F387787

General Info

Members Datasets Scaffolds Average Seq Length
287 164 269 160

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10168466|rootH1_101684663
Length 176
Sequence MTTKLHSEVNNLIALYMQFSENSRVWIYQSDRKLTDDEVQQVQQHLNKFTTQWTAHNNQLKAKGEVRYNRFLILIVDESHAGASGCSIDKSVHFMKQLEQEFNINLFDRFNLAYREGEEVLSLPRHDFEELLKQGKLNKESIVYNNLVQNLAELNTKWEVPFKDSWHIQLFGNLVQ

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2739367651 Pedobacter sp. OK291 Isolate Unclassified
3 2739367656 Pedobacter sp. CF523 Isolate Unclassified
4 2739367663 Pedobacter sp. YR510 Isolate Unclassified
5 2818991437 Pedobacter terrae 518 Isolate Unclassified
6 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
7 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
8 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
9 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
10 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
11 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
12 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
13 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
14 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
15 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
16 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
17 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
18 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
19 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
22 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
23 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
24 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
25 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
26 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
71 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
116 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
117 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
118 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
134 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
135 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
136 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
139 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
146 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
149 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
150 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
157 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
158 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
159 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
160 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
161 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
162 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
163 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
164 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.68
Metatranscriptomes 0.7
Isolates 6.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.15
Nodule 0
Rhizoplane 2.09
Rhizosphere 77.7
Stem 0
Stem Tuber 0
Unclassified 9.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10051845 3300001979 Bacteria 1172
2 JGI24737J22298_10001256 3300001990 Bacteria 8983
3 JGI24737J22298_10005387 3300001990 Bacteria 4418
4 JGI24735J21928_10000015 3300002067 Bacteria 167231
5 JGI25162J39368_1000047 3300002737 Viruses 167507
6 JGI25162J39368_1003374 3300002737 Bacteria 4718
7 JGI25164J39214_1001118 3300002772 Bacteria 7644
8 JGI25165J46597_1001696 3300003214 Bacteria 9921
9 rootH1_10010672 3300003316 Bacteria 12359
10 rootH1_10010672 3300003323 Bacteria 1707
11 rootH2_10008596 3300003320 Bacteria 5264
12 rootH2_10017421 3300003320 Bacteria 26803
13 rootL2_10268507 3300003322 Bacteria 1260
14 rootH1_10009220 3300003323 Bacteria 22214
15 rootH1_10009221 3300003323 Bacteria 3380
16 rootH1_10026050 3300003323 Bacteria 2302
17 rootH1_10168466 3300003323 Bacteria 2667
18 Ga0055530_10003073 3300003791 Bacteria 9924
19 Ga0065714_10106413 3300005288 Bacteria 1543
20 Ga0065714_10221592 3300005288 Bacteria 839
21 Ga0065714_10299240 3300005288 Bacteria 696
22 Ga0065714_10510171 3300005288 Bacteria 518
23 Ga0070658_10578866 3300005327 Bacteria 972
24 Ga0070680_100011377 3300005336 Bacteria 6882
25 Ga0070691_10156066 3300005341 Bacteria 1173
26 Ga0070671_100008871 3300005355 Bacteria 8069
27 Ga0070674_100660723 3300005356 Unclassified 889
