F387696

General Info

Members Datasets Scaffolds Average Seq Length
286 175 572 185

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_19072_c1|nmdc:mga0n895_19072_c1_542_1204
Length 220
Sequence MPITAGGDERRPYIRRACPVATPPPVRIADVEEAPMKTTLAVSLALSLSWTSILPAVEVSGVAVPETVAVDGKTLKLNGAGLRKKAFFKVYVAALYVENPSKNAAGLLSSNEVKSMRLHILRSLKGKQVSDAIAEGFERNSRDQMPKLKPRLDKLAAMIPDVKEGDEIALSWVPDKGTLVSVLGTDRGTIEGRDFADALFAVWLGPDPVQEDLKKALLGG

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.2
Rhizosphere 95.8
Stem 0
Stem Tuber 0
Unclassified 16.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_19072_c1 3300050512 Bacteria 6367
2 Ga0070690_100000153 3300005330 Bacteria 35124
3 Ga0070690_100043170 3300005330 Bacteria 2858
4 Ga0070690_100391955 3300005330 Bacteria 1018
5 Ga0070670_100006627 3300005331 Bacteria 9815
6 Ga0070670_100317281 3300005331 Bacteria 1365
7 Ga0068869_100028364 3300005334 Bacteria 3910
8 Ga0070666_10003171 3300005335 Bacteria 9993
9 Ga0068868_100007107 3300005338 Bacteria 7960
10 Ga0070689_100108723 3300005340 Bacteria 2203
11 Ga0070689_100206783 3300005340 Bacteria 1605
12 Ga0070687_100322975 3300005343 Bacteria 987
13 Ga0070661_100187059 3300005344 Bacteria 1578
14 Ga0070692_10013218 3300005345 Bacteria 3844
15 Ga0070668_100118783 3300005347 Bacteria 2111
16 Ga0070675_100071336 3300005354 Bacteria 2881
17 Ga0070674_100277880 3300005356 Bacteria 1326
18 Ga0070673_100257069 3300005364 Bacteria 1524
19 Ga0070667_100003746 3300005367 Bacteria 12911
20 Ga0070667_100175908 3300005367 Unclassified 1891
21 Ga0070667_100346508 3300005367 Bacteria 1344
22 Ga0070705_100229859 3300005440 Bacteria 1290
23 Ga0070694_100131092 3300005444 Bacteria 1811
24 Ga0070708_100000607 3300005445 Bacteria 26975
25 Ga0070708_100001412 3300005445 Bacteria 18343
26 Ga0070708_100058297 3300005445 Bacteria 3440
27 Ga0070708_100297326 3300005445 Unclassified 1520
28 Ga0070708_100360363 3300005445 Bacteria 1370
29 Ga0070708_100410486 3300005445 Bacteria 1277
30 Ga0070663_100043730 3300005455 Bacteria 3154
31 Ga0070663_100056337 3300005455 Bacteria 2816
32 Ga0070678_100271899 3300005456 Bacteria 1429
33 Ga0070678_100566012 3300005456 Bacteria 1011
34 Ga0070681_10515379 3300005458 Bacteria 1109
35 Ga0068867_100021934 3300005459 Bacteria 4561
36 Ga0070706_100004495 3300005467 Bacteria 13449
37 Ga0070706_100093553 3300005467 Bacteria 2789
38 Ga0070707_100033376 3300005468 Bacteria 4908
39 Ga0070707_100269144 3300005468 Bacteria 1657
40 Ga0070707_100287876 3300005468 Bacteria 1596
41 Ga0070707_100496897 3300005468 Unclassified 1181
42 Ga0070698_100030460 3300005471 Bacteria 5593
43 Ga0070698_100160297 3300005471 Unclassified 2194
44 Ga0070698_100456488 3300005471 Bacteria 1214
45 Ga0070699_100079530 3300005518 Bacteria 2856
46 Ga0070699_100227607 3300005518 Bacteria 1662
47 Ga0070697_100002559 3300005536 Bacteria 14001
48 Ga0070697_100008861 3300005536 Bacteria 7854
