F387668

General Info

Members Datasets Scaffolds Average Seq Length
286 181 572 161

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_1201355|Ga0501034_1201355_39_545
Length 155
Sequence VSEQNSGQMIQVPNTLRLKVGGAGRLGALDPAAIAKAEAALKSLSGNFAQWLQDEINKLEEARAAIKTEGMNRQTADRLYLHSHDLKGLGATYEYPLITRIAGSLCKLMDDQESRVASPMFLIDAHITNHPVGRVLAEELERRVLAYLDEHGPKR

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
36 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
37 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
43 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
57 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
58 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
68 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
69 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
73 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
74 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
75 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
76 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
77 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
78 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
79 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
80 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
81 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
82 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
83 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
84 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
85 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
86 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
87 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
88 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
89 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
90 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
91 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
92 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
93 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
94 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
95 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
98 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
99 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
100 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
101 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
102 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
103 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
104 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
107 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
110 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
111 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
112 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
113 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
114 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
126 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
127 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
128 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
129 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
130 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
131 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
132 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
133 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
134 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
135 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
136 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
137 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
138 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
139 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
140 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
141 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
142 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
143 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
144 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
145 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
146 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
147 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
148 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
151 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
152 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
153 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
154 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
155 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
156 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
157 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
158 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
159 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
160 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
161 2643221583 Caulobacter sp. Root655 Isolate Unclassified
162 2643221584 Caulobacter sp. Root656 Isolate Unclassified
163 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
164 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
165 2643221640 Caulobacter sp. Root342 Isolate Unclassified
166 2643221642 Caulobacter sp. Root343 Isolate Unclassified
167 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
168 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
169 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
170 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
171 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
172 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
173 2818991435 Caulobacter henricii 536 Isolate Unclassified
174 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
175 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
176 2849560528 Caulobacter zeae 410 Isolate Unclassified
177 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
178 2851153111 Caulobacter radicis 736 Isolate Unclassified
179 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
180 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
181 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.51
Metatranscriptomes 0
Isolates 10.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.87
Nodule 0
Rhizoplane 1.4
Rhizosphere 59.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_1201355 3300049571 Bacteria 637
2 JGI25153J46596_10021745 3300003215 Bacteria 2383
3 rootH2_10023832 3300003320 Bacteria 2389
4 rootL2_10080588 3300003322 Bacteria 1229
5 Ga0055537_1007754 3300003773 Bacteria 2548
6 Ga0055524_1006218 3300003775 Bacteria 5209
7 Ga0055524_1007535 3300003775 Bacteria 4606
8 Ga0055536_1001984 3300003781 Bacteria 11735
9 Ga0055528_1008303 3300003790 Bacteria 4474
10 Ga0055530_10018436 3300003791 Bacteria 2150
11 Ga0055531_10000799 3300003794 Bacteria 26105
12 Ga0055531_10007315 3300003794 Bacteria 6053
13 Ga0065165_1001007 3300005262 Bacteria 34394
