15446 |
| 162 | Ga0207669_10594609 | 3300025937 | Unclassified | 898 |
| 163 | Ga0207667_10000015 | 3300025949 | Bacteria | 417534 |
| 164 | Ga0207667_10004375 | 3300025949 | Bacteria | 17295 |
| 165 | Ga0207667_10051425 | 3300025949 | Viruses | 4344 |
| 166 | Ga0207712_10866867 | 3300025961 | Bacteria | 796 |
| 167 | Ga0207640_10183496 | 3300025981 | Viruses | 1571 |
| 168 | Ga0207639_10185353 | 3300026041 | Bacteria | 1774 |
| 169 | Ga0207639_10431213 | 3300026041 | Bacteria | 1194 |
| 170 | Ga0207678_10029452 | 3300026067 | Bacteria | 4792 |
| 171 | Ga0207702_10000165 | 3300026078 | Bacteria | 79066 |
| 172 | Ga0207702_10041908 | 3300026078 | Bacteria | 3839 |
| 173 | Ga0207702_10286226 | 3300026078 | Bacteria | 1560 |
| 174 | Ga0207674_10034875 | 3300026116 | Bacteria | 5255 |
| 175 | Ga0207674_10808651 | 3300026116 | Bacteria | 904 |
| 176 | Ga0207698_10294861 | 3300026142 | Bacteria | 1507 |
| 177 | Ga0207698_10316367 | 3300026142 | Bacteria | 1460 |
| 178 | Ga0307515_10008511 | 3300028794 | Bacteria | 19989 |
| 179 | Ga0307515_10009260 | 3300028794 | Bacteria | 19062 |
| 180 | Ga0307515_10023678 | 3300028794 | Bacteria | 10742 |
| 181 | Ga0307515_10060249 | 3300028794 | Bacteria | 5419 |
| 182 | Ga0265338_10429819 | 3300028800 | Bacteria | 937 |
| 183 | Ga0307405_10000003 | 3300031731 | Bacteria | 569064 |
| 184 | Ga0307407_10000010 | 3300031903 | Bacteria | 186970 |
| 185 | Ga0307412_10356422 | 3300031911 | Bacteria | 1176 |
| 186 | Ga0307416_100000014 | 3300032002 | Bacteria | 249053 |
| 187 | Ga0307414_10149978 | 3300032004 | Bacteria | 1838 |
| 188 | Ga0307411_10571990 | 3300032005 | Bacteria | 967 |
| 189 | Ga0307507_10002394 | 3300033179 | Bacteria | 39588 |
| 190 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 191 | Ga0395899_0000136 | 3300037312 | Bacteria | 112112 |
| 192 | Ga0395905_0377745 | 3300037471 | Bacteria | 1311 |
| 193 | Ga0395901_0202797 | 3300038443 | Bacteria | 2079 |
| 194 | Ga0395901_0878135 | 3300038443 | Bacteria | 880 |
| 195 | Ga0451789_0917768 | 3300041443 | Bacteria | 555 |
| 196 | Ga0451791_1140709 | 3300041451 | Viruses | 716 |
| 197 | Ga0451807_2647401 | 3300041486 | Bacteria | 545 |
| 198 | Ga0451849_1166478 | 3300041505 | Bacteria | 1163 |
| 199 | Ga0451577_0000240 | 3300042876 | Bacteria | 108418 |
| 200 | Ga0466969_0012582 | 3300044656 | Bacteria | 4460 |
| 201 | Ga0466961_0042565 | 3300044693 | Bacteria | 2911 |
| 202 | Ga0453684_0426553 | 3300044712 | Bacteria | 1480 |
| 203 | Ga0466959_0033030 | 3300045049 | Bacteria | 3829 |
| 204 | Ga0495629_0102113 | 3300046459 | Bacteria | 2001 |
| 205 | Ga0495638_0110290 | 3300046460 | Bacteria | 1635 |
| 206 | Ga0495651_0169904 | 3300046462 | Bacteria | 1554 |
| 207 | Ga0495650_0000023 | 3300046471 | Bacteria | 527763 |
| 208 | Ga0495650_0155468 | 3300046471 | Bacteria | 818 |
| 209 | Ga0495585_0008493 | 3300046492 | Bacteria | 6222 |
| 210 | Ga0495606_0001103 | 3300046507 | Bacteria | 38654 |
| 211 | Ga0495606_0006519 | 3300046507 | Bacteria | 10741 |
| 212 | Ga0495606_0021932 | 3300046507 | Bacteria | 4670 |
| 213 | Ga0495610_0006203 | 3300046512 | Bacteria | 8302 |
| 214 | Ga0495610_0006792 | 3300046512 | Bacteria | 7763 |
| 215 | Ga0495616_0003039 | 3300046513 | Bacteria | 10867 |
| 216 | Ga0495628_0629980 | 3300046516 | Bacteria | 763 |
| 217 | Ga0495637_0018523 | 3300046520 | Bacteria | 3228 |
| 218 | Ga0495644_0033545 | 3300046523 | Bacteria | 1939 |
| 219 | Ga0495648_0001312 | 3300046524 | Bacteria | 24628 |
| 220 | Ga0495642_0139391 | 3300046528 | Bacteria | 1046 |
| 221 | Ga0495652_0255975 | 3300046529 | Bacteria | 1295 |