49 Ga0070697_100020984 3300005536 Bacteria 5171
50 Ga0070697_100774875 3300005536 Bacteria 848
51 Ga0070697_100778266 3300005536 Unclassified 846
52 Ga0070672_100190863 3300005543 Unclassified 1710
53 Ga0070672_100522144 3300005543 Bacteria 1029
54 Ga0070686_100009996 3300005544 Bacteria 5340
55 Ga0070686_100015660 3300005544 Bacteria 4398
56 Ga0070695_100015546 3300005545 Bacteria 4597
57 Ga0070695_100167764 3300005545 Unclassified 1546
58 Ga0070696_100113807 3300005546 Bacteria 1951
59 Ga0070696_100133255 3300005546 Bacteria 1810
60 Ga0070696_100266193 3300005546 Bacteria 1302
61 Ga0070665_100016719 3300005548 Bacteria 7353
62 Ga0070665_100166902 3300005548 Bacteria 2204
63 Ga0070704_100229499 3300005549 Bacteria 1513
64 Ga0070664_100099423 3300005564 Bacteria 2528
65 Ga0070664_100334176 3300005564 Bacteria 1375
66 Ga0070664_100522313 3300005564 Bacteria 1096
67 Ga0068854_100070657 3300005578 Bacteria 2552
68 Ga0068856_100008070 3300005614 Bacteria 10276
69 Ga0068859_100049277 3300005617 Bacteria 4230
70 Ga0068859_100077530 3300005617 Bacteria 3364
71 Ga0068864_100027569 3300005618 Bacteria 4798
72 Ga0068851_10293400 3300005834 Bacteria 933
73 Ga0068863_100007443 3300005841 Bacteria 10713
74 Ga0068863_100110921 3300005841 Bacteria 2613
75 Ga0068858_100006654 3300005842 Bacteria 11240
76 Ga0068860_100008145 3300005843 Bacteria 10432
77 Ga0068860_100045837 3300005843 Bacteria 4169
78 Ga0068862_100009633 3300005844 Bacteria 7984
79 Ga0097621_100060074 3300006237 Bacteria 3115
80 Ga0097621_100158080 3300006237 Bacteria 1947
81 Ga0097621_100353683 3300006237 Bacteria 1307
82 Ga0097621_100585171 3300006237 Unclassified 1019
83 Ga0068871_100013967 3300006358 Bacteria 5974
84 Ga0068871_100018567 3300006358 Bacteria 5289
85 Ga0068871_100257022 3300006358 Unclassified 1523
86 Ga0068871_100976457 3300006358 Unclassified 788
87 Ga0075430_100016822 3300006846 Bacteria 6228
88 Ga0075431_100479213 3300006847 Unclassified 1237
89 Ga0075433_10001516 3300006852 Bacteria 17154
90 Ga0075433_10544983 3300006852 Unclassified 1020
91 Ga0075433_10846100 3300006852 Unclassified 799
92 Ga0075434_100003107 3300006871 Bacteria 14789
93 Ga0075434_100111063 3300006871 Unclassified 2752
94 Ga0075434_100627240 3300006871 Bacteria 1094
95 Ga0068865_100010959 3300006881 Bacteria 5658
96 Ga0068865_100264847 3300006881 Bacteria 1362
97 Ga0075436_100171814 3300006914 Unclassified 1530
98 Ga0097620_100049274 3300006931 Bacteria 4230
99 Ga0097620_100077530 3300006931 Bacteria 3364
100 Ga0075435_100098865 3300007076 Unclassified 2416
101 Ga0075435_100182227 3300007076 Unclassified 1775
102 Ga0099794_10000030 3300007265 Bacteria 58807
103 Ga0099794_10011033 3300007265 Bacteria 3859
104 Ga0099795_10057356 3300007788 Bacteria 1435
105 Ga0105247_10241202 3300009101 Bacteria 1232
106 Ga0114129_10004525 3300009147 Bacteria 19624