14 Ga0070658_10140802 3300005327 Bacteria 2015
15 Ga0070666_10371048 3300005335 Bacteria 1026
16 Ga0070668_100006149 3300005347 Bacteria 8894
17 Ga0070668_100038984 3300005347 Bacteria 3634
18 Ga0070667_100455529 3300005367 Bacteria 1169
19 Ga0070663_100320505 3300005455 Bacteria 1246
20 Ga0070678_101433939 3300005456 Bacteria 645
21 Ga0070665_100466474 3300005548 Bacteria 1273
22 Ga0068855_100479065 3300005563 Bacteria 1355
23 Ga0068857_100519300 3300005577 Bacteria 1119
24 Ga0068863_100410760 3300005841 Bacteria 1325
25 Ga0068860_101700204 3300005843 Bacteria 653
26 Ga0068862_100010612 3300005844 Bacteria 7613
27 Ga0068862_100027881 3300005844 Bacteria 4757
28 Ga0068862_100207475 3300005844 Bacteria 1769
29 Ga0075362_10284081 3300006177 Bacteria 819
30 Ga0075369_10101847 3300006186 Bacteria 1289
31 Ga0105240_11201304 3300009093 Bacteria 803
32 Ga0105241_10541682 3300009174 Bacteria 1044
33 Ga0105237_10905720 3300009545 Bacteria 889
34 Ga0105238_10355990 3300009551 Bacteria 1453
35 Ga0105239_10432356 3300010375 Bacteria 1492
36 Ga0163162_10722761 3300013306 Bacteria 1116
37 Ga0157375_11140343 3300013308 Bacteria 913
38 Ga0163163_10107147 3300014325 Bacteria 2821
39 Ga0157380_11078159 3300014326 Bacteria 841
40 Ga0163161_10546614 3300017792 Bacteria 949
41 Ga0209026_1006855 3300025250 Bacteria 2693
42 Ga0209565_1002577 3300025263 Bacteria 6432
43 Ga0209673_1000807 3300025273 Bacteria 41435
44 Ga0209673_1026530 3300025273 Bacteria 1900
45 Ga0209675_1053104 3300025291 Bacteria 828
46 Ga0209676_1000200 3300025292 Bacteria 133793
47 Ga0209676_1000606 3300025292 Bacteria 52511
48 Ga0209676_1005079 3300025292 Bacteria 7029
49 Ga0209564_1001421 3300025295 Bacteria 24658
50 Ga0209564_1015325 3300025295 Bacteria 3126
51 Ga0209564_1020859 3300025295 Bacteria 2383
52 Ga0209758_1001528 3300025297 Bacteria 26711
53 Ga0209758_1003270 3300025297 Bacteria 15024
54 Ga0209050_1000057 3300025298 Bacteria 326289
55 Ga0209256_1001936 3300025299 Bacteria 18867
56 Ga0209256_1004620 3300025299 Bacteria 8499
57 Ga0209256_1053331 3300025299 Bacteria 968
58 Ga0209051_1003086 3300025303 Bacteria 11242
59 Ga0209257_1000284 3300025304 Bacteria 112773
60 Ga0209257_1000702 3300025304 Bacteria 51789
61 Ga0209257_1004520 3300025304 Bacteria 10686
62 Ga0207705_10104991 3300025909 Bacteria 2082
63 Ga0207654_10324711 3300025911 Bacteria 1053
64 Ga0207695_10006113 3300025913 Bacteria 15708
65 Ga0207694_10649322 3300025924 Bacteria 889
66 Ga0207668_10006401 3300025972 Bacteria 6960
67 Ga0207668_10020603 3300025972 Bacteria 4193
68 Ga0207668_10039144 3300025972 Bacteria 3188
69 Ga0207702_10525145 3300026078 Bacteria 1156
70 Ga0207641_10276732 3300026088 Bacteria 1577
71 Ga0268265_10003844 3300028380 Bacteria 10624
72 Ga0268265_10043275 3300028380 Bacteria 3347
73 Ga0268265_10044708 3300028380 Bacteria 3299
74 Ga0268265_10062579 3300028380 Bacteria 2860
75 Ga0268264_10000021 3300028381 Bacteria 481580
76 Ga0265337_1014335 3300028556 Bacteria 2630
77 Ga0265334_10036651 3300028573 Bacteria 1936
78 Ga0265334_10055082 3300028573 Bacteria 1515
79 Ga0307515_10050759 3300028794 Bacteria 6203
80 Ga0307515_10088980 3300028794 Bacteria 3894
81 Ga0307515_10163372 3300028794 Bacteria 2258
82 Ga0307515_10205275 3300028794 Bacteria 1833
83 Ga0265338_10002312 3300028800 Bacteria 28912
84 Ga0265338_10009002 3300028800 Bacteria 12009
85 Ga0265338_10151293 3300028800 Bacteria 1803
86 Ga0265338_10188827 3300028800 Bacteria 1564