| 222 | Ga0495652_0617737 | 3300046529 | Bacteria | 737 |
| 223 | Ga0495609_0212068 | 3300046538 | Bacteria | 806 |
| 224 | Ga0495622_0220533 | 3300046557 | Bacteria | 840 |
| 225 | Ga0495633_0000021 | 3300046558 | Bacteria | 227171 |
| 226 | Ga0495633_0006537 | 3300046558 | Bacteria | 6887 |
| 227 | Ga0495633_0305589 | 3300046558 | Unclassified | 722 |
| 228 | Ga0495668_0000075 | 3300046616 | Bacteria | 163092 |
| 229 | Ga0495668_0170307 | 3300046616 | Bacteria | 1193 |
| 230 | Ga0495611_0111296 | 3300046648 | Bacteria | 1275 |
| 231 | Ga0495625_0000018 | 3300046660 | Bacteria | 299567 |
| 232 | Ga0495625_0000439 | 3300046660 | Bacteria | 62433 |
| 233 | Ga0495625_0001162 | 3300046660 | Bacteria | 33895 |
| 234 | Ga0495625_0004744 | 3300046660 | Bacteria | 12723 |
| 235 | Ga0495625_0101343 | 3300046660 | Bacteria | 1978 |
| 236 | Ga0495625_0730650 | 3300046660 | Bacteria | 582 |
| 237 | Ga0495635_0209988 | 3300046663 | Bacteria | 1319 |
| 238 | Ga0495661_0000485 | 3300046665 | Bacteria | 41846 |
| 239 | Ga0495661_0018518 | 3300046665 | Bacteria | 4578 |
| 240 | Ga0495671_0072504 | 3300046692 | Bacteria | 1691 |
| 241 | Ga0495671_0167679 | 3300046692 | Bacteria | 1068 |
| 242 | Ga0495649_0000015 | 3300046694 | Bacteria | 246431 |
| 243 | Ga0495687_006547 | 3300047443 | Bacteria | 7109 |
| 244 | Ga0495687_058666 | 3300047443 | Bacteria | 1596 |
| 245 | Ga0495677_0091383 | 3300047445 | Bacteria | 1147 |
| 246 | Ga0495685_040315 | 3300047447 | Bacteria | 1597 |
| 247 | Ga0495686_0000237 | 3300047472 | Bacteria | 100373 |
| 248 | Ga0495686_0002207 | 3300047472 | Bacteria | 18912 |
| 249 | Ga0495686_0028569 | 3300047472 | Bacteria | 3632 |
| 250 | Ga0495686_0062659 | 3300047472 | Bacteria | 2306 |
| 251 | Ga0495686_0177908 | 3300047472 | Bacteria | 1234 |
| 252 | Ga0496114_1111245 | 3300048917 | Bacteria | 675 |
| 253 | Ga0496115_0061877 | 3300048918 | Bacteria | 3019 |
| 254 | Ga0495678_013312 | 3300049459 | Bacteria | 3867 |
| 255 | Ga0495678_239364 | 3300049459 | Bacteria | 543 |
| 256 | nmdc:mga0k408_2077_c1 | 3300050493 | Bacteria | 10713 |
| 257 | nmdc:mga0k408_3438_c1 | 3300050493 | Bacteria | 8383 |
| 258 | nmdc:mga0k408_7232_c1 | 3300050493 | Bacteria | 5932 |
| 259 | Ga0500646_0053336 | 3300053090 | Bacteria | 1172 |
| 260 | Ga0500608_016757 | 3300053122 | Bacteria | 3317 |
| 261 | Ga0500614_099281 | 3300053123 | Bacteria | 837 |
| 262 | Ga0500618_000012 | 3300053125 | Bacteria | 185382 |
| 263 | Ga0500618_021263 | 3300053125 | Bacteria | 1585 |
| 264 | Ga0500573_0246576 | 3300053140 | Bacteria | 923 |
| 265 | Ga0500616_0268912 | 3300053153 | Viruses | 720 |
| 266 | Ga0500619_067924 | 3300053154 | Bacteria | 1182 |
| 267 | Ga0500622_0005513 | 3300053156 | Bacteria | 7577 |
| 268 | Ga0500622_0153117 | 3300053156 | Bacteria | 1088 |
| 269 | Ga0500634_0226990 | 3300053161 | Bacteria | 796 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041486 | Ga0451807_2647401 | Ga0451807_2647401_54_488 | 141 |
| 2 | 3300041451 | Ga0451791_1140709 | Ga0451791_1140709_35_469 | 144 |
| 3 | 3300025927 | Ga0207687_10425338 | Ga0207687_104253381 | 153 |
| 4 | iso_pu_bacteria | 2739367656 | 2739616892 | 154 |
| 5 | 3300044712 | Ga0453684_0426553 | Ga0453684_0426553_314_823 | 155 |
| 6 | iso_pu_bacteria | 2739367651 | 2739590899 | 155 |
| 7 | iso_pu_bacteria | 2818991437 | 2819546564 | 155 |
| 8 | iso_pu_bacteria | 2842722452 | 2842725263 | 155 |
| 9 | iso_pu_bacteria | 2842909656 | 2842912535 | 155 |
| 10 | iso_pu_bacteria | 2849281842 | 2849286252 | 155 |
| 11 | iso_pu_bacteria | 2857627736 | 2857629679 | 155 |