107 Ga0114129_10008252 3300009147 Bacteria 14853
108 Ga0114129_10656959 3300009147 Unclassified 1353
109 Ga0105243_10033502 3300009148 Bacteria 3973
110 Ga0105242_10197195 3300009176 Bacteria 1786
111 Ga0105248_10107356 3300009177 Bacteria 3148
112 Ga0105248_10196029 3300009177 Bacteria 2275
113 Ga0105248_12044130 3300009177 Bacteria 651
114 Ga0105249_11009913 3300009553 Bacteria 901
115 Ga0105249_11233602 3300009553 Bacteria 819
116 Ga0157378_10019278 3300013297 Bacteria 5996
117 Ga0163162_10015342 3300013306 Bacteria 7485
118 Ga0163162_10286522 3300013306 Bacteria 1779
119 Ga0157375_10004747 3300013308 Bacteria 11812
120 Ga0157375_10018506 3300013308 Bacteria 6319
121 Ga0157375_10736220 3300013308 Bacteria 1138
122 Ga0157375_11140223 3300013308 Bacteria 913
123 Ga0163163_10007893 3300014325 Bacteria 9408
124 Ga0157380_10374842 3300014326 Bacteria 1341
125 Ga0157377_10063947 3300014745 Bacteria 2109
126 Ga0157379_10002314 3300014968 Bacteria 15881
127 Ga0157379_10031501 3300014968 Bacteria 4724
128 Ga0157379_10556624 3300014968 Unclassified 1067
129 Ga0157376_10012661 3300014969 Bacteria 6270
130 Ga0157376_10136571 3300014969 Unclassified 2195
131 Ga0157376_10159476 3300014969 Bacteria 2043
132 Ga0157376_10364551 3300014969 Unclassified 1387
133 Ga0207680_10032737 3300025903 Bacteria 2958
134 Ga0207680_10081127 3300025903 Bacteria 2038
135 Ga0207684_10000011 3300025910 Bacteria 502991
136 Ga0207684_10000890 3300025910 Bacteria 33979
137 Ga0207684_10039561 3300025910 Bacteria 3999
138 Ga0207684_10042111 3300025910 Bacteria 3871
139 Ga0207707_10439088 3300025912 Bacteria 1117
140 Ga0207649_10280656 3300025920 Bacteria 1211
141 Ga0207646_10026116 3300025922 Bacteria 5335
142 Ga0207646_10180139 3300025922 Bacteria 1909
143 Ga0207646_10420899 3300025922 Bacteria 1206
144 Ga0207650_10122403 3300025925 Bacteria 2027
145 Ga0207659_10062282 3300025926 Bacteria 2692
146 Ga0207659_10733179 3300025926 Unclassified 847
147 Ga0207644_10866684 3300025931 Bacteria 756
148 Ga0207706_10052371 3300025933 Bacteria 3603
149 Ga0207709_10077241 3300025935 Bacteria 2134
150 Ga0207669_10243628 3300025937 Bacteria 1334
151 Ga0207691_10026453 3300025940 Bacteria 5442
152 Ga0207711_10000904 3300025941 Bacteria 28550
153 Ga0207711_10014322 3300025941 Bacteria 6586
154 Ga0207711_10267629 3300025941 Bacteria 1572
155 Ga0207689_10004541 3300025942 Bacteria 12563
156 Ga0207689_10533563 3300025942 Unclassified 985
157 Ga0207679_10166222 3300025945 Bacteria 1812
158 Ga0207667_10450568 3300025949 Unclassified 1308
159 Ga0207651_10208022 3300025960 Bacteria 1573
160 Ga0207668_10899479 3300025972 Bacteria 788
161 Ga0207640_10124765 3300025981 Bacteria 1852
162 Ga0207658_10020118 3300025986 Bacteria 4621
163 Ga0207658_10116330 3300025986 Bacteria 2124
164 Ga0207677_10568948 3300026023 Bacteria 990
165 Ga0207703_10008568 3300026035 Bacteria 8072