87 Ga0265338_10200499 3300028800 Bacteria 1505
88 Ga0265327_10000447 3300031251 Bacteria 74605
89 Ga0265327_10052668 3300031251 Bacteria 2118
90 Ga0307405_11206383 3300031731 Bacteria 655
91 Ga0307413_10032715 3300031824 Bacteria 2951
92 Ga0307413_11760592 3300031824 Bacteria 554
93 Ga0307406_10025701 3300031901 Bacteria 3527
94 Ga0307406_10331153 3300031901 Bacteria 1182
95 Ga0307412_10001163 3300031911 Bacteria 15065
96 Ga0307414_10004190 3300032004 Bacteria 7799
97 Ga0307414_10009218 3300032004 Bacteria 5657
98 Ga0307414_10018367 3300032004 Bacteria 4303
99 Ga0307414_10078984 3300032004 Bacteria 2400
100 Ga0307414_10181032 3300032004 Bacteria 1695
101 Ga0307414_10261019 3300032004 Bacteria 1446
102 Ga0307414_10285668 3300032004 Bacteria 1388
103 Ga0307414_10749241 3300032004 Bacteria 888
104 Ga0307414_10762340 3300032004 Bacteria 880
105 Ga0307414_10806026 3300032004 Bacteria 856
106 Ga0307411_10271672 3300032005 Bacteria 1345
107 Ga0307510_10036307 3300033180 Bacteria 5486
108 Ga0307510_10114606 3300033180 Bacteria 2424
109 Ga0373933_0376562 3300035724 Bacteria 924
110 Ga0373925_0345361 3300037068 Bacteria 1208
111 Ga0395899_0000264 3300037312 Bacteria 68569
112 Ga0436365_0615546 3300039437 Bacteria 2129
113 Ga0436360_1023001 3300039438 Bacteria 1082
114 Ga0436361_0888935 3300039447 Bacteria 2350
115 Ga0436361_1177545 3300039447 Bacteria 13395
116 Ga0439461_0172202 3300041410 Bacteria 569
117 Ga0451843_1471873 3300041509 Bacteria 713
118 Ga0450890_020746 3300042127 Bacteria 891
119 Ga0439435_0004780 3300042436 Bacteria 2938
120 Ga0439459_0004785 3300042438 Bacteria 2192
121 Ga0466961_0434604 3300044693 Bacteria 795
122 Ga0495627_000360 3300046453 Bacteria 42630
123 Ga0495590_0001078 3300046457 Bacteria 12019
124 Ga0495638_0000410 3300046460 Bacteria 52445
125 Ga0495638_0000579 3300046460 Bacteria 41378
126 Ga0495638_0002568 3300046460 Bacteria 14695
127 Ga0495638_0008669 3300046460 Bacteria 7194
128 Ga0495638_0008806 3300046460 Bacteria 7128
129 Ga0495638_0062135 3300046460 Bacteria 2306
130 Ga0495638_0117150 3300046460 Bacteria 1577
131 Ga0495650_0000269 3300046471 Bacteria 99675
132 Ga0495650_0074280 3300046471 Bacteria 1326
133 Ga0495650_0080208 3300046471 Bacteria 1260
134 Ga0495650_0254129 3300046471 Bacteria 597
135 Ga0495605_0359933 3300046474 Bacteria 609
136 Ga0495583_0000029 3300046506 Bacteria 255536
137 Ga0495606_0082992 3300046507 Bacteria 1988
138 Ga0495610_0000225 3300046512 Bacteria 60452
139 Ga0495610_0001127 3300046512 Bacteria 24387
140 Ga0495610_0005078 3300046512 Bacteria 9482
141 Ga0495616_0000160 3300046513 Bacteria 58888
142 Ga0495616_0120550 3300046513 Bacteria 1211
143 Ga0495631_0002366 3300046518 Bacteria 10729
144 Ga0495632_0001474 3300046519 Bacteria 19561
145 Ga0495632_0020555 3300046519 Bacteria 3571
146 Ga0495643_0116681 3300046522 Bacteria 1352
147 Ga0495643_0189804 3300046522 Bacteria 993
148 Ga0495644_0067144 3300046523 Bacteria 1347
149 Ga0495648_0001017 3300046524 Bacteria 28697
150 Ga0495648_0025248 3300046524 Bacteria 4027
151 Ga0495648_0110968 3300046524 Bacteria 1493
152 Ga0495597_0051326 3300046542 Bacteria 1819
153 Ga0495597_0056689 3300046542 Bacteria 1715
154 Ga0495668_0000014 3300046616 Bacteria 442055
155 Ga0495668_0004371 3300046616 Bacteria 10080
156 Ga0495668_0008351 3300046616 Bacteria 6481
157 Ga0495668_0064907 3300046616 Bacteria 2009
158 Ga0495668_0156205 3300046616 Bacteria 1249