| 12 | iso_pu_bacteria | 2904445276 | 2904446711 | 155 |
| 13 | iso_pu_bacteria | 2954016120 | 2954019079 | 155 |
| 14 | iso_pu_bacteria | 2739367663 | 2739647239 | 156 |
| 15 | iso_pu_bacteria | 2852623160 | 2852624907 | 156 |
| 16 | iso_pu_bacteria | 2884933994 | 2884936196 | 156 |
| 17 | iso_pu_bacteria | 2919437846 | 2919442778 | 156 |
| 18 | 3300042876 | Ga0451577_0000240 | Ga0451577_0000240_79375_79860 | 157 |
| 19 | iso_pu_bacteria | 2599185184 | 2599479475 | 157 |
| 20 | iso_pu_bacteria | 2902048731 | 2902052594 | 157 |
| 21 | iso_pu_bacteria | 2928078545 | 2928082219 | 157 |
| 22 | iso_pu_bacteria | 2928147474 | 2928149205 | 157 |
| 23 | iso_pu_bacteria | 2932082852 | 2932087734 | 157 |
| 24 | iso_pu_bacteria | 2977232053 | 2977235947 | 157 |
| 25 | 3300003791 | Ga0055530_10003073 | Ga0055530_100030732 | 159 |
| 26 | 3300005288 | Ga0065714_10299240 | Ga0065714_102992401 | 159 |
| 27 | 3300005288 | Ga0065714_10510171 | Ga0065714_105101711 | 159 |
| 28 | 3300005327 | Ga0070658_10578866 | Ga0070658_105788662 | 159 |
| 29 | 3300009036 | Ga0105244_10026368 | Ga0105244_100263683 | 159 |
| 30 | 3300009036 | Ga0105244_10251007 | Ga0105244_102510072 | 159 |
| 31 | 3300013102 | Ga0157371_10000180 | Ga0157371_100001802 | 159 |
| 32 | 3300013102 | Ga0157371_10003500 | Ga0157371_100035005 | 159 |
| 33 | 3300013104 | Ga0157370_10011048 | Ga0157370_100110484 | 159 |
| 34 | 3300013104 | Ga0157370_10011928 | Ga0157370_100119283 | 159 |
| 35 | 3300013104 | Ga0157370_10016025 | Ga0157370_100160254 | 159 |
| 36 | 3300013104 | Ga0157370_10090647 | Ga0157370_100906473 | 159 |
| 37 | 3300013306 | Ga0163162_10090725 | Ga0163162_100907253 | 159 |
| 38 | 3300013308 | Ga0157375_10558617 | Ga0157375_105586172 | 159 |
| 39 | 3300013308 | Ga0157375_13347932 | Ga0157375_133479321 | 159 |
| 40 | 3300014497 | Ga0182008_10002211 | Ga0182008_100022115 | 159 |
| 41 | 3300015261 | Ga0182006_1002222 | Ga0182006_10022224 | 159 |
| 42 | 3300015261 | Ga0182006_1114798 | Ga0182006_11147982 | 159 |
| 43 | 3300015682 | Ga0183373_1001 | Ga0183373_1001459 | 159 |
| 44 | 3300017792 | Ga0163161_10004072 | Ga0163161_100040728 | 159 |
| 45 | 3300017792 | Ga0163161_10004396 | Ga0163161_100043968 | 159 |
| 46 | 3300017792 | Ga0163161_10070351 | Ga0163161_100703512 | 159 |
| 47 | 3300025292 | Ga0209676_1000008 | Ga0209676_1000008359 | 159 |
| 48 | 3300025298 | Ga0209050_1000055 | Ga0209050_100005553 | 159 |
| 49 | 3300026142 | Ga0207698_10294861 | Ga0207698_102948611 | 159 |
| 50 | 3300031731 | Ga0307405_10000003 | Ga0307405_10000003300 | 159 |
| 51 | 3300031903 | Ga0307407_10000010 | Ga0307407_10000010120 | 159 |
| 52 | 3300031911 | Ga0307412_10356422 | Ga0307412_103564223 | 159 |
| 53 | 3300032002 | Ga0307416_100000014 | Ga0307416_100000014111 | 159 |
| 54 | 3300032004 | Ga0307414_10149978 | Ga0307414_101499782 | 159 |
| 55 | 3300032005 | Ga0307411_10571990 | Ga0307411_105719902 | 159 |
| 56 | 3300041443 | Ga0451789_0917768 | Ga0451789_0917768_18_497 | 159 |
| 57 | 3300046507 | Ga0495606_0021932 | Ga0495606_0021932_2551_3030 | 159 |
| 58 | 3300046512 | Ga0495610_0006203 | Ga0495610_0006203_1962_2441 | 159 |
| 59 | 3300046520 | Ga0495637_0018523 | Ga0495637_0018523_1487_1966 | 159 |
| 60 | 3300053140 | Ga0500573_0246576 | Ga0500573_0246576_277_756 | 159 |
| 61 | 3300001990 | JGI24737J22298_10005387 | JGI24737J22298_100053874 | 160 |
| 62 | 3300002737 | JGI25162J39368_1000047 | JGI25162J39368_1000047112 | 160 |
| 63 | 3300002737 | JGI25162J39368_1003374 | JGI25162J39368_10033748 | 160 |