166 Ga0207678_10029801 3300026067 Bacteria 4765
167 Ga0207678_10088436 3300026067 Bacteria 2647
168 Ga0207702_10448222 3300026078 Unclassified 1252
169 Ga0207641_10015051 3300026088 Bacteria 6338
170 Ga0207641_10028413 3300026088 Bacteria 4622
171 Ga0207641_10132232 3300026088 Unclassified 2242
172 Ga0207641_10474761 3300026088 Unclassified 1211
173 Ga0207641_10573529 3300026088 Bacteria 1102
174 Ga0207641_11435660 3300026088 Unclassified 691
175 Ga0207648_10012055 3300026089 Bacteria 8108
176 Ga0207676_10226198 3300026095 Bacteria 1669
177 Ga0207676_10290795 3300026095 Bacteria 1488
178 Ga0207675_100005372 3300026118 Bacteria 12294
179 Ga0207683_10016925 3300026121 Bacteria 6205
180 Ga0209588_1000015 3300027671 Bacteria 129625
181 Ga0209588_1026908 3300027671 Bacteria 1828
182 Ga0268266_10204447 3300028379 Bacteria 1808
183 Ga0268266_10731634 3300028379 Bacteria 954
184 Ga0268265_10026854 3300028380 Bacteria 4100
185 Ga0268264_10175893 3300028381 Bacteria 1940
186 Ga0265314_10075120 3300031711 Bacteria 2249
187 Ga0307412_10509624 3300031911 Bacteria 1003
188 Ga0307416_100031860 3300032002 Bacteria 3975
189 Ga0307416_100323835 3300032002 Bacteria 1545
190 Ga0307415_100340858 3300032126 Bacteria 1258
191 Ga0373923_0479472 3300035111 Bacteria 605
192 Ga0373955_0149932 3300035172 Bacteria 1372
193 Ga0373947_0083702 3300035725 Bacteria 1979
194 Ga0373937_0038980 3300036401 Bacteria 4329
195 Ga0373937_0319670 3300036401 Bacteria 1468
196 Ga0373925_0300087 3300037068 Unclassified 1297
197 Ga0395901_0738125 3300038443 Unclassified 979
198 Ga0451577_0040718 3300042876 Bacteria 4171
199 Ga0453683_0107333 3300044673 Bacteria 1755
200 Ga0453683_0440555 3300044673 Bacteria 842
201 Ga0451576_0383854 3300045051 Bacteria 1472
202 Ga0495592_0004874 3300046454 Bacteria 9877
203 Ga0495629_0308700 3300046459 Unclassified 1082
204 Ga0495651_0326000 3300046462 Bacteria 1022
205 Ga0495653_0048171 3300046463 Bacteria 3292
206 Ga0495580_0000582 3300046472 Bacteria 30822
207 Ga0495582_0034386 3300046473 Bacteria 2786
208 Ga0495582_0177365 3300046473 Bacteria 1214
209 Ga0495639_0197112 3300046475 Bacteria 985
210 Ga0495662_0007586 3300046476 Bacteria 5354
211 Ga0495585_0094212 3300046492 Bacteria 1610
212 Ga0495585_0353890 3300046492 Unclassified 713
213 Ga0495606_0008110 3300046507 Bacteria 9207
214 Ga0495618_0079466 3300046514 Bacteria 2092
215 Ga0495628_0006510 3300046516 Bacteria 10197
216 Ga0495630_0013249 3300046517 Bacteria 5998
217 Ga0495630_0281719 3300046517 Bacteria 1270
218 Ga0495666_0006282 3300046526 Bacteria 5984
219 Ga0495652_0314963 3300046529 Bacteria 1132
220 Ga0495665_0080289 3300046531 Bacteria 1716
221 Ga0495640_0007142 3300046533 Bacteria 8793
222 Ga0495586_0005252 3300046535 Bacteria 6931
223 Ga0495587_0003700 3300046536 Bacteria 10167
224 Ga0495645_0047587 3300046543 Bacteria 3124
225 Ga0495667_0000672 3300046559 Bacteria 21886