159 Ga0495668_0164002 3300046616 Bacteria 1217
160 Ga0495625_0000816 3300046660 Bacteria 42972
161 Ga0495625_0004473 3300046660 Bacteria 13202
162 Ga0495625_0033964 3300046660 Bacteria 3766
163 Ga0495625_0051993 3300046660 Bacteria 2935
164 Ga0495625_0106382 3300046660 Bacteria 1921
165 Ga0495669_0000042 3300046684 Bacteria 87033
166 Ga0495669_0000097 3300046684 Bacteria 54707
167 Ga0495670_0126367 3300046691 Bacteria 1331
168 Ga0495670_0249584 3300046691 Bacteria 946
169 Ga0495671_0063361 3300046692 Bacteria 1821
170 Ga0495671_0304129 3300046692 Bacteria 767
171 Ga0495649_0001363 3300046694 Bacteria 18554
172 Ga0495589_0008640 3300046794 Bacteria 5312
173 Ga0495660_0002278 3300046810 Bacteria 12330
174 Ga0495660_0070081 3300046810 Bacteria 1862
175 Ga0495660_0093480 3300046810 Bacteria 1559
176 Ga0495672_0002182 3300047320 Bacteria 18231
177 Ga0495673_0000189 3300047469 Bacteria 99018
178 Ga0495673_0000461 3300047469 Bacteria 44189
179 Ga0495673_0002213 3300047469 Bacteria 14001
180 Ga0495686_0000825 3300047472 Bacteria 39868
181 Ga0495686_0008370 3300047472 Bacteria 7593
182 Ga0495686_0021167 3300047472 Bacteria 4325
183 Ga0496106_0061400 3300048909 Bacteria 2851
184 Ga0496107_0000349 3300048910 Bacteria 25181
185 Ga0496115_0003100 3300048918 Bacteria 11940
186 Ga0496115_1075188 3300048918 Bacteria 611
187 Ga0496116_0036631 3300048919 Bacteria 3430
188 Ga0496121_0001899 3300048924 Bacteria 33454
189 Ga0496124_0011989 3300048927 Bacteria 8619
190 Ga0496125_0001355 3300048928 Bacteria 36098
191 Ga0496125_0008273 3300048928 Bacteria 10922
192 Ga0496126_0004916 3300048929 Bacteria 15601
193 Ga0495678_000723 3300049459 Bacteria 29969
194 Ga0501032_0283492 3300049569 Bacteria 1072
195 Ga0501032_0402784 3300049569 Bacteria 879
196 Ga0501033_0038714 3300049570 Bacteria 3562
197 Ga0501033_0487936 3300049570 Bacteria 853
198 Ga0501034_0128921 3300049571 Bacteria 2513
199 Ga0501034_0830224 3300049571 Bacteria 815
200 Ga0501036_0807915 3300049572 Bacteria 772
201 Ga0501037_0005361 3300049573 Bacteria 9331
202 Ga0501038_0983270 3300049574 Bacteria 620
203 Ga0501043_0614107 3300049579 Bacteria 802
204 Ga0501047_0025506 3300049581 Bacteria 5683
205 Ga0501047_0267542 3300049581 Bacteria 1556
206 Ga0501047_0535885 3300049581 Bacteria 996
207 Ga0501047_0881836 3300049581 Bacteria 708
208 Ga0501238_008082 3300049671 Bacteria 1377
209 Ga0501035_0621072 3300049822 Bacteria 879
210 Ga0501044_0044028 3300049823 Bacteria 4635
211 Ga0501044_0074916 3300049823 Bacteria 3437
212 Ga0501044_0250279 3300049823 Bacteria 1713
213 Ga0501044_0285542 3300049823 Bacteria 1583
214 Ga0501044_1131024 3300049823 Bacteria 652
215 nmdc:mga03683_65145_c1 3300050489 Bacteria 1547
216 nmdc:mga0k408_182470_c1 3300050493 Bacteria 1252
217 nmdc:mga07m45_173286_c1 3300050496 Bacteria 1254
218 nmdc:mga0sz30_91075_c1 3300050516 Bacteria 1327
219 Ga0500578_0001050 3300053086 Bacteria 30142
220 Ga0500643_004779 3300053087 Bacteria 6003
221 Ga0500643_013763 3300053087 Bacteria 2840
222 Ga0500643_026144 3300053087 Bacteria 1831
223 Ga0500643_084832 3300053087 Bacteria 867
224 Ga0500644_0000261 3300053088 Bacteria 29859
225 Ga0500644_0004679 3300053088 Bacteria 3433
226 Ga0500644_0040744 3300053088 Bacteria 1539
227 Ga0500651_0116959 3300053093 Bacteria 1622
228 Ga0500554_005715 3300053102 Bacteria 2737
229 Ga0500555_054382 3300053103 Bacteria 1089
230 Ga0500555_057904 3300053103 Bacteria 1048