| 64 | 3300002772 | JGI25164J39214_1001118 | JGI25164J39214_100111813 | 160 |
| 65 | 3300003214 | JGI25165J46597_1001696 | JGI25165J46597_100169614 | 160 |
| 66 | 3300003323 | rootH1_10168466 | rootH1_101684663 | 160 |
| 67 | 3300005577 | Ga0068857_100014917 | Ga0068857_1000149173 | 160 |
| 68 | 3300005614 | Ga0068856_100058154 | Ga0068856_1000581544 | 160 |
| 69 | 3300005616 | Ga0068852_100306651 | Ga0068852_1003066512 | 160 |
| 70 | 3300006163 | Ga0070715_10154591 | Ga0070715_101545912 | 160 |
| 71 | 3300009093 | Ga0105240_10381862 | Ga0105240_103818623 | 160 |
| 72 | 3300009176 | Ga0105242_10179856 | Ga0105242_101798562 | 160 |
| 73 | 3300009553 | Ga0105249_10454660 | Ga0105249_104546601 | 160 |
| 74 | 3300010375 | Ga0105239_10107981 | Ga0105239_101079815 | 160 |
| 75 | 3300010375 | Ga0105239_11850207 | Ga0105239_118502072 | 160 |
| 76 | 3300013100 | Ga0157373_10002151 | Ga0157373_1000215111 | 160 |
| 77 | 3300013102 | Ga0157371_10001187 | Ga0157371_100011876 | 160 |
| 78 | 3300013104 | Ga0157370_10074362 | Ga0157370_100743624 | 160 |
| 79 | 3300013104 | Ga0157370_10381228 | Ga0157370_103812282 | 160 |
| 80 | 3300013105 | Ga0157369_10030669 | Ga0157369_100306692 | 160 |
| 81 | 3300013105 | Ga0157369_10297283 | Ga0157369_102972833 | 160 |
| 82 | 3300013296 | Ga0157374_10512615 | Ga0157374_105126152 | 160 |
| 83 | 3300013306 | Ga0163162_10014253 | Ga0163162_100142534 | 160 |
| 84 | 3300013307 | Ga0157372_10002236 | Ga0157372_1000223613 | 160 |
| 85 | 3300017792 | Ga0163161_10211923 | Ga0163161_102119232 | 160 |
| 86 | 3300025230 | Ga0209563_105803 | Ga0209563_1058033 | 160 |
| 87 | 3300025231 | Ga0207427_100025 | Ga0207427_1000257 | 160 |
| 88 | 3300025233 | Ga0209437_100010 | Ga0209437_100010269 | 160 |
| 89 | 3300025233 | Ga0209437_100089 | Ga0209437_100089177 | 160 |
| 90 | 3300025250 | Ga0209026_1004148 | Ga0209026_10041485 | 160 |
| 91 | 3300025250 | Ga0209026_1004203 | Ga0209026_10042034 | 160 |
| 92 | 3300025258 | Ga0209129_1013080 | Ga0209129_10130803 | 160 |
| 93 | 3300025261 | Ga0209233_1000017 | Ga0209233_1000017282 | 160 |
| 94 | 3300025272 | Ga0209455_1012172 | Ga0209455_10121723 | 160 |
| 95 | 3300025904 | Ga0207647_10000035 | Ga0207647_1000003524 | 160 |
| 96 | 3300025913 | Ga0207695_10271171 | Ga0207695_102711713 | 160 |
| 97 | 3300025961 | Ga0207712_10866867 | Ga0207712_108668672 | 160 |
| 98 | 3300026078 | Ga0207702_10041908 | Ga0207702_100419084 | 160 |
| 99 | 3300026116 | Ga0207674_10034875 | Ga0207674_100348754 | 160 |
| 100 | 3300026142 | Ga0207698_10316367 | Ga0207698_103163673 | 160 |
| 101 | 3300046471 | Ga0495650_0155468 | Ga0495650_0155468_54_536 | 160 |
| 102 | 3300046513 | Ga0495616_0003039 | Ga0495616_0003039_4765_5247 | 160 |
| 103 | 3300046529 | Ga0495652_0617737 | Ga0495652_0617737_223_705 | 160 |
| 104 | 3300047443 | Ga0495687_058666 | Ga0495687_058666_906_1388 | 160 |
| 105 | 3300047472 | Ga0495686_0000237 | Ga0495686_0000237_6937_7419 | 160 |
| 106 | 3300049459 | Ga0495678_013312 | Ga0495678_013312_829_1311 | 160 |
| 107 | 3300001979 | JGI24740J21852_10051845 | JGI24740J21852_100518452 | 161 |
| 108 | 3300001990 | JGI24737J22298_10001256 | JGI24737J22298_100012567 | 161 |
| 109 | 3300002067 | JGI24735J21928_10000015 | JGI24735J21928_10000015139 | 161 |
| 110 | 3300003316 | rootH1_10010672 | rootH1_100106729 | 161 |
| 111 | 3300003320 | rootH2_10008596 | rootH2_100085962 | 161 |
| 112 | 3300003320 | rootH2_10017421 | rootH2_100174214 | 161 |
| 113 | 3300003322 | rootL2_10268507 | rootL2_102685072 | 161 |
| 114 | 3300003323 | rootH1_10009220 | rootH1_1000922017 | 161 |
| 115 | 3300003323 | rootH1_10009221 | rootH1_100092214 | 161 |