226 Ga0495634_0001130 3300046642 Bacteria 24672
227 Ga0495635_0074828 3300046663 Unclassified 2320
228 Ga0495635_0076686 3300046663 Bacteria 2290
229 Ga0495599_0018626 3300046678 Bacteria 4325
230 Ga0495623_0183226 3300046679 Bacteria 1215
231 Ga0495646_0355671 3300046680 Bacteria 767
232 Ga0495658_0003278 3300046683 Bacteria 8044
233 Ga0495658_0006434 3300046683 Bacteria 5771
234 Ga0495658_0096979 3300046683 Bacteria 1754
235 Ga0495613_0004594 3300046689 Bacteria 10361
236 Ga0495600_0007741 3300046809 Bacteria 6579
237 Ga0495600_0148397 3300046809 Bacteria 1519
238 Ga0495636_0022746 3300047318 Bacteria 2536
239 Ga0495674_0233677 3300047319 Bacteria 1517
240 Ga0495674_0320775 3300047319 Bacteria 1262
241 Ga0495680_0000812 3300047322 Bacteria 34880
242 Ga0495675_0029587 3300047444 Bacteria 3494
243 Ga0495602_0321772 3300048088 Unclassified 1125
244 Ga0495615_0013545 3300048090 Bacteria 1706
245 Ga0496100_0016730 3300048903 Bacteria 4314
246 Ga0496100_0057090 3300048903 Bacteria 2556
247 Ga0496102_0025657 3300048905 Bacteria 5250
248 Ga0496102_0075413 3300048905 Bacteria 3101
249 Ga0496102_0128180 3300048905 Bacteria 2373
250 Ga0496102_0321807 3300048905 Bacteria 1457
251 Ga0496103_0290987 3300048906 Bacteria 1051
252 Ga0496104_0546623 3300048907 Bacteria 1069
253 Ga0496105_0151213 3300048908 Bacteria 1908
254 Ga0496107_0004813 3300048910 Bacteria 9164
255 Ga0496110_0213230 3300048913 Bacteria 1756
256 Ga0496112_0023668 3300048915 Bacteria 5874
257 Ga0501038_0647178 3300049574 Unclassified 796
258 Ga0501067_0030107 3300049583 Bacteria 3010
259 Ga0501069_0446179 3300049585 Unclassified 769
260 Ga0501075_0722237 3300049591 Bacteria 759
261 Ga0501076_0353197 3300049592 Bacteria 1207
262 Ga0501080_0158925 3300049742 Unclassified 2088
263 Ga0501081_0195261 3300049743 Bacteria 1467
264 Ga0501045_0123463 3300049824 Bacteria 1923
265 nmdc:mga05p37_425231_c1 3300050507 Unclassified 1545
266 nmdc:mga05p37_4818_c2 3300050507 Bacteria 15585
267 nmdc:mga05p37_577210_c1 3300050507 Unclassified 1274
268 nmdc:mga06r32_1051551_c1 3300050510 Unclassified 765
269 nmdc:mga0n895_22531_c1 3300050512 Bacteria 5908
270 nmdc:mga0n895_4117_c1 3300050512 Bacteria 11851
271 nmdc:mga0n895_74284_c1 3300050512 Bacteria 2416
272 nmdc:mga0rr50_192170_c1 3300050513 Unclassified 1673
273 nmdc:mga0rr50_25999_c1 3300050513 Bacteria 4077
274 nmdc:mga0rr50_286586_c1 3300050513 Bacteria 1375
275 nmdc:mga0rr50_90935_c1 3300050513 Unclassified 2376
276 nmdc:mga08x19_143482_c1 3300050514 Unclassified 1614
277 nmdc:mga08x19_38443_c1 3300050514 Bacteria 3040
278 nmdc:mga0a205_57706_c1 3300050515 Bacteria 3748
279 nmdc:mga0a205_617439_c1 3300050515 Unclassified 937
280 nmdc:mga0a205_787554_c1 3300050515 Unclassified 799
281 nmdc:mga0a205_893_c2 3300050515 Bacteria 23258
282 Ga0495601_0007320 3300053077 Bacteria 6469
283 Ga0495601_0009793 3300053077 Bacteria 5669