231 Ga0500556_0087848 3300053104 Bacteria 1184
232 Ga0500556_0109270 3300053104 Bacteria 1071
233 Ga0500562_001487 3300053108 Bacteria 5780
234 Ga0500594_0000084 3300053118 Bacteria 28710
235 Ga0500595_003899 3300053119 Bacteria 6845
236 Ga0500608_000101 3300053122 Bacteria 34992
237 Ga0500608_045590 3300053122 Bacteria 2106
238 Ga0500614_066897 3300053123 Bacteria 978
239 Ga0500618_000255 3300053125 Bacteria 41984
240 Ga0500658_0004221 3300053134 Bacteria 5394
241 Ga0500658_0268614 3300053134 Bacteria 784
242 Ga0500559_0000243 3300053136 Bacteria 43046
243 Ga0500559_0001271 3300053136 Bacteria 14750
244 Ga0500564_000062 3300053138 Bacteria 29161
245 Ga0500573_0009144 3300053140 Bacteria 5486
246 Ga0500577_0000769 3300053142 Bacteria 8240
247 Ga0500588_0089165 3300053146 Bacteria 1045
248 Ga0500604_0227832 3300053151 Bacteria 643
249 Ga0500616_0060933 3300053153 Bacteria 1955
250 Ga0500616_0259701 3300053153 Bacteria 738
251 Ga0500622_0001061 3300053156 Bacteria 22910
252 Ga0500622_0002582 3300053156 Bacteria 12950
253 Ga0500622_0006658 3300053156 Bacteria 6659
254 Ga0500622_0014473 3300053156 Bacteria 4234
255 Ga0500627_0005229 3300053158 Bacteria 4286
256 Ga0500609_000606 3300053731 Bacteria 5460
257 2511120211 2510917020 Bacteria 5657507
258 2585150113 2582581279 Bacteria 4980720
259 2585155454 2582581280 Bacteria 5994497
260 2585199240 2582581293 Bacteria 5907401
261 2587919673 2585428106 Bacteria 5179711
262 2643747927 2643221545 Bacteria 5083237
263 2643781913 2643221552 Bacteria 5708754
264 2643884773 2643221574 Bacteria 2789653
265 2643926292 2643221583 Bacteria 5218014
266 2643931566 2643221584 Bacteria 5511711
267 2644001263 2643221598 Bacteria 4578346
268 2644086018 2643221614 Bacteria 4260023
269 2644226394 2643221640 Bacteria 5258820
270 2644235882 2643221642 Bacteria 5357871
271 2644345315 2643221661 Bacteria 4267604
272 2644352387 2643221663 Bacteria 3425771
273 2644369589 2643221666 Bacteria 4265935
274 2644507969 2643221691 Bacteria 5093099
275 2644548426 2643221699 Bacteria 5731501
276 2644550733 2643221699 Bacteria 5731501
277 2792459598 2791355048 Bacteria 5832535
278 2819536798 2818991435 Bacteria 5433759
279 2819645959 2818991454 Bacteria 5563326
280 2843747253 2843744320 Bacteria 5659202
281 2849560790 2849560528 Bacteria 5393480
282 2849574309 2849573788 Bacteria 5421256
283 2851158064 2851153111 Bacteria 5542585
284 2857506709 2857504554 Bacteria 5369913
285 2898333421 2898329390 Bacteria 5168154
286 2941486989 2941485952 Bacteria 3591484
287 Ga0501034_1201355
288 JGI25153J46596_10021745
289 rootH2_10023832
290 rootL2_10080588
291 Ga0055537_1007754
292 Ga0055524_1006218
293 Ga0055524_1007535
294 Ga0055536_1001984
295 Ga0055528_1008303
296 Ga0055530_10018436
297 Ga0055531_10000799
298 Ga0055531_10007315
299 Ga0065165_1001007
300 Ga0070658_10140802
301 Ga0070666_10371048
302 Ga0070668_100006149
303 Ga0070668_100038984
304 Ga0070667_100455529
305 Ga0070663_100320505
306 Ga0070678_101433939
307 Ga0070665_100466474
308 Ga0068855_100479065
309 Ga0068857_100519300
310 Ga0068863_100410760
311 Ga0068860_101700204
312 Ga0068862_100010612
313 Ga0068862_100027881
314 Ga0068862_100207475
315 Ga0075362_10284081
316 Ga0075369_10101847
317 Ga0105240_11201304
318 Ga0105241_10541682
319 Ga0105237_10905720
320 Ga0105238_10355990
321 Ga0105239_10432356
322 Ga0163162_10722761
323 Ga0157375_11140343
324 Ga0163163_10107147
325 Ga0157380_11078159
326 Ga0163161_10546614
327 Ga0209026_1006855
328 Ga0209565_1002577
329 Ga0209673_1000807
330 Ga0209673_1026530
331 Ga0209675_1053104
332 Ga0209676_1000200
333 Ga0209676_1000606
334 Ga0209676_1005079
335 Ga0209564_1001421
336 Ga0209564_1015325
337 Ga0209564_1020859
338 Ga0209758_1001528
339 Ga0209758_1003270
340 Ga0209050_1000057
341 Ga0209256_1001936
342 Ga0209256_1004620
343 Ga0209256_1053331
344 Ga0209051_1003086
345 Ga0209257_1000284
346 Ga0209257_1000702
347 Ga0209257_1004520
348 Ga0207705_10104991
349 Ga0207654_10324711
350 Ga0207695_10006113
351 Ga0207694_10649322
352 Ga0207668_10006401
353 Ga0207668_10020603
354 Ga0207668_10039144
355 Ga0207702_10525145
356 Ga0207641_10276732
357 Ga0268265_10003844
358 Ga0268265_10043275
359 Ga0268265_10044708
360 Ga0268265_10062579
361 Ga0268264_10000021
362 Ga0265337_1014335
363 Ga0265334_10036651
364 Ga0265334_10055082
365 Ga0307515_10050759
366 Ga0307515_10088980
367 Ga0307515_10163372
368 Ga0307515_10205275
369 Ga0265338_10002312
370 Ga0265338_10009002
371 Ga0265338_10151293
372 Ga0265338_10188827
373 Ga0265338_10200499
374 Ga0265327_10000447
375 Ga0265327_10052668
376 Ga0307405_11206383
377 Ga0307413_10032715
378 Ga0307413_11760592
379 Ga0307406_10025701
380 Ga0307406_10331153
381 Ga0307412_10001163
382 Ga0307414_10004190
383 Ga0307414_10009218
384 Ga0307414_10018367
385 Ga0307414_10078984
386 Ga0307414_10181032
387 Ga0307414_10261019
388 Ga0307414_10285668
389 Ga0307414_10749241
390 Ga0307414_10762340
391 Ga0307414_10806026
392 Ga0307411_10271672
393 Ga0307510_10036307
394 Ga0307510_10114606
395 Ga0373933_0376562
396 Ga0373925_0345361
397 Ga0395899_0000264
398 Ga0436365_0615546
399 Ga0436360_1023001
400 Ga0436361_0888935
401 Ga0436361_1177545
402 Ga0439461_0172202
403 Ga0451843_1471873
404 Ga0450890_020746
405 Ga0439435_0004780
406 Ga0439459_0004785
407 Ga0466961_0434604
408 Ga0495627_000360
409 Ga0495590_0001078
410 Ga0495638_0000410
411 Ga0495638_0000579
412 Ga0495638_0002568
413 Ga0495638_0008669
414 Ga0495638_0008806
415 Ga0495638_0062135
416 Ga0495638_0117150
417 Ga0495650_0000269
418 Ga0495650_0074280
419 Ga0495650_0080208
420 Ga0495650_0254129
421 Ga0495605_0359933
422 Ga0495583_0000029
423 Ga0495606_0082992
424 Ga0495610_0000225
425 Ga0495610_0001127
426 Ga0495610_0005078
427 Ga0495616_0000160
428 Ga0495616_0120550
429 Ga0495631_0002366
430 Ga0495632_0001474
431 Ga0495632_0020555
432 Ga0495643_0116681
433 Ga0495643_0189804
434 Ga0495644_0067144
435 Ga0495648_0001017
436 Ga0495648_0025248
437 Ga0495648_0110968
438 Ga0495597_0051326
439 Ga0495597_0056689
440 Ga0495668_0000014
441 Ga0495668_0004371
442 Ga0495668_0008351
443 Ga0495668_0064907
444 Ga0495668_0156205
445 Ga0495668_0164002
446 Ga0495625_0000816
447 Ga0495625_0004473
448 Ga0495625_0033964
449 Ga0495625_0051993
450 Ga0495625_0106382
451 Ga0495669_0000042
452 Ga0495669_0000097
453 Ga0495670_0126367
454 Ga0495670_0249584
455 Ga0495671_0063361
456 Ga0495671_0304129
457 Ga0495649_0001363
458 Ga0495589_0008640
459 Ga0495660_0002278
460 Ga0495660_0070081
461 Ga0495660_0093480
462 Ga0495672_0002182
463 Ga0495673_0000189
464 Ga0495673_0000461
465 Ga0495673_0002213
466 Ga0495686_0000825
467 Ga0495686_0008370
468 Ga0495686_0021167
469 Ga0496106_0061400
470 Ga0496107_0000349
471 Ga0496115_0003100
472 Ga0496115_1075188
473 Ga0496116_0036631
474 Ga0496121_0001899
475 Ga0496124_0011989
476 Ga0496125_0001355
477 Ga0496125_0008273
478 Ga0496126_0004916
479 Ga0495678_000723
480 Ga0501032_0283492
481 Ga0501032_0402784
482 Ga0501033_0038714
483 Ga0501033_0487936
484 Ga0501034_0128921
485 Ga0501034_0830224
486 Ga0501036_0807915
487 Ga0501037_0005361
488 Ga0501038_0983270
489 Ga0501043_0614107
490 Ga0501047_0025506
491 Ga0501047_0267542
492 Ga0501047_0535885
493 Ga0501047_0881836
494 Ga0501238_008082
495 Ga0501035_0621072
496 Ga0501044_0044028
497 Ga0501044_0074916
498 Ga0501044_0250279
499 Ga0501044_0285542
500 Ga0501044_1131024
501 nmdc:mga03683_65145_c1
502 nmdc:mga0k408_182470_c1
503 nmdc:mga07m45_173286_c1
504 nmdc:mga0sz30_91075_c1
505 Ga0500578_0001050
506 Ga0500643_004779
507 Ga0500643_013763
508 Ga0500643_026144
509 Ga0500643_084832
510 Ga0500644_0000261
511 Ga0500644_0004679
512 Ga0500644_0040744
513 Ga0500651_0116959
514 Ga0500554_005715
515 Ga0500555_054382
516 Ga0500555_057904
517 Ga0500556_0087848
518 Ga0500556_0109270
519 Ga0500562_001487
520 Ga0500594_0000084
521 Ga0500595_003899
522 Ga0500608_000101
523 Ga0500608_045590
524 Ga0500614_066897
525 Ga0500618_000255
526 Ga0500658_0004221
527 Ga0500658_0268614
528 Ga0500559_0000243
529 Ga0500559_0001271
530 Ga0500564_000062
531 Ga0500573_0009144
532 Ga0500577_0000769
533 Ga0500588_0089165
534 Ga0500604_0227832
535 Ga0500616_0060933
536 Ga0500616_0259701
537 Ga0500622_0001061
538 Ga0500622_0002582
539 Ga0500622_0006658
540 Ga0500622_0014473
541 Ga0500627_0005229
542 Ga0500609_000606
543 2511120211
544 2585150113
545 2585155454
546 2585199240
547 2587919673
548 2643747927
549 2643781913
550 2643884773
551 2643926292
552 2643931566
553 2644001263
554 2644086018
555 2644226394
556 2644235882
557 2644345315
558 2644352387
559 2644369589
560 2644507969
561 2644548426
562 2644550733
563 2792459598
564 2819536798
565 2819645959
566 2843747253
567 2849560790
568 2849574309
569 2851158064
570 2857506709
571 2898333421
572 2941486989

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lch-assembly1.cif.gz_A solution nmr structure of a protein with a redesigned hydrophobic core, northeast structural genomics consortium target or38 0.8026 39 139
8c5v-assembly1.cif.gz_C chemotaxis core signalling unit from e protein lysed e. coli cells 0.7831 38 157
1i5n-assembly3.cif.gz_C crystal structure of the p1 domain of chea from salmonella typhimurium 0.778 39 155
8c5v-assembly1.cif.gz_D chemotaxis core signalling unit from e protein lysed e. coli cells 0.7761 38 152
2lp4-assembly1.cif.gz_A solution structure of p1-chey/p2 complex in bacterial chemotaxis 0.7608 38 156
ID Description Score Start End Superfamily
3u3bA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.8547 37 134 1.20.120.160
1tqgA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.8225 40 135 1.20.120.160
3u3bA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.8026 37 134 1.20.120.160
2lchA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.8026 39 139 1.20.120.160
af_Q54RR8_9_125_1.20.120.160 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.7904 40 136 1.20.120.160
ID Description Score Start End GO Terms
AF-H1QE50-F1-model_v4 deleted 0.9832 73 160
AF-A0A519P1T6-F1-model_v4 Hpt domain-containing protein 0.9783 30 158 GO:0000160
AF-H1QE50-F1-model_v4 deleted 0.9617 73 160
AF-A0A519P1T6-F1-model_v4 Hpt domain-containing protein 0.9564 30 158 GO:0000160
AF-A0A3R8M0X1-F1-model_v4 Hpt domain-containing protein 0.9065 17 106 GO:0000160

Map