| 116 | 3300003323 | rootH1_10026050 | rootH1_100260504 | 161 |
| 117 | 3300005288 | Ga0065714_10106413 | Ga0065714_101064132 | 161 |
| 118 | 3300005288 | Ga0065714_10221592 | Ga0065714_102215922 | 161 |
| 119 | 3300005336 | Ga0070680_100011377 | Ga0070680_10001137710 | 161 |
| 120 | 3300005341 | Ga0070691_10156066 | Ga0070691_101560662 | 161 |
| 121 | 3300005355 | Ga0070671_100008871 | Ga0070671_10000887110 | 161 |
| 122 | 3300005356 | Ga0070674_100660723 | Ga0070674_1006607232 | 161 |
| 123 | 3300005455 | Ga0070663_100016565 | Ga0070663_1000165653 | 161 |
| 124 | 3300005458 | Ga0070681_10022138 | Ga0070681_100221386 | 161 |
| 125 | 3300005530 | Ga0070679_100036558 | Ga0070679_1000365583 | 161 |
| 126 | 3300005539 | Ga0068853_100124518 | Ga0068853_1001245184 | 161 |
| 127 | 3300005539 | Ga0068853_100156749 | Ga0068853_1001567492 | 161 |
| 128 | 3300005563 | Ga0068855_100000043 | Ga0068855_10000004351 | 161 |
| 129 | 3300005563 | Ga0068855_100004378 | Ga0068855_1000043786 | 161 |
| 130 | 3300005563 | Ga0068855_100112248 | Ga0068855_1001122484 | 161 |
| 131 | 3300005563 | Ga0068855_100621651 | Ga0068855_1006216512 | 161 |
| 132 | 3300005578 | Ga0068854_100591208 | Ga0068854_1005912082 | 161 |
| 133 | 3300005614 | Ga0068856_100000824 | Ga0068856_10000082428 | 161 |
| 134 | 3300005614 | Ga0068856_100139279 | Ga0068856_1001392793 | 161 |
| 135 | 3300005618 | Ga0068864_100146033 | Ga0068864_1001460332 | 161 |
| 136 | 3300005834 | Ga0068851_10265547 | Ga0068851_102655472 | 161 |
| 137 | 3300005842 | Ga0068858_100062835 | Ga0068858_1000628354 | 161 |
| 138 | 3300006195 | Ga0075366_10002961 | Ga0075366_100029614 | 161 |
| 139 | 3300006195 | Ga0075366_10005018 | Ga0075366_100050185 | 161 |
| 140 | 3300006195 | Ga0075366_10023157 | Ga0075366_100231572 | 161 |
| 141 | 3300006237 | Ga0097621_100590297 | Ga0097621_1005902971 | 161 |
| 142 | 3300009093 | Ga0105240_10000173 | Ga0105240_10000173115 | 161 |
| 143 | 3300009093 | Ga0105240_10012925 | Ga0105240_100129257 | 161 |
| 144 | 3300009093 | Ga0105240_10042668 | Ga0105240_100426686 | 161 |
| 145 | 3300009093 | Ga0105240_10072460 | Ga0105240_100724603 | 161 |
| 146 | 3300009093 | Ga0105240_10179140 | Ga0105240_101791403 | 161 |
| 147 | 3300009098 | Ga0105245_10141394 | Ga0105245_101413942 | 161 |
| 148 | 3300009174 | Ga0105241_10079187 | Ga0105241_100791872 | 161 |
| 149 | 3300009174 | Ga0105241_10141653 | Ga0105241_101416532 | 161 |
| 150 | 3300009174 | Ga0105241_10151416 | Ga0105241_101514163 | 161 |
| 151 | 3300009174 | Ga0105241_10806223 | Ga0105241_108062232 | 161 |
| 152 | 3300009174 | Ga0105241_10806226 | Ga0105241_108062262 | 161 |
| 153 | 3300009545 | Ga0105237_10006614 | Ga0105237_1000661410 | 161 |
| 154 | 3300009545 | Ga0105237_10009764 | Ga0105237_1000976410 | 161 |
| 155 | 3300009545 | Ga0105237_10050483 | Ga0105237_100504833 | 161 |
| 156 | 3300009545 | Ga0105237_10093733 | Ga0105237_100937333 | 161 |
| 157 | 3300009545 | Ga0105237_10388422 | Ga0105237_103884222 | 161 |
| 158 | 3300009545 | Ga0105237_11196531 | Ga0105237_111965311 | 161 |
| 159 | 3300009551 | Ga0105238_10053480 | Ga0105238_100534804 | 161 |
| 160 | 3300009551 | Ga0105238_10265577 | Ga0105238_102655773 | 161 |
| 161 | 3300010375 | Ga0105239_10000015 | Ga0105239_1000001526 | 161 |
| 162 | 3300010375 | Ga0105239_10000222 | Ga0105239_1000022213 | 161 |
| 163 | 3300010375 | Ga0105239_10027959 | Ga0105239_100279593 | 161 |
| 164 | 3300010375 | Ga0105239_10035191 | Ga0105239_100351914 | 161 |
| 165 | 3300010375 | Ga0105239_10099441 | Ga0105239_100994416 | 161 |