284 Ga0495595_0019766 3300053084 Unclassified 2925
285 Ga0495619_0003704 3300053085 Bacteria 9856
286 Ga0530510_0285152 3300061734 Bacteria 1234
287 nmdc:mga0n895_19072_c1
288 Ga0070690_100000153
289 Ga0070690_100043170
290 Ga0070690_100391955
291 Ga0070670_100006627
292 Ga0070670_100317281
293 Ga0068869_100028364
294 Ga0070666_10003171
295 Ga0068868_100007107
296 Ga0070689_100108723
297 Ga0070689_100206783
298 Ga0070687_100322975
299 Ga0070661_100187059
300 Ga0070692_10013218
301 Ga0070668_100118783
302 Ga0070675_100071336
303 Ga0070674_100277880
304 Ga0070673_100257069
305 Ga0070667_100003746
306 Ga0070667_100175908
307 Ga0070667_100346508
308 Ga0070705_100229859
309 Ga0070694_100131092
310 Ga0070708_100000607
311 Ga0070708_100001412
312 Ga0070708_100058297
313 Ga0070708_100297326
314 Ga0070708_100360363
315 Ga0070708_100410486
316 Ga0070663_100043730
317 Ga0070663_100056337
318 Ga0070678_100271899
319 Ga0070678_100566012
320 Ga0070681_10515379
321 Ga0068867_100021934
322 Ga0070706_100004495
323 Ga0070706_100093553
324 Ga0070707_100033376
325 Ga0070707_100269144
326 Ga0070707_100287876
327 Ga0070707_100496897
328 Ga0070698_100030460
329 Ga0070698_100160297
330 Ga0070698_100456488
331 Ga0070699_100079530
332 Ga0070699_100227607
333 Ga0070697_100002559
334 Ga0070697_100008861
335 Ga0070697_100020984
336 Ga0070697_100774875
337 Ga0070697_100778266
338 Ga0070672_100190863
339 Ga0070672_100522144
340 Ga0070686_100009996
341 Ga0070686_100015660
342 Ga0070695_100015546
343 Ga0070695_100167764
344 Ga0070696_100113807
345 Ga0070696_100133255
346 Ga0070696_100266193
347 Ga0070665_100016719
348 Ga0070665_100166902
349 Ga0070704_100229499
350 Ga0070664_100099423
351 Ga0070664_100334176
352 Ga0070664_100522313
353 Ga0068854_100070657
354 Ga0068856_100008070
355 Ga0068859_100049277
356 Ga0068859_100077530
357 Ga0068864_100027569
358 Ga0068851_10293400
359 Ga0068863_100007443
360 Ga0068863_100110921
361 Ga0068858_100006654
362 Ga0068860_100008145
363 Ga0068860_100045837
364 Ga0068862_100009633
365 Ga0097621_100060074
366 Ga0097621_100158080
367 Ga0097621_100353683
368 Ga0097621_100585171
369 Ga0068871_100013967
370 Ga0068871_100018567
371 Ga0068871_100257022
372 Ga0068871_100976457
373 Ga0075430_100016822
374 Ga0075431_100479213
375 Ga0075433_10001516
376 Ga0075433_10544983
377 Ga0075433_10846100
378 Ga0075434_100003107
379 Ga0075434_100111063
380 Ga0075434_100627240
381 Ga0068865_100010959
382 Ga0068865_100264847
383 Ga0075436_100171814
384 Ga0097620_100049274
385 Ga0097620_100077530
386 Ga0075435_100098865
387 Ga0075435_100182227
388 Ga0099794_10000030
389 Ga0099794_10011033
390 Ga0099795_10057356
391 Ga0105247_10241202
392 Ga0114129_10004525
393 Ga0114129_10008252
394 Ga0114129_10656959
395 Ga0105243_10033502
396 Ga0105242_10197195
397 Ga0105248_10107356
398 Ga0105248_10196029
399 Ga0105248_12044130
400 Ga0105249_11009913
401 Ga0105249_11233602
402 Ga0157378_10019278
403 Ga0163162_10015342
404 Ga0163162_10286522
405 Ga0157375_10004747
406 Ga0157375_10018506
407 Ga0157375_10736220
408 Ga0157375_11140223
409 Ga0163163_10007893
410 Ga0157380_10374842
411 Ga0157377_10063947
412 Ga0157379_10002314
413 Ga0157379_10031501
414 Ga0157379_10556624
415 Ga0157376_10012661
416 Ga0157376_10136571
417 Ga0157376_10159476
418 Ga0157376_10364551
419 Ga0207680_10032737
420 Ga0207680_10081127
421 Ga0207684_10000011
422 Ga0207684_10000890
423 Ga0207684_10039561
424 Ga0207684_10042111
425 Ga0207707_10439088
426 Ga0207649_10280656
427 Ga0207646_10026116
428 Ga0207646_10180139
429 Ga0207646_10420899
430 Ga0207650_10122403
431 Ga0207659_10062282
432 Ga0207659_10733179
433 Ga0207644_10866684
434 Ga0207706_10052371
435 Ga0207709_10077241
436 Ga0207669_10243628
437 Ga0207691_10026453
438 Ga0207711_10000904
439 Ga0207711_10014322
440 Ga0207711_10267629
441 Ga0207689_10004541
442 Ga0207689_10533563
443 Ga0207679_10166222
444 Ga0207667_10450568
445 Ga0207651_10208022
446 Ga0207668_10899479
447 Ga0207640_10124765
448 Ga0207658_10020118
449 Ga0207658_10116330
450 Ga0207677_10568948
451 Ga0207703_10008568
452 Ga0207678_10029801
453 Ga0207678_10088436
454 Ga0207702_10448222
455 Ga0207641_10015051
456 Ga0207641_10028413
457 Ga0207641_10132232
458 Ga0207641_10474761
459 Ga0207641_10573529
460 Ga0207641_11435660
461 Ga0207648_10012055
462 Ga0207676_10226198
463 Ga0207676_10290795
464 Ga0207675_100005372
465 Ga0207683_10016925
466 Ga0209588_1000015
467 Ga0209588_1026908
468 Ga0268266_10204447
469 Ga0268266_10731634
470 Ga0268265_10026854
471 Ga0268264_10175893
472 Ga0265314_10075120
473 Ga0307412_10509624
474 Ga0307416_100031860
475 Ga0307416_100323835
476 Ga0307415_100340858
477 Ga0373923_0479472
478 Ga0373955_0149932
479 Ga0373947_0083702
480 Ga0373937_0038980
481 Ga0373937_0319670
482 Ga0373925_0300087
483 Ga0395901_0738125
484 Ga0451577_0040718
485 Ga0453683_0107333
486 Ga0453683_0440555
487 Ga0451576_0383854
488 Ga0495592_0004874
489 Ga0495629_0308700
490 Ga0495651_0326000
491 Ga0495653_0048171
492 Ga0495580_0000582
493 Ga0495582_0034386
494 Ga0495582_0177365
495 Ga0495639_0197112
496 Ga0495662_0007586
497 Ga0495585_0094212
498 Ga0495585_0353890
499 Ga0495606_0008110
500 Ga0495618_0079466
501 Ga0495628_0006510
502 Ga0495630_0013249
503 Ga0495630_0281719
504 Ga0495666_0006282
505 Ga0495652_0314963
506 Ga0495665_0080289
507 Ga0495640_0007142
508 Ga0495586_0005252
509 Ga0495587_0003700
510 Ga0495645_0047587
511 Ga0495667_0000672
512 Ga0495634_0001130
513 Ga0495635_0074828
514 Ga0495635_0076686
515 Ga0495599_0018626
516 Ga0495623_0183226
517 Ga0495646_0355671
518 Ga0495658_0003278
519 Ga0495658_0006434
520 Ga0495658_0096979
521 Ga0495613_0004594
522 Ga0495600_0007741
523 Ga0495600_0148397
524 Ga0495636_0022746
525 Ga0495674_0233677
526 Ga0495674_0320775
527 Ga0495680_0000812
528 Ga0495675_0029587