28 Ga0070663_100016565 3300005455 Bacteria 4792
29 Ga0070681_10022138 3300005458 Bacteria 6378
30 Ga0070679_100036558 3300005530 Bacteria 4873
31 Ga0068853_100124518 3300005539 Bacteria 2302
32 Ga0068853_100156749 3300005539 Bacteria 2052
33 Ga0068855_100000043 3300005563 Bacteria 149118
34 Ga0068855_100004378 3300005563 Bacteria 17254
35 Ga0068855_100112248 3300005563 Bacteria 3128
36 Ga0068855_100621651 3300005563 Bacteria 1163
37 Ga0068857_100014917 3300005577 Bacteria 6777
38 Ga0068854_100591208 3300005578 Bacteria 946
39 Ga0068856_100000824 3300005614 Bacteria 33487
40 Ga0068856_100058154 3300005614 Bacteria 3818
41 Ga0068856_100139279 3300005614 Bacteria 2433
42 Ga0068852_100306651 3300005616 Bacteria 1538
43 Ga0068864_100146033 3300005618 Bacteria 2138
44 Ga0068851_10265547 3300005834 Bacteria 977
45 Ga0068858_100062835 3300005842 Bacteria 3434
46 Ga0070715_10154591 3300006163 Bacteria 1127
47 Ga0075366_10002961 3300006195 Bacteria 8842
48 Ga0075366_10005018 3300006195 Bacteria 7148
49 Ga0075366_10023157 3300006195 Bacteria 3618
50 Ga0097621_100590297 3300006237 Viruses 1014
51 Ga0105244_10026368 3300009036 Bacteria 3146
52 Ga0105244_10251007 3300009036 Bacteria 825
53 Ga0105240_10000173 3300009093 Bacteria 131281
54 Ga0105240_10012925 3300009093 Bacteria 11499
55 Ga0105240_10042668 3300009093 Bacteria 5779
56 Ga0105240_10072460 3300009093 Bacteria 4257
57 Ga0105240_10179140 3300009093 Bacteria 2503
58 Ga0105240_10381862 3300009093 Bacteria 1591
59 Ga0105245_10141394 3300009098 Bacteria 2267
60 Ga0105241_10079187 3300009174 Bacteria 2569
61 Ga0105241_10141653 3300009174 Bacteria 1958
62 Ga0105241_10151416 3300009174 Bacteria 1898
63 Ga0105241_10806223 3300009174 Bacteria 865
64 Ga0105241_10806226 3300009174 Bacteria 865
65 Ga0105242_10179856 3300009176 Bacteria 1865
66 Ga0105237_10006614 3300009545 Bacteria 12813
67 Ga0105237_10009764 3300009545 Bacteria 10266
68 Ga0105237_10050483 3300009545 Viruses 4180
69 Ga0105237_10093733 3300009545 Viruses 2992
70 Ga0105237_10388422 3300009545 Bacteria 1401
71 Ga0105237_11196531 3300009545 Unclassified 766
72 Ga0105238_10053480 3300009551 Bacteria 4057
73 Ga0105238_10265577 3300009551 Bacteria 1696
74 Ga0105249_10454660 3300009553 Bacteria 1320
75 Ga0105239_10000015 3300010375 Bacteria 319892
76 Ga0105239_10000222 3300010375 Bacteria 83623
77 Ga0105239_10027959 3300010375 Bacteria 6205
78 Ga0105239_10035191 3300010375 Bacteria 5500
79 Ga0105239_10099441 3300010375 Viruses 3216
80 Ga0105239_10107981 3300010375 Bacteria 3083
81 Ga0105239_10129657 3300010375 Bacteria 2804
82 Ga0105239_11850207 3300010375 Bacteria 700
83 Ga0157373_10002151 3300013100 Bacteria 14917
84 Ga0157373_11117393 3300013100 Bacteria 592
85 Ga0157371_10000180 3300013102 Bacteria 92616
86 Ga0157371_10001187 3300013102 Bacteria 27903
87 Ga0157371_10002167 3300013102 Bacteria 19107
88 Ga0157371_10003500 3300013102 Bacteria 14192
89 Ga0157370_10011048 3300013104 Bacteria 9469
90 Ga0157370_10011928 3300013104 Bacteria 9060
91 Ga0157370_10016025 3300013104 Bacteria 7602
92 Ga0157370_10074362 3300013104 Bacteria 3205
93 Ga0157370_10090647 3300013104 Bacteria 2870
94 Ga0157370_10171295 3300013104 Bacteria 2018
95 Ga0157370_10218801 3300013104 Unclassified 1764
96 Ga0157370_10381228 3300013104 Bacteria 1299
97 Ga0157370_10562202 3300013104 Bacteria 1045
98 Ga0157370_11080226 3300013104 Bacteria 725
99 Ga0157370_11283552 3300013104 Bacteria 660
100 Ga0157369_10000566 3300013105 Bacteria 48674
101 Ga0157369_10030669 3300013105 Bacteria 5928
102 Ga0157369_10297283 3300013105 Bacteria 1680
103 Ga0157374_10512615 3300013296 Bacteria 1205
104 Ga0157374_11626615 3300013296 Bacteria 670
105 Ga0163162_10014253 3300013306 Bacteria 7766
106 Ga0163162_10028471 3300013306 Bacteria 5529
107 Ga0163162_10084824 3300013306 Bacteria 3244
108 Ga0163162_10090725 3300013306 Bacteria 3137
109 Ga0163162_10762946 3300013306 Viruses 1086
110 Ga0163162_12269146 3300013306 Bacteria 623
111 Ga0157372_10000020 3300013307 Bacteria 208056
112 Ga0157372_10002236 3300013307 Bacteria 21010
113 Ga0157372_10003829 3300013307 Bacteria 16174
114 Ga0157372_10252016 3300013307 Unclassified 2049
115 Ga0157375_10558617 3300013308 Bacteria 1306
116 Ga0157375_13347932 3300013308 Bacteria 534
117 Ga0182008_10002211 3300014497 Bacteria 12335