| 166 | 3300010375 | Ga0105239_10129657 | Ga0105239_101296575 | 161 |
| 167 | 3300013100 | Ga0157373_11117393 | Ga0157373_111173931 | 161 |
| 168 | 3300013102 | Ga0157371_10002167 | Ga0157371_100021672 | 161 |
| 169 | 3300013104 | Ga0157370_10171295 | Ga0157370_101712953 | 161 |
| 170 | 3300013104 | Ga0157370_10218801 | Ga0157370_102188012 | 161 |
| 171 | 3300013104 | Ga0157370_10562202 | Ga0157370_105622022 | 161 |
| 172 | 3300013104 | Ga0157370_11080226 | Ga0157370_110802262 | 161 |
| 173 | 3300013104 | Ga0157370_11283552 | Ga0157370_112835521 | 161 |
| 174 | 3300013105 | Ga0157369_10000566 | Ga0157369_100005665 | 161 |
| 175 | 3300013296 | Ga0157374_11626615 | Ga0157374_116266151 | 161 |
| 176 | 3300013306 | Ga0163162_10028471 | Ga0163162_100284718 | 161 |
| 177 | 3300013306 | Ga0163162_10084824 | Ga0163162_100848242 | 161 |
| 178 | 3300013306 | Ga0163162_10762946 | Ga0163162_107629462 | 161 |
| 179 | 3300013306 | Ga0163162_12269146 | Ga0163162_122691461 | 161 |
| 180 | 3300013307 | Ga0157372_10000020 | Ga0157372_10000020100 | 161 |
| 181 | 3300013307 | Ga0157372_10003829 | Ga0157372_1000382912 | 161 |
| 182 | 3300013307 | Ga0157372_10252016 | Ga0157372_102520162 | 161 |
| 183 | 3300020077 | Ga0206351_10780580 | Ga0206351_107805802 | 161 |
| 184 | 3300020610 | Ga0154015_1607702 | Ga0154015_16077021 | 161 |
| 185 | 3300025261 | Ga0209233_1000929 | Ga0209233_100092912 | 161 |
| 186 | 3300025904 | Ga0207647_10114181 | Ga0207647_101141812 | 161 |
| 187 | 3300025911 | Ga0207654_10003275 | Ga0207654_100032758 | 161 |
| 188 | 3300025911 | Ga0207654_10535381 | Ga0207654_105353812 | 161 |
| 189 | 3300025911 | Ga0207654_10664885 | Ga0207654_106648851 | 161 |
| 190 | 3300025912 | Ga0207707_10007990 | Ga0207707_1000799010 | 161 |
| 191 | 3300025913 | Ga0207695_10000053 | Ga0207695_1000005341 | 161 |
| 192 | 3300025913 | Ga0207695_10038992 | Ga0207695_100389925 | 161 |
| 193 | 3300025913 | Ga0207695_10045782 | Ga0207695_100457822 | 161 |
| 194 | 3300025913 | Ga0207695_10050962 | Ga0207695_100509624 | 161 |
| 195 | 3300025913 | Ga0207695_10170861 | Ga0207695_101708613 | 161 |
| 196 | 3300025913 | Ga0207695_10186139 | Ga0207695_101861392 | 161 |
| 197 | 3300025913 | Ga0207695_10223875 | Ga0207695_102238752 | 161 |
| 198 | 3300025914 | Ga0207671_10003316 | Ga0207671_1000331610 | 161 |
| 199 | 3300025914 | Ga0207671_10009242 | Ga0207671_100092425 | 161 |
| 200 | 3300025914 | Ga0207671_10031236 | Ga0207671_100312364 | 161 |
| 201 | 3300025917 | Ga0207660_10018017 | Ga0207660_100180177 | 161 |
| 202 | 3300025921 | Ga0207652_10011595 | Ga0207652_100115954 | 161 |
| 203 | 3300025924 | Ga0207694_10178078 | Ga0207694_101780783 | 161 |
| 204 | 3300025924 | Ga0207694_10240824 | Ga0207694_102408242 | 161 |
| 205 | 3300025931 | Ga0207644_10001419 | Ga0207644_1000141918 | 161 |
| 206 | 3300025937 | Ga0207669_10594609 | Ga0207669_105946092 | 161 |
| 207 | 3300025949 | Ga0207667_10000015 | Ga0207667_1000001550 | 161 |
| 208 | 3300025949 | Ga0207667_10004375 | Ga0207667_1000437515 | 161 |
| 209 | 3300025949 | Ga0207667_10051425 | Ga0207667_100514253 | 161 |
| 210 | 3300025981 | Ga0207640_10183496 | Ga0207640_101834962 | 161 |
| 211 | 3300026041 | Ga0207639_10185353 | Ga0207639_101853532 | 161 |
| 212 | 3300026041 | Ga0207639_10431213 | Ga0207639_104312132 | 161 |
| 213 | 3300026067 | Ga0207678_10029452 | Ga0207678_100294523 | 161 |
| 214 | 3300026078 | Ga0207702_10000165 | Ga0207702_1000016520 | 161 |
| 215 | 3300026078 | Ga0207702_10286226 | Ga0207702_102862263 | 161 |
| 216 | 3300026116 | Ga0207674_10808651 | Ga0207674_108086513 | 161 |