529 Ga0495602_0321772
530 Ga0495615_0013545
531 Ga0496100_0016730
532 Ga0496100_0057090
533 Ga0496102_0025657
534 Ga0496102_0075413
535 Ga0496102_0128180
536 Ga0496102_0321807
537 Ga0496103_0290987
538 Ga0496104_0546623
539 Ga0496105_0151213
540 Ga0496107_0004813
541 Ga0496110_0213230
542 Ga0496112_0023668
543 Ga0501038_0647178
544 Ga0501067_0030107
545 Ga0501069_0446179
546 Ga0501075_0722237
547 Ga0501076_0353197
548 Ga0501080_0158925
549 Ga0501081_0195261
550 Ga0501045_0123463
551 nmdc:mga05p37_425231_c1
552 nmdc:mga05p37_4818_c2
553 nmdc:mga05p37_577210_c1
554 nmdc:mga06r32_1051551_c1
555 nmdc:mga0n895_22531_c1
556 nmdc:mga0n895_4117_c1
557 nmdc:mga0n895_74284_c1
558 nmdc:mga0rr50_192170_c1
559 nmdc:mga0rr50_25999_c1
560 nmdc:mga0rr50_286586_c1
561 nmdc:mga0rr50_90935_c1
562 nmdc:mga08x19_143482_c1
563 nmdc:mga08x19_38443_c1
564 nmdc:mga0a205_57706_c1
565 nmdc:mga0a205_617439_c1
566 nmdc:mga0a205_787554_c1
567 nmdc:mga0a205_893_c2
568 Ga0495601_0007320
569 Ga0495601_0009793
570 Ga0495595_0019766
571 Ga0495619_0003704
572 Ga0530510_0285152

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16036

Chalcone_3

Chalcone isomerase-like

56

219

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4doi-assembly2.cif.gz_B crystal structure of arabidopsis thaliana chalcone isomerase at3g55120 (atchi) 0.8569 21 183
6ms8-assembly8.cif.gz_H crystal structure of chalcone isomerase from medicago truncatula complexed with (2s) naringenin 0.8485 21 183
5yx3-assembly1.cif.gz_B chalcone isomerase from the antarctic vascular plant deschampsia antarctica (dachi1) 0.8426 18 183
5yx4-assembly1.cif.gz_A isoliquiritigenin-complexed chalcone isomerase (s189a) from the antarctic vascular plant deschampsia antarctica (dachi1) 0.8323 21 183
1jx1-assembly4.cif.gz_D chalcone isomerase--t48a mutant 0.8297 19 183
ID Description Score Start End Superfamily
af_A0JML9_281_432_2.60.120.920 Mainly Beta;Sandwich;Jelly Rolls;SPRY domain 0.8627 127 154 2.60.120.920
af_A0A1D6H5M0_65_273_3.50.70.10 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase; 0.8518 26 147 3.50.70.10
af_Q94215_1_142_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.851 131 156 2.60.120.200
af_D4A198_713_881_2.60.120.920 Mainly Beta;Sandwich;Jelly Rolls;SPRY domain 0.8445 127 154 2.60.120.920
af_Q5NCX5_44_207_2.60.120.920 Mainly Beta;Sandwich;Jelly Rolls;SPRY domain 0.828 127 154 2.60.120.920
ID Description Score Start End GO Terms
AF-A0A0B0H890-F1-model_v4 Chalcone isomerase domain-containing protein 0.9815 19 185 GO:0016872
AF-A0A0S8GCR2-F1-model_v4 Chalcone isomerase domain-containing protein 0.9779 20 184 GO:0016872
AF-A0A839A1Q5-F1-model_v4 deleted 0.9762 42 185
AF-A0A0S8CYS3-F1-model_v4 Chalcone isomerase domain-containing protein 0.9755 17 184 GO:0016872
AF-A0A833ITG3-F1-model_v4 Chalcone isomerase domain-containing protein 0.9706 17 184 GO:0016872

Map