118 Ga0182006_1002222 3300015261 Bacteria 10750
119 Ga0182006_1114798 3300015261 Bacteria 942
120 Ga0183373_1001 3300015682 Bacteria 1410374
121 Ga0163161_10004072 3300017792 Bacteria 10222
122 Ga0163161_10004396 3300017792 Bacteria 9831
123 Ga0163161_10070351 3300017792 Bacteria 2558
124 Ga0163161_10211923 3300017792 Bacteria 1497
125 Ga0206351_10780580 3300020077 Unclassified 1555
126 Ga0154015_1607702 3300020610 Unclassified 1138
127 Ga0209563_105803 3300025230 Bacteria 2193
128 Ga0207427_100025 3300025231 Bacteria 433726
129 Ga0209437_100010 3300025233 Bacteria 838447
130 Ga0209437_100089 3300025233 Bacteria 250476
131 Ga0209026_1004148 3300025250 Bacteria 4444
132 Ga0209026_1004203 3300025250 Bacteria 4388
133 Ga0209129_1013080 3300025258 Viruses 1851
134 Ga0209233_1000017 3300025261 Bacteria 898076
135 Ga0209233_1000929 3300025261 Bacteria 12753
136 Ga0209455_1012172 3300025272 Bacteria 2074
137 Ga0209676_1000008 3300025292 Bacteria 991778
138 Ga0209050_1000055 3300025298 Bacteria 339254
139 Ga0207647_10000035 3300025904 Bacteria 99177
140 Ga0207647_10114181 3300025904 Bacteria 1596
141 Ga0207654_10003275 3300025911 Bacteria 8187
142 Ga0207654_10535381 3300025911 Bacteria 830
143 Ga0207654_10664885 3300025911 Bacteria 747
144 Ga0207707_10007990 3300025912 Bacteria 9188
145 Ga0207695_10000053 3300025913 Bacteria 396740
146 Ga0207695_10038992 3300025913 Bacteria 5109
147 Ga0207695_10045782 3300025913 Bacteria 4641
148 Ga0207695_10050962 3300025913 Bacteria 4350
149 Ga0207695_10170861 3300025913 Bacteria 2099
150 Ga0207695_10186139 3300025913 Bacteria 1995
151 Ga0207695_10223875 3300025913 Viruses 1788
152 Ga0207695_10271171 3300025913 Bacteria 1592
153 Ga0207671_10003316 3300025914 Bacteria 16180
154 Ga0207671_10009242 3300025914 Bacteria 8259
155 Ga0207671_10031236 3300025914 Viruses 3968
156 Ga0207660_10018017 3300025917 Bacteria 4703
157 Ga0207652_10011595 3300025921 Bacteria 7110
158 Ga0207694_10178078 3300025924 Unclassified 1723
159 Ga0207694_10240824 3300025924 Bacteria 1478
160 Ga0207687_10425338 3300025927 Bacteria 1097
161 Ga0207644_10001419 3300025931 Bacteria 15446
162 Ga0207669_10594609 3300025937 Unclassified 898
163 Ga0207667_10000015 3300025949 Bacteria 417534
164 Ga0207667_10004375 3300025949 Bacteria 17295
165 Ga0207667_10051425 3300025949 Viruses 4344
166 Ga0207712_10866867 3300025961 Bacteria 796
167 Ga0207640_10183496 3300025981 Viruses 1571
168 Ga0207639_10185353 3300026041 Bacteria 1774
169 Ga0207639_10431213 3300026041 Bacteria 1194
170 Ga0207678_10029452 3300026067 Bacteria 4792
171 Ga0207702_10000165 3300026078 Bacteria 79066
172 Ga0207702_10041908 3300026078 Bacteria 3839
173 Ga0207702_10286226 3300026078 Bacteria 1560
174 Ga0207674_10034875 3300026116 Bacteria 5255
175 Ga0207674_10808651 3300026116 Bacteria 904
176 Ga0207698_10294861 3300026142 Bacteria 1507
177 Ga0207698_10316367 3300026142 Bacteria 1460
178 Ga0307515_10008511 3300028794 Bacteria 19989
179 Ga0307515_10009260 3300028794 Bacteria 19062
180 Ga0307515_10023678 3300028794 Bacteria 10742
181 Ga0307515_10060249 3300028794 Bacteria 5419
182 Ga0265338_10429819 3300028800 Bacteria 937
183 Ga0307405_10000003 3300031731 Bacteria 569064
184 Ga0307407_10000010 3300031903 Bacteria 186970
185 Ga0307412_10356422 3300031911 Bacteria 1176
186 Ga0307416_100000014 3300032002 Bacteria 249053
187 Ga0307414_10149978 3300032004 Bacteria 1838
188 Ga0307411_10571990 3300032005 Bacteria 967
189 Ga0307507_10002394 3300033179 Bacteria 39588
190 Ga0395899_0000002 3300037312 Bacteria 1324310
191 Ga0395899_0000136 3300037312 Bacteria 112112
192 Ga0395905_0377745 3300037471 Bacteria 1311
193 Ga0395901_0202797 3300038443 Bacteria 2079
194 Ga0395901_0878135 3300038443 Bacteria 880
195 Ga0451789_0917768 3300041443 Bacteria 555
196 Ga0451791_1140709 3300041451 Viruses 716
197 Ga0451807_2647401 3300041486 Bacteria 545
198 Ga0451849_1166478 3300041505 Bacteria 1163
199 Ga0451577_0000240 3300042876 Bacteria 108418
200 Ga0466969_0012582 3300044656 Bacteria 4460
201 Ga0466961_0042565 3300044693 Bacteria 2911
202 Ga0453684_0426553 3300044712 Bacteria 1480
203 Ga0466959_0033030 3300045049 Bacteria 3829
204 Ga0495629_0102113 3300046459 Bacteria 2001
205 Ga0495638_0110290 3300046460 Bacteria 1635
206 Ga0495651_0169904 3300046462 Bacteria 1554
207 Ga0495650_0000023 3300046471 Bacteria 527763
208 Ga0495650_0155468 3300046471 Bacteria 818
209 Ga0495585_0008493 3300046492 Bacteria 6222
210 Ga0495606_0001103 3300046507 Bacteria 38654
211 Ga0495606_0006519 3300046507 Bacteria 10741
212 Ga0495606_0021932 3300046507 Bacteria 4670
213 Ga0495610_0006203 3300046512 Bacteria 8302
214 Ga0495610_0006792 3300046512 Bacteria 7763
215 Ga0495616_0003039 3300046513 Bacteria 10867
216 Ga0495628_0629980 3300046516 Bacteria 763
217 Ga0495637_0018523 3300046520 Bacteria 3228
218 Ga0495644_0033545 3300046523 Bacteria 1939
219 Ga0495648_0001312 3300046524 Bacteria 24628
220 Ga0495642_0139391 3300046528 Bacteria 1046
221 Ga0495652_0255975 3300046529 Bacteria 1295
222 Ga0495652_0617737 3300046529 Bacteria 737
223 Ga0495609_0212068 3300046538 Bacteria 806
224 Ga0495622_0220533 3300046557 Bacteria 840
225 Ga0495633_0000021 3300046558 Bacteria 227171
226 Ga0495633_0006537 3300046558 Bacteria 6887
227 Ga0495633_0305589 3300046558 Unclassified 722
228 Ga0495668_0000075 3300046616 Bacteria 163092
229 Ga0495668_0170307 3300046616 Bacteria 1193
230 Ga0495611_0111296 3300046648 Bacteria 1275
231 Ga0495625_0000018 3300046660 Bacteria 299567
232 Ga0495625_0000439 3300046660 Bacteria 62433
233 Ga0495625_0001162 3300046660 Bacteria 33895
234 Ga0495625_0004744 3300046660 Bacteria 12723
235 Ga0495625_0101343 3300046660 Bacteria 1978
236 Ga0495625_0730650 3300046660 Bacteria 582
237 Ga0495635_0209988 3300046663 Bacteria 1319
238 Ga0495661_0000485 3300046665 Bacteria 41846
239 Ga0495661_0018518 3300046665 Bacteria 4578
240 Ga0495671_0072504 3300046692 Bacteria 1691
241 Ga0495671_0167679 3300046692 Bacteria 1068
242 Ga0495649_0000015 3300046694 Bacteria 246431
243 Ga0495687_006547 3300047443 Bacteria 7109
244 Ga0495687_058666 3300047443 Bacteria 1596
245 Ga0495677_0091383 3300047445 Bacteria 1147
246 Ga0495685_040315 3300047447 Bacteria 1597
247 Ga0495686_0000237 3300047472 Bacteria 100373
248 Ga0495686_0002207 3300047472 Bacteria 18912
249 Ga0495686_0028569 3300047472 Bacteria 3632
250 Ga0495686_0062659 3300047472 Bacteria 2306
251 Ga0495686_0177908 3300047472 Bacteria 1234
252 Ga0496114_1111245 3300048917 Bacteria 675
253 Ga0496115_0061877 3300048918 Bacteria 3019
254 Ga0495678_013312 3300049459 Bacteria 3867
255 Ga0495678_239364 3300049459 Bacteria 543
256 nmdc:mga0k408_2077_c1 3300050493 Bacteria 10713
257 nmdc:mga0k408_3438_c1 3300050493 Bacteria 8383
258 nmdc:mga0k408_7232_c1 3300050493 Bacteria 5932
259 Ga0500646_0053336 3300053090 Bacteria 1172
260 Ga0500608_016757 3300053122 Bacteria 3317
261 Ga0500614_099281 3300053123 Bacteria 837
262 Ga0500618_000012 3300053125 Bacteria 185382
263 Ga0500618_021263 3300053125 Bacteria 1585
264 Ga0500573_0246576 3300053140 Bacteria 923
265 Ga0500616_0268912 3300053153 Viruses 720
266 Ga0500619_067924 3300053154 Bacteria 1182
267 Ga0500622_0005513 3300053156 Bacteria 7577
268 Ga0500622_0153117 3300053156 Bacteria 1088
269 Ga0500634_0226990 3300053161 Bacteria 796

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041486 Ga0451807_2647401 Ga0451807_2647401_54_488 141
2 3300041451 Ga0451791_1140709 Ga0451791_1140709_35_469 144
3 3300025927 Ga0207687_10425338 Ga0207687_104253381 153
4 iso_pu_bacteria 2739367656 2739616892 154
5 3300044712 Ga0453684_0426553 Ga0453684_0426553_314_823 155
6 iso_pu_bacteria 2739367651 2739590899 155
7 iso_pu_bacteria 2818991437 2819546564 155
8 iso_pu_bacteria 2842722452 2842725263 155
9 iso_pu_bacteria 2842909656 2842912535 155
10 iso_pu_bacteria 2849281842 2849286252 155
11 iso_pu_bacteria 2857627736 2857629679 155
12 iso_pu_bacteria 2904445276 2904446711 155
13 iso_pu_bacteria 2954016120 2954019079 155
14 iso_pu_bacteria 2739367663 2739647239 156
15 iso_pu_bacteria 2852623160 2852624907 156
16 iso_pu_bacteria 2884933994 2884936196 156
17 iso_pu_bacteria 2919437846 2919442778 156
18 3300042876 Ga0451577_0000240 Ga0451577_0000240_79375_79860 157
19 iso_pu_bacteria 2599185184 2599479475 157
20 iso_pu_bacteria 2902048731 2902052594 157
21 iso_pu_bacteria 2928078545 2928082219 157
22 iso_pu_bacteria 2928147474 2928149205 157
23 iso_pu_bacteria 2932082852 2932087734 157
24 iso_pu_bacteria 2977232053 2977235947 157
25 3300003791 Ga0055530_10003073 Ga0055530_100030732 159
26 3300005288 Ga0065714_10299240 Ga0065714_102992401 159
27 3300005288 Ga0065714_10510171 Ga0065714_105101711 159
28 3300005327 Ga0070658_10578866 Ga0070658_105788662 159
29 3300009036 Ga0105244_10026368 Ga0105244_100263683 159
30 3300009036 Ga0105244_10251007 Ga0105244_102510072 159
31 3300013102 Ga0157371_10000180 Ga0157371_100001802 159
32 3300013102 Ga0157371_10003500 Ga0157371_100035005 159
33 3300013104 Ga0157370_10011048 Ga0157370_100110484 159
34 3300013104 Ga0157370_10011928 Ga0157370_100119283 159
35 3300013104 Ga0157370_10016025 Ga0157370_100160254 159
36 3300013104 Ga0157370_10090647 Ga0157370_100906473 159
37 3300013306 Ga0163162_10090725 Ga0163162_100907253 159
38 3300013308 Ga0157375_10558617 Ga0157375_105586172 159
39 3300013308 Ga0157375_13347932 Ga0157375_133479321 159
40 3300014497 Ga0182008_10002211 Ga0182008_100022115 159
41 3300015261 Ga0182006_1002222 Ga0182006_10022224 159
42 3300015261 Ga0182006_1114798 Ga0182006_11147982 159
43 3300015682 Ga0183373_1001 Ga0183373_1001459 159
44 3300017792 Ga0163161_10004072 Ga0163161_100040728 159
45 3300017792 Ga0163161_10004396 Ga0163161_100043968 159
46 3300017792 Ga0163161_10070351 Ga0163161_100703512 159
47 3300025292 Ga0209676_1000008 Ga0209676_1000008359 159
48 3300025298 Ga0209050_1000055 Ga0209050_100005553 159
49 3300026142 Ga0207698_10294861 Ga0207698_102948611 159
50 3300031731 Ga0307405_10000003 Ga0307405_10000003300 159
51 3300031903 Ga0307407_10000010 Ga0307407_10000010120 159
52 3300031911 Ga0307412_10356422 Ga0307412_103564223 159
53 3300032002 Ga0307416_100000014 Ga0307416_100000014111 159
54 3300032004 Ga0307414_10149978 Ga0307414_101499782 159
55 3300032005 Ga0307411_10571990 Ga0307411_105719902 159
56 3300041443 Ga0451789_0917768 Ga0451789_0917768_18_497 159
57 3300046507 Ga0495606_0021932 Ga0495606_0021932_2551_3030 159
58 3300046512 Ga0495610_0006203 Ga0495610_0006203_1962_2441 159
59 3300046520 Ga0495637_0018523 Ga0495637_0018523_1487_1966 159
60 3300053140 Ga0500573_0246576 Ga0500573_0246576_277_756 159
61 3300001990 JGI24737J22298_10005387 JGI24737J22298_100053874 160
62 3300002737 JGI25162J39368_1000047 JGI25162J39368_1000047112 160
63 3300002737 JGI25162J39368_1003374 JGI25162J39368_10033748 160
64 3300002772 JGI25164J39214_1001118 JGI25164J39214_100111813 160
65 3300003214 JGI25165J46597_1001696 JGI25165J46597_100169614 160
66 3300003323 rootH1_10168466 rootH1_101684663 160
67 3300005577 Ga0068857_100014917 Ga0068857_1000149173 160
68 3300005614 Ga0068856_100058154 Ga0068856_1000581544 160
69 3300005616 Ga0068852_100306651 Ga0068852_1003066512 160
70 3300006163 Ga0070715_10154591 Ga0070715_101545912 160
71 3300009093 Ga0105240_10381862 Ga0105240_103818623 160
72 3300009176 Ga0105242_10179856 Ga0105242_101798562 160
73 3300009553 Ga0105249_10454660 Ga0105249_104546601 160
74 3300010375 Ga0105239_10107981 Ga0105239_101079815 160
75 3300010375 Ga0105239_11850207 Ga0105239_118502072 160
76 3300013100 Ga0157373_10002151 Ga0157373_1000215111 160
77 3300013102 Ga0157371_10001187 Ga0157371_100011876 160
78 3300013104 Ga0157370_10074362 Ga0157370_100743624 160
79 3300013104 Ga0157370_10381228 Ga0157370_103812282 160
80 3300013105 Ga0157369_10030669 Ga0157369_100306692 160
81 3300013105 Ga0157369_10297283 Ga0157369_102972833 160
82 3300013296 Ga0157374_10512615 Ga0157374_105126152 160
83 3300013306 Ga0163162_10014253 Ga0163162_100142534 160
84 3300013307 Ga0157372_10002236 Ga0157372_1000223613 160
85 3300017792 Ga0163161_10211923 Ga0163161_102119232 160
86 3300025230 Ga0209563_105803 Ga0209563_1058033 160
87 3300025231 Ga0207427_100025 Ga0207427_1000257 160
88 3300025233 Ga0209437_100010 Ga0209437_100010269 160
89 3300025233 Ga0209437_100089 Ga0209437_100089177 160
90 3300025250 Ga0209026_1004148 Ga0209026_10041485 160
91 3300025250 Ga0209026_1004203 Ga0209026_10042034 160
92 3300025258 Ga0209129_1013080 Ga0209129_10130803 160
93 3300025261 Ga0209233_1000017 Ga0209233_1000017282 160
94 3300025272 Ga0209455_1012172 Ga0209455_10121723 160
95 3300025904 Ga0207647_10000035 Ga0207647_1000003524 160
96 3300025913 Ga0207695_10271171 Ga0207695_102711713 160
97 3300025961 Ga0207712_10866867 Ga0207712_108668672 160
98 3300026078 Ga0207702_10041908 Ga0207702_100419084 160
99 3300026116 Ga0207674_10034875 Ga0207674_100348754 160
100 3300026142 Ga0207698_10316367 Ga0207698_103163673 160
101 3300046471 Ga0495650_0155468 Ga0495650_0155468_54_536 160
102 3300046513 Ga0495616_0003039 Ga0495616_0003039_4765_5247 160
103 3300046529 Ga0495652_0617737 Ga0495652_0617737_223_705 160
104 3300047443 Ga0495687_058666 Ga0495687_058666_906_1388 160
105 3300047472 Ga0495686_0000237 Ga0495686_0000237_6937_7419 160
106 3300049459 Ga0495678_013312 Ga0495678_013312_829_1311 160
107 3300001979 JGI24740J21852_10051845 JGI24740J21852_100518452 161
108 3300001990 JGI24737J22298_10001256 JGI24737J22298_100012567 161
109 3300002067 JGI24735J21928_10000015 JGI24735J21928_10000015139 161
110 3300003316 rootH1_10010672 rootH1_100106729 161
111 3300003320 rootH2_10008596 rootH2_100085962 161
112 3300003320 rootH2_10017421 rootH2_100174214 161
113 3300003322 rootL2_10268507 rootL2_102685072 161
114 3300003323 rootH1_10009220 rootH1_1000922017 161
115 3300003323 rootH1_10009221 rootH1_100092214 161
116 3300003323 rootH1_10026050 rootH1_100260504 161
117 3300005288 Ga0065714_10106413 Ga0065714_101064132 161
118 3300005288 Ga0065714_10221592 Ga0065714_102215922 161
119 3300005336 Ga0070680_100011377 Ga0070680_10001137710 161
120 3300005341 Ga0070691_10156066 Ga0070691_101560662 161
121 3300005355 Ga0070671_100008871 Ga0070671_10000887110 161
122 3300005356 Ga0070674_100660723 Ga0070674_1006607232 161
123 3300005455 Ga0070663_100016565 Ga0070663_1000165653 161
124 3300005458 Ga0070681_10022138 Ga0070681_100221386 161
125 3300005530 Ga0070679_100036558 Ga0070679_1000365583 161
126 3300005539 Ga0068853_100124518 Ga0068853_1001245184 161
127 3300005539 Ga0068853_100156749 Ga0068853_1001567492 161
128 3300005563 Ga0068855_100000043 Ga0068855_10000004351 161
129 3300005563 Ga0068855_100004378 Ga0068855_1000043786 161
130 3300005563 Ga0068855_100112248 Ga0068855_1001122484 161
131 3300005563 Ga0068855_100621651 Ga0068855_1006216512 161
132 3300005578 Ga0068854_100591208 Ga0068854_1005912082 161
133 3300005614 Ga0068856_100000824 Ga0068856_10000082428 161
134 3300005614 Ga0068856_100139279 Ga0068856_1001392793 161
135 3300005618 Ga0068864_100146033 Ga0068864_1001460332 161
136 3300005834 Ga0068851_10265547 Ga0068851_102655472 161
137 3300005842 Ga0068858_100062835 Ga0068858_1000628354 161
138 3300006195 Ga0075366_10002961 Ga0075366_100029614 161
139 3300006195 Ga0075366_10005018 Ga0075366_100050185 161
140 3300006195 Ga0075366_10023157 Ga0075366_100231572 161
141 3300006237 Ga0097621_100590297 Ga0097621_1005902971 161
142 3300009093 Ga0105240_10000173 Ga0105240_10000173115 161
143 3300009093 Ga0105240_10012925 Ga0105240_100129257 161
144 3300009093 Ga0105240_10042668 Ga0105240_100426686 161
145 3300009093 Ga0105240_10072460 Ga0105240_100724603 161
146 3300009093 Ga0105240_10179140 Ga0105240_101791403 161
147 3300009098 Ga0105245_10141394 Ga0105245_101413942 161
148 3300009174 Ga0105241_10079187 Ga0105241_100791872 161
149 3300009174 Ga0105241_10141653 Ga0105241_101416532 161
150 3300009174 Ga0105241_10151416 Ga0105241_101514163 161
151 3300009174 Ga0105241_10806223 Ga0105241_108062232 161
152 3300009174 Ga0105241_10806226 Ga0105241_108062262 161
153 3300009545 Ga0105237_10006614 Ga0105237_1000661410 161
154 3300009545 Ga0105237_10009764 Ga0105237_1000976410 161
155 3300009545 Ga0105237_10050483 Ga0105237_100504833 161
156 3300009545 Ga0105237_10093733 Ga0105237_100937333 161
157 3300009545 Ga0105237_10388422 Ga0105237_103884222 161
158 3300009545 Ga0105237_11196531 Ga0105237_111965311 161
159 3300009551 Ga0105238_10053480 Ga0105238_100534804 161
160 3300009551 Ga0105238_10265577 Ga0105238_102655773 161
161 3300010375 Ga0105239_10000015 Ga0105239_1000001526 161
162 3300010375 Ga0105239_10000222 Ga0105239_1000022213 161
163 3300010375 Ga0105239_10027959 Ga0105239_100279593 161
164 3300010375 Ga0105239_10035191 Ga0105239_100351914 161
165 3300010375 Ga0105239_10099441 Ga0105239_100994416 161
166 3300010375 Ga0105239_10129657 Ga0105239_101296575 161
167 3300013100 Ga0157373_11117393 Ga0157373_111173931 161
168 3300013102 Ga0157371_10002167 Ga0157371_100021672 161
169 3300013104 Ga0157370_10171295 Ga0157370_101712953 161
170 3300013104 Ga0157370_10218801 Ga0157370_102188012 161
171 3300013104 Ga0157370_10562202 Ga0157370_105622022 161
172 3300013104 Ga0157370_11080226 Ga0157370_110802262 161
173 3300013104 Ga0157370_11283552 Ga0157370_112835521 161
174 3300013105 Ga0157369_10000566 Ga0157369_100005665 161
175 3300013296 Ga0157374_11626615 Ga0157374_116266151 161
176 3300013306 Ga0163162_10028471 Ga0163162_100284718 161
177 3300013306 Ga0163162_10084824 Ga0163162_100848242 161
178 3300013306 Ga0163162_10762946 Ga0163162_107629462 161
179 3300013306 Ga0163162_12269146 Ga0163162_122691461 161
180 3300013307 Ga0157372_10000020 Ga0157372_10000020100 161
181 3300013307 Ga0157372_10003829 Ga0157372_1000382912 161
182 3300013307 Ga0157372_10252016 Ga0157372_102520162 161
183 3300020077 Ga0206351_10780580 Ga0206351_107805802 161
184 3300020610 Ga0154015_1607702 Ga0154015_16077021 161
185 3300025261 Ga0209233_1000929 Ga0209233_100092912 161
186 3300025904 Ga0207647_10114181 Ga0207647_101141812 161
187 3300025911 Ga0207654_10003275 Ga0207654_100032758 161
188 3300025911 Ga0207654_10535381 Ga0207654_105353812 161
189 3300025911 Ga0207654_10664885 Ga0207654_106648851 161
190 3300025912 Ga0207707_10007990 Ga0207707_1000799010 161
191 3300025913 Ga0207695_10000053 Ga0207695_1000005341 161
192 3300025913 Ga0207695_10038992 Ga0207695_100389925 161
193 3300025913 Ga0207695_10045782 Ga0207695_100457822 161
194 3300025913 Ga0207695_10050962 Ga0207695_100509624 161
195 3300025913 Ga0207695_10170861 Ga0207695_101708613 161
196 3300025913 Ga0207695_10186139 Ga0207695_101861392 161
197 3300025913 Ga0207695_10223875 Ga0207695_102238752 161
198 3300025914 Ga0207671_10003316 Ga0207671_1000331610 161
199 3300025914 Ga0207671_10009242 Ga0207671_100092425 161
200 3300025914 Ga0207671_10031236 Ga0207671_100312364 161
201 3300025917 Ga0207660_10018017 Ga0207660_100180177 161
202 3300025921 Ga0207652_10011595 Ga0207652_100115954 161
203 3300025924 Ga0207694_10178078 Ga0207694_101780783 161
204 3300025924 Ga0207694_10240824 Ga0207694_102408242 161
205 3300025931 Ga0207644_10001419 Ga0207644_1000141918 161
206 3300025937 Ga0207669_10594609 Ga0207669_105946092 161
207 3300025949 Ga0207667_10000015 Ga0207667_1000001550 161
208 3300025949 Ga0207667_10004375 Ga0207667_1000437515 161
209 3300025949 Ga0207667_10051425 Ga0207667_100514253 161
210 3300025981 Ga0207640_10183496 Ga0207640_101834962 161
211 3300026041 Ga0207639_10185353 Ga0207639_101853532 161
212 3300026041 Ga0207639_10431213 Ga0207639_104312132 161
213 3300026067 Ga0207678_10029452 Ga0207678_100294523 161
214 3300026078 Ga0207702_10000165 Ga0207702_1000016520 161
215 3300026078 Ga0207702_10286226 Ga0207702_102862263 161
216 3300026116 Ga0207674_10808651 Ga0207674_108086513 161
217 3300028794 Ga0307515_10008511 Ga0307515_100085118 161
218 3300028794 Ga0307515_10009260 Ga0307515_100092607 161
219 3300028794 Ga0307515_10023678 Ga0307515_100236789 161
220 3300028794 Ga0307515_10060249 Ga0307515_100602495 161
221 3300028800 Ga0265338_10429819 Ga0265338_104298191 161
222 3300033179 Ga0307507_10002394 Ga0307507_1000239431 161
223 3300037312 Ga0395899_0000002 Ga0395899_0000002_235807_236340 161
224 3300037312 Ga0395899_0000136 Ga0395899_0000136_66035_66520 161
225 3300037471 Ga0395905_0377745 Ga0395905_0377745_536_1021 161
226 3300038443 Ga0395901_0202797 Ga0395901_0202797_298_783 161
227 3300038443 Ga0395901_0878135 Ga0395901_0878135_153_638 161
228 3300041505 Ga0451849_1166478 Ga0451849_1166478_17_502 161
229 3300044656 Ga0466969_0012582 Ga0466969_0012582_1264_1749 161
230 3300044693 Ga0466961_0042565 Ga0466961_0042565_448_933 161
231 3300045049 Ga0466959_0033030 Ga0466959_0033030_747_1232 161
232 3300046459 Ga0495629_0102113 Ga0495629_0102113_309_794 161
233 3300046460 Ga0495638_0110290 Ga0495638_0110290_560_1045 161
234 3300046462 Ga0495651_0169904 Ga0495651_0169904_850_1335 161
235 3300046471 Ga0495650_0000023 Ga0495650_0000023_295381_295866 161
236 3300046492 Ga0495585_0008493 Ga0495585_0008493_4723_5208 161
237 3300046507 Ga0495606_0001103 Ga0495606_0001103_29613_30098 161
238 3300046507 Ga0495606_0006519 Ga0495606_0006519_9805_10290 161
239 3300046512 Ga0495610_0006792 Ga0495610_0006792_756_1241 161
240 3300046516 Ga0495628_0629980 Ga0495628_0629980_259_744 161
241 3300046523 Ga0495644_0033545 Ga0495644_0033545_1259_1744 161
242 3300046524 Ga0495648_0001312 Ga0495648_0001312_22684_23169 161
243 3300046528 Ga0495642_0139391 Ga0495642_0139391_266_751 161
244 3300046529 Ga0495652_0255975 Ga0495652_0255975_675_1160 161
245 3300046538 Ga0495609_0212068 Ga0495609_0212068_214_699 161
246 3300046557 Ga0495622_0220533 Ga0495622_0220533_188_673 161
247 3300046558 Ga0495633_0000021 Ga0495633_0000021_138783_139268 161
248 3300046558 Ga0495633_0006537 Ga0495633_0006537_5447_5932 161
249 3300046558 Ga0495633_0305589 Ga0495633_0305589_46_531 161
250 3300046616 Ga0495668_0000075 Ga0495668_0000075_82092_82577 161
251 3300046616 Ga0495668_0170307 Ga0495668_0170307_43_528 161
252 3300046648 Ga0495611_0111296 Ga0495611_0111296_10_495 161
253 3300046660 Ga0495625_0000018 Ga0495625_0000018_244202_244687 161
254 3300046660 Ga0495625_0000439 Ga0495625_0000439_4394_4879 161
255 3300046660 Ga0495625_0001162 Ga0495625_0001162_26373_26858 161
256 3300046660 Ga0495625_0004744 Ga0495625_0004744_9858_10343 161
257 3300046660 Ga0495625_0101343 Ga0495625_0101343_234_719 161
258 3300046660 Ga0495625_0730650 Ga0495625_0730650_25_510 161
259 3300046663 Ga0495635_0209988 Ga0495635_0209988_313_798 161
260 3300046665 Ga0495661_0000485 Ga0495661_0000485_9199_9684 161
261 3300046665 Ga0495661_0018518 Ga0495661_0018518_2146_2631 161
262 3300046692 Ga0495671_0072504 Ga0495671_0072504_364_849 161
263 3300046692 Ga0495671_0167679 Ga0495671_0167679_361_846 161
264 3300046694 Ga0495649_0000015 Ga0495649_0000015_172897_173382 161
265 3300047443 Ga0495687_006547 Ga0495687_006547_471_956 161
266 3300047445 Ga0495677_0091383 Ga0495677_0091383_248_733 161
267 3300047447 Ga0495685_040315 Ga0495685_040315_886_1371 161
268 3300047472 Ga0495686_0002207 Ga0495686_0002207_6769_7254 161
269 3300047472 Ga0495686_0028569 Ga0495686_0028569_289_774 161
270 3300047472 Ga0495686_0062659 Ga0495686_0062659_485_970 161
271 3300047472 Ga0495686_0177908 Ga0495686_0177908_603_1091 161
272 3300048917 Ga0496114_1111245 Ga0496114_1111245_46_531 161
273 3300048918 Ga0496115_0061877 Ga0496115_0061877_668_1153 161
274 3300049459 Ga0495678_239364 Ga0495678_239364_38_523 161
275 3300050493 nmdc:mga0k408_2077_c1 nmdc:mga0k408_2077_c1_7411_7896 161
276 3300050493 nmdc:mga0k408_3438_c1 nmdc:mga0k408_3438_c1_2799_3299 161
277 3300050493 nmdc:mga0k408_7232_c1 nmdc:mga0k408_7232_c1_4477_4962 161
278 3300053090 Ga0500646_0053336 Ga0500646_0053336_351_836 161
279 3300053122 Ga0500608_016757 Ga0500608_016757_2622_3107 161
280 3300053123 Ga0500614_099281 Ga0500614_099281_112_597 161
281 3300053125 Ga0500618_000012 Ga0500618_000012_123681_124166 161
282 3300053125 Ga0500618_021263 Ga0500618_021263_553_1038 161
283 3300053153 Ga0500616_0268912 Ga0500616_0268912_113_598 161
284 3300053154 Ga0500619_067924 Ga0500619_067924_164_649 161
285 3300053156 Ga0500622_0005513 Ga0500622_0005513_2397_2882 161
286 3300053156 Ga0500622_0153117 Ga0500622_0153117_269_754 161
287 3300053161 Ga0500634_0226990 Ga0500634_0226990_144_629 161

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wxp-assembly2.cif.gz_D de novo tim barrel-ferredoxin fold fusion homodimer with 4-glutamate centre tfd-ee 0.6312 7 121
6gwj-assembly1.cif.gz_B human osgep / lage3 / gon7 complex 0.6094 9 87
6nuk-assembly1.cif.gz_A de novo designed protein ferredog-diesel 0.6022 1 90
4av2-assembly1.cif.gz_A single particle electron microscopy of pilq dodecameric complexes from neisseria meningitidis. 0.5994 7 85
2kjw-assembly1.cif.gz_A solution structure and backbone dynamics of the permutant p54-55 0.5772 5 92
ID Description Score Start End Superfamily
af_A4HRY4_300_413_3.30.70.1130 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;EIF_2_alpha 0.6623 7 90 3.30.70.1130
af_P84850_411_490_3.30.70.2740 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6352 9 90 3.30.70.2740
af_O07406_325_407_3.30.70.2740 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6239 9 93 3.30.70.2740
af_Q58341_1_185_3.30.2130.30 Alpha Beta;2-Layer Sandwich;VC0802-like; 0.6159 5 64 3.30.2130.30
af_G5EE33_680_891_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.6032 1 88 3.30.70.1230
ID Description Score Start End GO Terms
AF-A0A2H9VN69-F1-model_v4 ABC transporter ATPase 0.9935 1 158
AF-A0A355BC12-F1-model_v4 ABC transporter ATPase 0.9935 3 79
AF-A0A7V1SN25-F1-model_v4 ABC transporter ATPase 0.9929 1 159
AF-A0A7Y1V2Q8-F1-model_v4 ABC transporter ATPase 0.9894 3 153
AF-A0A519JUP5-F1-model_v4 ABC transporter ATPase 0.9879 2 93

Feature Viewer

pLDDT pTM Quality
94.03 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map