| 217 | 3300028794 | Ga0307515_10008511 | Ga0307515_100085118 | 161 |
| 218 | 3300028794 | Ga0307515_10009260 | Ga0307515_100092607 | 161 |
| 219 | 3300028794 | Ga0307515_10023678 | Ga0307515_100236789 | 161 |
| 220 | 3300028794 | Ga0307515_10060249 | Ga0307515_100602495 | 161 |
| 221 | 3300028800 | Ga0265338_10429819 | Ga0265338_104298191 | 161 |
| 222 | 3300033179 | Ga0307507_10002394 | Ga0307507_1000239431 | 161 |
| 223 | 3300037312 | Ga0395899_0000002 | Ga0395899_0000002_235807_236340 | 161 |
| 224 | 3300037312 | Ga0395899_0000136 | Ga0395899_0000136_66035_66520 | 161 |
| 225 | 3300037471 | Ga0395905_0377745 | Ga0395905_0377745_536_1021 | 161 |
| 226 | 3300038443 | Ga0395901_0202797 | Ga0395901_0202797_298_783 | 161 |
| 227 | 3300038443 | Ga0395901_0878135 | Ga0395901_0878135_153_638 | 161 |
| 228 | 3300041505 | Ga0451849_1166478 | Ga0451849_1166478_17_502 | 161 |
| 229 | 3300044656 | Ga0466969_0012582 | Ga0466969_0012582_1264_1749 | 161 |
| 230 | 3300044693 | Ga0466961_0042565 | Ga0466961_0042565_448_933 | 161 |
| 231 | 3300045049 | Ga0466959_0033030 | Ga0466959_0033030_747_1232 | 161 |
| 232 | 3300046459 | Ga0495629_0102113 | Ga0495629_0102113_309_794 | 161 |
| 233 | 3300046460 | Ga0495638_0110290 | Ga0495638_0110290_560_1045 | 161 |
| 234 | 3300046462 | Ga0495651_0169904 | Ga0495651_0169904_850_1335 | 161 |
| 235 | 3300046471 | Ga0495650_0000023 | Ga0495650_0000023_295381_295866 | 161 |
| 236 | 3300046492 | Ga0495585_0008493 | Ga0495585_0008493_4723_5208 | 161 |
| 237 | 3300046507 | Ga0495606_0001103 | Ga0495606_0001103_29613_30098 | 161 |
| 238 | 3300046507 | Ga0495606_0006519 | Ga0495606_0006519_9805_10290 | 161 |
| 239 | 3300046512 | Ga0495610_0006792 | Ga0495610_0006792_756_1241 | 161 |
| 240 | 3300046516 | Ga0495628_0629980 | Ga0495628_0629980_259_744 | 161 |
| 241 | 3300046523 | Ga0495644_0033545 | Ga0495644_0033545_1259_1744 | 161 |
| 242 | 3300046524 | Ga0495648_0001312 | Ga0495648_0001312_22684_23169 | 161 |
| 243 | 3300046528 | Ga0495642_0139391 | Ga0495642_0139391_266_751 | 161 |
| 244 | 3300046529 | Ga0495652_0255975 | Ga0495652_0255975_675_1160 | 161 |
| 245 | 3300046538 | Ga0495609_0212068 | Ga0495609_0212068_214_699 | 161 |
| 246 | 3300046557 | Ga0495622_0220533 | Ga0495622_0220533_188_673 | 161 |
| 247 | 3300046558 | Ga0495633_0000021 | Ga0495633_0000021_138783_139268 | 161 |
| 248 | 3300046558 | Ga0495633_0006537 | Ga0495633_0006537_5447_5932 | 161 |
| 249 | 3300046558 | Ga0495633_0305589 | Ga0495633_0305589_46_531 | 161 |
| 250 | 3300046616 | Ga0495668_0000075 | Ga0495668_0000075_82092_82577 | 161 |
| 251 | 3300046616 | Ga0495668_0170307 | Ga0495668_0170307_43_528 | 161 |
| 252 | 3300046648 | Ga0495611_0111296 | Ga0495611_0111296_10_495 | 161 |
| 253 | 3300046660 | Ga0495625_0000018 | Ga0495625_0000018_244202_244687 | 161 |
| 254 | 3300046660 | Ga0495625_0000439 | Ga0495625_0000439_4394_4879 | 161 |
| 255 | 3300046660 | Ga0495625_0001162 | Ga0495625_0001162_26373_26858 | 161 |
| 256 | 3300046660 | Ga0495625_0004744 | Ga0495625_0004744_9858_10343 | 161 |
| 257 | 3300046660 | Ga0495625_0101343 | Ga0495625_0101343_234_719 | 161 |
| 258 | 3300046660 | Ga0495625_0730650 | Ga0495625_0730650_25_510 | 161 |
| 259 | 3300046663 | Ga0495635_0209988 | Ga0495635_0209988_313_798 | 161 |
| 260 | 3300046665 | Ga0495661_0000485 | Ga0495661_0000485_9199_9684 | 161 |
| 261 | 3300046665 | Ga0495661_0018518 | Ga0495661_0018518_2146_2631 | 161 |
| 262 | 3300046692 | Ga0495671_0072504 | Ga0495671_0072504_364_849 | 161 |
| 263 | 3300046692 | Ga0495671_0167679 | Ga0495671_0167679_361_846 | 161 |
| 264 | 3300046694 | Ga0495649_0000015 | Ga0495649_0000015_172897_173382 | 161 |
| 265 | 3300047443 | Ga0495687_006547 | Ga0495687_006547_471_956 | 161 |
| 266 | 3300047445 | Ga0495677_0091383 | Ga0495677_0091383_248_733 | 161 |
| 267 | 3300047447 | Ga0495685_040315 | Ga0495685_040315_886_1371 | 161 |
| 268 | 3300047472 | Ga0495686_0002207 | Ga0495686_0002207_6769_7254 | 161 |
| 269 | 3300047472 | Ga0495686_0028569 | Ga0495686_0028569_289_774 | 161 |
| 270 | 3300047472 | Ga0495686_0062659 | Ga0495686_0062659_485_970 | 161 |
| 271 | 3300047472 | Ga0495686_0177908 | Ga0495686_0177908_603_1091 | 161 |
| 272 | 3300048917 | Ga0496114_1111245 | Ga0496114_1111245_46_531 | 161 |
| 273 | 3300048918 | Ga0496115_0061877 | Ga0496115_0061877_668_1153 | 161 |
| 274 | 3300049459 | Ga0495678_239364 | Ga0495678_239364_38_523 | 161 |
| 275 | 3300050493 | nmdc:mga0k408_2077_c1 | nmdc:mga0k408_2077_c1_7411_7896 | 161 |
| 276 | 3300050493 | nmdc:mga0k408_3438_c1 | nmdc:mga0k408_3438_c1_2799_3299 | 161 |
| 277 | 3300050493 | nmdc:mga0k408_7232_c1 | nmdc:mga0k408_7232_c1_4477_4962 | 161 |
| 278 | 3300053090 | Ga0500646_0053336 | Ga0500646_0053336_351_836 | 161 |
| 279 | 3300053122 | Ga0500608_016757 | Ga0500608_016757_2622_3107 | 161 |
| 280 | 3300053123 | Ga0500614_099281 | Ga0500614_099281_112_597 | 161 |
| 281 | 3300053125 | Ga0500618_000012 | Ga0500618_000012_123681_124166 | 161 |
| 282 | 3300053125 | Ga0500618_021263 | Ga0500618_021263_553_1038 | 161 |
| 283 | 3300053153 | Ga0500616_0268912 | Ga0500616_0268912_113_598 | 161 |
| 284 | 3300053154 | Ga0500619_067924 | Ga0500619_067924_164_649 | 161 |
| 285 | 3300053156 | Ga0500622_0005513 | Ga0500622_0005513_2397_2882 | 161 |
| 286 | 3300053156 | Ga0500622_0153117 | Ga0500622_0153117_269_754 | 161 |
| 287 | 3300053161 | Ga0500634_0226990 | Ga0500634_0226990_144_629 | 161 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6wxp-assembly2.cif.gz_D | de novo tim barrel-ferredoxin fold fusion homodimer with 4-glutamate centre tfd-ee | 0.6312 | 7 | 121 |
| 6gwj-assembly1.cif.gz_B | human osgep / lage3 / gon7 complex | 0.6094 | 9 | 87 |
| 6nuk-assembly1.cif.gz_A | de novo designed protein ferredog-diesel | 0.6022 | 1 | 90 |
| 4av2-assembly1.cif.gz_A | single particle electron microscopy of pilq dodecameric complexes from neisseria meningitidis. | 0.5994 | 7 | 85 |
| 2kjw-assembly1.cif.gz_A | solution structure and backbone dynamics of the permutant p54-55 | 0.5772 | 5 | 92 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4HRY4_300_413_3.30.70.1130 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;EIF_2_alpha | 0.6623 | 7 | 90 | 3.30.70.1130 |
| af_P84850_411_490_3.30.70.2740 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.6352 | 9 | 90 | 3.30.70.2740 |
| af_O07406_325_407_3.30.70.2740 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.6239 | 9 | 93 | 3.30.70.2740 |
| af_Q58341_1_185_3.30.2130.30 | Alpha Beta;2-Layer Sandwich;VC0802-like; | 0.6159 | 5 | 64 | 3.30.2130.30 |
| af_G5EE33_680_891_3.30.70.1230 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain | 0.6032 | 1 | 88 | 3.30.70.1230 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2H9VN69-F1-model_v4 | ABC transporter ATPase | 0.9935 | 1 | 158 |
|
| AF-A0A355BC12-F1-model_v4 | ABC transporter ATPase | 0.9935 | 3 | 79 |
|
| AF-A0A7V1SN25-F1-model_v4 | ABC transporter ATPase | 0.9929 | 1 | 159 |
|
| AF-A0A7Y1V2Q8-F1-model_v4 | ABC transporter ATPase | 0.9894 | 3 | 153 |
|
| AF-A0A519JUP5-F1-model_v4 | ABC transporter ATPase | 0.9879 | 2 | 93 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar