F387592

General Info

Members Datasets Scaffolds Average Seq Length
286 174 570 226

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0130565|Ga0495580_0130565_941_1714
Length 257
Sequence MTIQVATSGEWKPYRHNELPEGQMADESPRLPVARRSFLSRLGLGVAAVGGGIGVTRAVAQQAGPERFQPARHPQDDWMDQTAGKHRFVLDTTTPDAAGGALLYANNYFTANKSGYNLDPADLSIIIVMRHFATPFAYNNAMWAKYGKQFSDALKFVDPKTKQAPTANLYTSADYGFALPNFGTTLDSLIQRRVQFAVCDMATHFFAGALADSTKGNVDATYRELVANVLPNSHMVPAGIVAVNRAQERGYTFSYVT

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
122 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
123 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
134 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 3.15
Rhizosphere 96.15
Stem 0
Stem Tuber 0
Unclassified 29.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0130565 3300046472 Bacteria 1743
2 Ga0065714_10086536 3300005288 Bacteria 2095
3 Ga0065712_10010533 3300005290 Bacteria 2647
4 Ga0065712_10249782 3300005290 Unclassified 963
5 Ga0065715_10000775 3300005293 Bacteria 8453
6 Ga0065715_10095589 3300005293 Bacteria 4050
7 Ga0065707_10116813 3300005295 Bacteria 2227
8 Ga0070676_10167994 3300005328 Unclassified 1417
9 Ga0070683_100268066 3300005329 Unclassified 1624
10 Ga0070670_100036099 3300005331 Bacteria 4254
11 Ga0070670_100155266 3300005331 Bacteria 1982
12 Ga0070670_100236778 3300005331 Bacteria 1589
13 Ga0070677_10019375 3300005333 Unclassified 2464
14 Ga0068869_100039860 3300005334 Unclassified 3356
15 Ga0070666_10095783 3300005335 Bacteria 2043
16 Ga0070689_100320806 3300005340 Bacteria 1294
17 Ga0070669_100055033 3300005353 Unclassified 2915
18 Ga0070669_100405508 3300005353 Bacteria 1116
19 Ga0070675_100009864 3300005354 Bacteria 7443
20 Ga0070675_100514486 3300005354 Bacteria 1080
21 Ga0070671_100125411 3300005355 Unclassified 2161
22 Ga0070674_100012339 3300005356 Bacteria 5245
23 Ga0070674_100026069 3300005356 Unclassified 3814
24 Ga0070667_100219716 3300005367 Unclassified 1691
25 Ga0070667_100305116 3300005367 Bacteria 1434
26 Ga0070713_100037980 3300005436 Unclassified 3897
27 Ga0070705_100429696 3300005440 Unclassified 986
28 Ga0070700_100134430 3300005441 Unclassified 1673
29 Ga0070700_100670006 3300005441 Unclassified 821
30 Ga0070694_100042806 3300005444 Bacteria 3026
31 Ga0070708_100748286 3300005445 Bacteria 919
32 Ga0070678_100004395 3300005456 Bacteria 7984
33 Ga0068867_100297378 3300005459 Bacteria 1330
34 Ga0068867_100996946 3300005459 Bacteria 759
35 Ga0070707_100059756 3300005468 Bacteria 3655
36 Ga0070698_100001284 3300005471 Bacteria 28003
37 Ga0070699_100015196 3300005518 Bacteria 6613
38 Ga0070684_100267371 3300005535 Bacteria 1565
39 Ga0070697_100056674 3300005536 Bacteria 3188
40 Ga0070672_100035543 3300005543 Bacteria 3788
41 Ga0070672_100439320 3300005543 Unclassified 1123
42 Ga0070695_100012286 3300005545 Bacteria 5136
43 Ga0070695_100096037 3300005545 Bacteria 1987
44 Ga0070696_100394008 3300005546 Bacteria 1082
45 Ga0070693_100491389 3300005547 Unclassified 869
46 Ga0070665_100045753 3300005548 Bacteria 4395
47 Ga0070704_100037843 3300005549 Bacteria 3300
48 Ga0070704_100079157 3300005549 Bacteria 2413
49 Ga0070704_100118847 3300005549 Bacteria 2026
50 Ga0070704_100131745 3300005549 Bacteria 1939
51 Ga0068855_100001836 3300005563 Bacteria 26466
52 Ga0070664_100092327 3300005564 Bacteria 2621
53 Ga0070664_100097529 3300005564 Bacteria 2552
54 Ga0068854_100473931 3300005578 Bacteria 1050
55 Ga0068859_100060275 3300005617 Bacteria 3823
56 Ga0068859_100359713 3300005617 Bacteria 1550
57 Ga0068859_100456264 3300005617 Bacteria 1374
58 Ga0068864_100008511 3300005618 Bacteria 8464
59 Ga0068866_10227596 3300005718 Unclassified 1129
60 Ga0068861_100026910 3300005719 Bacteria 4185
61 Ga0068861_100192781 3300005719 Bacteria 1705
62 Ga0068861_100324572 3300005719 Bacteria 1342
63 Ga0068870_10126043 3300005840 Bacteria 1481
64 Ga0068863_100363067 3300005841 Bacteria 1412
65 Ga0068863_100431787 3300005841 Bacteria 1291
66 Ga0068863_100700293 3300005841 Unclassified 1007
67 Ga0068858_100010645 3300005842 Bacteria 8702
68 Ga0068858_100018356 3300005842 Bacteria 6550
69 Ga0068858_100165917 3300005842 Bacteria 2081
70 Ga0068860_100086858 3300005843 Bacteria 2977
71 Ga0068860_100254542 3300005843 Bacteria 1710
72 Ga0068860_100316754 3300005843 Bacteria 1530
73 Ga0068860_100403986 3300005843 Unclassified 1352
74 Ga0068862_100198114 3300005844 Bacteria 1810
75 Ga0068862_100210118 3300005844 Bacteria 1758
76 Ga0068862_100237014 3300005844 Unclassified 1657
77 Ga0068862_100454464 3300005844 Bacteria 1208
78 Ga0097621_100002833 3300006237 Bacteria 11893
79 Ga0097621_100013393 3300006237 Bacteria 6114
80 Ga0068871_100002478 3300006358 Bacteria 12591
81 Ga0068871_100002968 3300006358 Bacteria 11636
82 Ga0068871_100611290 3300006358 Bacteria 992
83 Ga0075430_100049655 3300006846 Bacteria 3540
84 Ga0075431_100017337 3300006847 Bacteria 7318
85 Ga0075431_100098336 3300006847 Unclassified 3021
86 Ga0075431_100156213 3300006847 Unclassified 2347
87 Ga0075431_100353341 3300006847 Bacteria 1477
88 Ga0075433_10113989 3300006852 Bacteria 2398
89 Ga0075434_100117210 3300006871 Bacteria 2676
90 Ga0075434_100756951 3300006871 Unclassified 988
91 Ga0068865_100017666 3300006881 Bacteria 4591
92 Ga0097620_100060273 3300006931 Bacteria 3823
93 Ga0097620_100359718 3300006931 Bacteria 1550
94 Ga0097620_100456296 3300006931 Bacteria 1374
95 Ga0105240_10008654 3300009093 Bacteria 14540
96 Ga0111539_10000658 3300009094 Bacteria 44608
97 Ga0111539_10000896 3300009094 Bacteria 38862
98 Ga0111539_10050396 3300009094 Unclassified 4960
99 Ga0111539_10145382 3300009094 Unclassified 2776
100 Ga0111539_10931260 3300009094 Unclassified 1010
101 Ga0105247_10008965 3300009101 Bacteria 6097
102 Ga0114129_10463547 3300009147 Bacteria 1660
103 Ga0114129_10514215 3300009147 Bacteria 1562
104 Ga0105243_10009311 3300009148 Bacteria 7490
105 Ga0105242_10029754 3300009176 Bacteria 4356
106 Ga0105242_10283672 3300009176 Archaea 1505
107 Ga0105242_10313017 3300009176 Bacteria 1437
108 Ga0105248_10005976 3300009177 Bacteria 13366
109 Ga0105248_11206941 3300009177 Bacteria 855
110 Ga0105238_10119030 3300009551 Bacteria 2621
111 Ga0105238_10361361 3300009551 Bacteria 1441
112 Ga0105249_10281763 3300009553 Bacteria 1660
113 Ga0105249_11158540 3300009553 Unclassified 844
114 Ga0157370_10347059 3300013104 Bacteria 1368
115 Ga0157374_10029328 3300013296 Unclassified 4981
116 Ga0163162_10106865 3300013306 Bacteria 2894
117 Ga0157372_10823834 3300013307 Unclassified 1078
118 Ga0157375_10047073 3300013308 Bacteria 4209
119 Ga0157375_10508097 3300013308 Bacteria 1369
120 Ga0157375_10752069 3300013308 Unclassified 1126
121 Ga0157375_10846760 3300013308 Unclassified 1061
122 Ga0157375_10978891 3300013308 Unclassified 986
123 Ga0157380_10009540 3300014326 Bacteria 6963
124 Ga0157380_10140256 3300014326 Bacteria 2076
125 Ga0157379_10044128 3300014968 Unclassified 3980
126 Ga0157379_10080753 3300014968 Bacteria 2913
127 Ga0157379_10234128 3300014968 Viruses 1665
128 Ga0157376_10333030 3300014969 Bacteria 1447
129 Ga0163161_10028878 3300017792 Bacteria 3941
130 Ga0207697_10161684 3300025315 Unclassified 977
131 Ga0207656_10102833 3300025321 Bacteria 1312
132 Ga0207656_10238578 3300025321 Unclassified 888
133 Ga0207682_10006566 3300025893 Unclassified 4682
134 Ga0207682_10013857 3300025893 Unclassified 3140
135 Ga0207642_10141080 3300025899 Bacteria 1271
136 Ga0207710_10019936 3300025900 Bacteria 2864
137 Ga0207688_10108449 3300025901 Bacteria 1610
138 Ga0207680_10345691 3300025903 Bacteria 1044
139 Ga0207643_10050941 3300025908 Bacteria 2349
140 Ga0207707_10404527 3300025912 Unclassified 1172
141 Ga0207695_10074511 3300025913 Bacteria 3456
142 Ga0207660_10531328 3300025917 Bacteria 956
143 Ga0207646_10049596 3300025922 Bacteria 3759
144 Ga0207646_10064771 3300025922 Bacteria 3263
145 Ga0207681_10045229 3300025923 Unclassified 2955
146 Ga0207681_10406411 3300025923 Bacteria 1101
147 Ga0207694_10187598 3300025924 Unclassified 1679
148 Ga0207650_10036263 3300025925 Bacteria 3587
149 Ga0207650_10048299 3300025925 Bacteria 3139
150 Ga0207650_10073374 3300025925 Bacteria 2577
151 Ga0207659_10013466 3300025926 Bacteria 5239
152 Ga0207659_10075611 3300025926 Bacteria 2472
153 Ga0207687_10369253 3300025927 Unclassified 1173
154 Ga0207700_10008760 3300025928 Bacteria 6284
155 Ga0207644_10479584 3300025931 Bacteria 1024
156 Ga0207670_10282617 3300025936 Bacteria 1294
157 Ga0207669_10003796 3300025937 Bacteria 6571
158 Ga0207669_10013436 3300025937 Bacteria 4066
159 Ga0207669_10101243 3300025937 Bacteria 1905
160 Ga0207704_10137331 3300025938 Bacteria 1704
161 Ga0207691_10087356 3300025940 Bacteria 2797
162 Ga0207691_10202921 3300025940 Unclassified 1725
163 Ga0207691_10207248 3300025940 Unclassified 1704
164 Ga0207711_10063876 3300025941 Unclassified 3179
165 Ga0207689_10032794 3300025942 Bacteria 4318
166 Ga0207679_10259338 3300025945 Unclassified 1482
167 Ga0207679_10580313 3300025945 Unclassified 1008
168 Ga0207658_10172138 3300025986 Unclassified 1785
169 Ga0207703_10089429 3300026035 Unclassified 2586
170 Ga0207703_10174865 3300026035 Bacteria 1891
171 Ga0207703_10271621 3300026035 Unclassified 1536
172 Ga0207708_10125592 3300026075 Bacteria 2002
173 Ga0207641_10069553 3300026088 Bacteria 3023
174 Ga0207641_10334987 3300026088 Bacteria 1438
175 Ga0207641_10739929 3300026088 Bacteria 970
176 Ga0207648_10124099 3300026089 Bacteria 2271
177 Ga0207648_10345965 3300026089 Bacteria 1340
178 Ga0207648_10347130 3300026089 Bacteria 1337
179 Ga0207648_10536038 3300026089 Bacteria 1074
180 Ga0207648_10765049 3300026089 Unclassified 897
181 Ga0207676_10106192 3300026095 Unclassified 2339
182 Ga0207674_10438149 3300026116 Unclassified 1263
183 Ga0207675_100027691 3300026118 Bacteria 5278
184 Ga0207683_10015404 3300026121 Bacteria 6510
185 Ga0207683_10119327 3300026121 Unclassified 2366
186 Ga0207683_10655180 3300026121 Unclassified 973
187 Ga0207428_10006093 3300027907 Bacteria 11152
188 Ga0207428_10009674 3300027907 Bacteria 8637
189 Ga0207428_10025097 3300027907 Unclassified 4992
190 Ga0268265_10069772 3300028380 Bacteria 2730
191 Ga0268265_10073348 3300028380 Bacteria 2673
192 Ga0268265_10244940 3300028380 Bacteria 1584
193 Ga0268265_10850163 3300028380 Unclassified 893
194 Ga0268264_10042290 3300028381 Unclassified 3772
195 Ga0268264_10063737 3300028381 Bacteria 3100
196 Ga0268264_10364881 3300028381 Bacteria 1379
197 Ga0268264_10723054 3300028381 Unclassified 990
198 Ga0265334_10001637 3300028573 Bacteria 10747
199 Ga0265338_10034874 3300028800 Bacteria 4851
200 Ga0307408_100435529 3300031548 Bacteria 1134
201 Ga0316575_10077875 3300031665 Bacteria 1336
202 Ga0265314_10076463 3300031711 Bacteria 2224
203 Ga0307405_10118660 3300031731 Bacteria 1806
204 Ga0373939_0075770 3300035114 Unclassified 1106
205 Ga0373933_0043782 3300035724 Bacteria 2649
206 Ga0373933_0416863 3300035724 Bacteria 877
207 Ga0373937_0109051 3300036401 Bacteria 2574
208 Ga0373937_0110958 3300036401 Bacteria 2551
209 Ga0373937_0474476 3300036401 Unclassified 1188
210 Ga0439456_039473 3300042013 Unclassified 1022
211 Ga0439435_0027229 3300042436 Bacteria 1528
212 Ga0439460_0173118 3300042461 Unclassified 727
213 Ga0451577_0026993 3300042876 Bacteria 5198
214 Ga0451577_0052138 3300042876 Unclassified 3652
215 Ga0451577_0327077 3300042876 Unclassified 1390
216 Ga0453684_0200747 3300044712 Unclassified 2325
217 Ga0453684_0392692 3300044712 Unclassified 1555
218 Ga0495629_0111012 3300046459 Bacteria 1912
219 Ga0495580_0045683 3300046472 Unclassified 3110
220 Ga0495639_0118419 3300046475 Bacteria 1262
221 Ga0495594_0159677 3300046499 Bacteria 1281
222 Ga0495586_0134238 3300046535 Unclassified 1387
223 Ga0495586_0199552 3300046535 Unclassified 1134
224 Ga0495587_0036755 3300046536 Bacteria 2945
225 Ga0495621_0020829 3300046539 Unclassified 2156
226 Ga0495645_0192372 3300046543 Unclassified 1389
227 Ga0495633_0137488 3300046558 Unclassified 1130
228 Ga0495588_0000928 3300046674 Bacteria 12739
229 Ga0495599_0010147 3300046678 Bacteria 5769
230 Ga0495599_0187687 3300046678 Unclassified 1272
231 Ga0495658_0038129 3300046683 Bacteria 2660
232 Ga0495658_0224208 3300046683 Unclassified 1178
233 Ga0495674_0606059 3300047319 Bacteria 867
234 Ga0495674_0721774 3300047319 Bacteria 781
235 Ga0495680_0118762 3300047322 Unclassified 1954
236 Ga0495684_0053377 3300047471 Bacteria 3084
237 Ga0496101_0001196 3300048904 Bacteria 15516
238 Ga0496104_0042190 3300048907 Bacteria 4280
239 Ga0496104_0305129 3300048907 Bacteria 1504
240 Ga0496104_0990928 3300048907 Unclassified 744
241 Ga0496105_0399767 3300048908 Unclassified 1091
242 Ga0496112_0025603 3300048915 Bacteria 5666
243 Ga0496113_0025524 3300048916 Unclassified 4213
244 Ga0496114_0000611 3300048917 Bacteria 26411
245 Ga0496114_0342918 3300048917 Bacteria 1321
246 Ga0501034_0017788 3300049571 Bacteria 7292
247 Ga0501039_0009753 3300049575 Bacteria 7315
248 Ga0501039_0461813 3300049575 Bacteria 997
249 Ga0501040_0006142 3300049576 Bacteria 7791
250 Ga0501040_0406425 3300049576 Bacteria 978
251 Ga0501041_0003660 3300049577 Bacteria 8841
252 Ga0501043_0111265 3300049579 Bacteria 2150
253 Ga0501046_0473936 3300049580 Bacteria 899
254 Ga0501047_0006566 3300049581 Bacteria 10950
255 Ga0501048_0011695 3300049582 Bacteria 6548
256 Ga0501074_0384340 3300049590 Unclassified 996
257 Ga0501075_0001280 3300049591 Bacteria 16314
258 Ga0501076_0133316 3300049592 Bacteria 2015
259 Ga0501077_0020000 3300049593 Bacteria 4236
260 Ga0501080_0148274 3300049742 Bacteria 2169
261 Ga0501080_0516003 3300049742 Unclassified 1067
262 Ga0501081_0002268 3300049743 Bacteria 12100
263 Ga0501083_0124391 3300049744 Bacteria 1691
264 Ga0501044_0009943 3300049823 Bacteria 10335
265 Ga0501045_0001013 3300049824 Bacteria 18471
266 nmdc:mga0k408_11847_c1 3300050493 Bacteria 4758
267 nmdc:mga06z11_74153_c1 3300050494 Bacteria 1808
268 nmdc:mga05p37_268664_c1 3300050507 Bacteria 2039
269 nmdc:mga05p37_297073_c1 3300050507 Bacteria 1920
270 nmdc:mga05p37_87958_c1 3300050507 Bacteria 3830
271 nmdc:mga09592_398578_c1 3300050508 Unclassified 1189
272 nmdc:mga06r32_14332_c1 3300050510 Bacteria 7192
273 nmdc:mga06r32_24843_c1 3300050510 Bacteria 5569
274 nmdc:mga06r32_51834_c1 3300050510 Bacteria 3928
275 nmdc:mga08y16_108274_c1 3300050511 Unclassified 2893
276 nmdc:mga08y16_258_c1 3300050511 Bacteria 47787
277 nmdc:mga08y16_300_c1 3300050511 Bacteria 44608
278 nmdc:mga08y16_60856_c1 3300050511 Unclassified 3943
279 nmdc:mga0n895_152530_c1 3300050512 Unclassified 2341
280 nmdc:mga0rr50_4184_c1 3300050513 Bacteria 8441
281 nmdc:mga0a205_110182_c1 3300050515 Bacteria 2652
282 Ga0495595_0093517 3300053084 Bacteria 1445
283 Ga0501084_0031243 3300054114 Bacteria 4454
284 Ga0501084_0136516 3300054114 Unclassified 2065
285 Ga0530510_0417436 3300061734 Bacteria 1013
286 Ga0495580_0130565
287 Ga0065714_10086536
288 Ga0065712_10010533
289 Ga0065712_10249782
290 Ga0065715_10000775
291 Ga0065715_10095589
292 Ga0065707_10116813
293 Ga0070676_10167994
294 Ga0070683_100268066
295 Ga0070670_100036099
296 Ga0070670_100155266
297 Ga0070670_100236778
298 Ga0070677_10019375
299 Ga0068869_100039860
300 Ga0070666_10095783
301 Ga0070689_100320806
302 Ga0070669_100055033
303 Ga0070669_100405508
304 Ga0070675_100009864
305 Ga0070675_100514486
306 Ga0070671_100125411
307 Ga0070674_100012339
308 Ga0070674_100026069
309 Ga0070667_100219716
310 Ga0070667_100305116
311 Ga0070713_100037980
312 Ga0070705_100429696
313 Ga0070700_100134430
314 Ga0070700_100670006
315 Ga0070694_100042806
316 Ga0070708_100748286
317 Ga0070678_100004395
318 Ga0068867_100297378
319 Ga0068867_100996946
320 Ga0070707_100059756
321 Ga0070698_100001284
322 Ga0070699_100015196
323 Ga0070684_100267371
324 Ga0070697_100056674
325 Ga0070672_100035543
326 Ga0070672_100439320
327 Ga0070695_100012286
328 Ga0070695_100096037
329 Ga0070696_100394008
330 Ga0070693_100491389
331 Ga0070665_100045753
332 Ga0070704_100037843
333 Ga0070704_100079157
334 Ga0070704_100118847
335 Ga0070704_100131745
336 Ga0068855_100001836
337 Ga0070664_100092327
338 Ga0070664_100097529
339 Ga0068854_100473931
340 Ga0068859_100060275
341 Ga0068859_100359713
342 Ga0068859_100456264
343 Ga0068864_100008511
344 Ga0068866_10227596
345 Ga0068861_100026910
346 Ga0068861_100192781
347 Ga0068861_100324572
348 Ga0068870_10126043
349 Ga0068863_100363067
350 Ga0068863_100431787
351 Ga0068863_100700293
352 Ga0068858_100010645
353 Ga0068858_100018356
354 Ga0068858_100165917
355 Ga0068860_100086858
356 Ga0068860_100254542
357 Ga0068860_100316754
358 Ga0068860_100403986
359 Ga0068862_100198114
360 Ga0068862_100210118
361 Ga0068862_100237014
362 Ga0068862_100454464
363 Ga0097621_100002833
364 Ga0097621_100013393
365 Ga0068871_100002478
366 Ga0068871_100002968
367 Ga0068871_100611290
368 Ga0075430_100049655
369 Ga0075431_100017337
370 Ga0075431_100098336
371 Ga0075431_100156213
372 Ga0075431_100353341
373 Ga0075433_10113989
374 Ga0075434_100117210
375 Ga0075434_100756951
376 Ga0068865_100017666
377 Ga0097620_100060273
378 Ga0097620_100359718
379 Ga0097620_100456296
380 Ga0105240_10008654
381 Ga0111539_10000658
382 Ga0111539_10000896
383 Ga0111539_10050396
384 Ga0111539_10145382
385 Ga0111539_10931260
386 Ga0105247_10008965
387 Ga0114129_10463547
388 Ga0114129_10514215
389 Ga0105243_10009311
390 Ga0105242_10029754
391 Ga0105242_10283672
392 Ga0105242_10313017
393 Ga0105248_10005976
394 Ga0105248_11206941
395 Ga0105238_10119030
396 Ga0105238_10361361
397 Ga0105249_10281763
398 Ga0105249_11158540
399 Ga0157370_10347059
400 Ga0157374_10029328
401 Ga0163162_10106865
402 Ga0157372_10823834
403 Ga0157375_10047073
404 Ga0157375_10508097
405 Ga0157375_10752069
406 Ga0157375_10846760
407 Ga0157375_10978891
408 Ga0157380_10009540
409 Ga0157380_10140256
410 Ga0157379_10044128
411 Ga0157379_10080753
412 Ga0157379_10234128
413 Ga0157376_10333030
414 Ga0163161_10028878
415 Ga0207697_10161684
416 Ga0207656_10102833
417 Ga0207656_10238578
418 Ga0207682_10006566
419 Ga0207682_10013857
420 Ga0207642_10141080
421 Ga0207710_10019936
422 Ga0207688_10108449
423 Ga0207680_10345691
424 Ga0207643_10050941
425 Ga0207707_10404527
426 Ga0207695_10074511
427 Ga0207660_10531328
428 Ga0207646_10049596
429 Ga0207646_10064771
430 Ga0207681_10045229
431 Ga0207681_10406411
432 Ga0207694_10187598
433 Ga0207650_10036263
434 Ga0207650_10048299
435 Ga0207650_10073374
436 Ga0207659_10013466
437 Ga0207659_10075611
438 Ga0207687_10369253
439 Ga0207700_10008760
440 Ga0207644_10479584
441 Ga0207670_10282617
442 Ga0207669_10003796
443 Ga0207669_10013436
444 Ga0207669_10101243
445 Ga0207704_10137331
446 Ga0207691_10087356
447 Ga0207691_10202921
448 Ga0207691_10207248
449 Ga0207711_10063876
450 Ga0207689_10032794
451 Ga0207679_10259338
452 Ga0207679_10580313
453 Ga0207658_10172138
454 Ga0207703_10089429
455 Ga0207703_10174865
456 Ga0207703_10271621
457 Ga0207708_10125592
458 Ga0207641_10069553
459 Ga0207641_10334987
460 Ga0207641_10739929
461 Ga0207648_10124099
462 Ga0207648_10345965
463 Ga0207648_10347130
464 Ga0207648_10536038
465 Ga0207648_10765049
466 Ga0207676_10106192
467 Ga0207674_10438149
468 Ga0207675_100027691
469 Ga0207683_10015404
470 Ga0207683_10119327
471 Ga0207683_10655180
472 Ga0207428_10006093
473 Ga0207428_10009674
474 Ga0207428_10025097
475 Ga0268265_10069772
476 Ga0268265_10073348
477 Ga0268265_10244940
478 Ga0268265_10850163
479 Ga0268264_10042290
480 Ga0268264_10063737
481 Ga0268264_10364881
482 Ga0268264_10723054
483 Ga0265334_10001637
484 Ga0265338_10034874
485 Ga0307408_100435529
486 Ga0316575_10077875
487 Ga0265314_10076463
488 Ga0307405_10118660
489 Ga0373939_0075770
490 Ga0373933_0043782
491 Ga0373933_0416863
492 Ga0373937_0109051
493 Ga0373937_0110958
494 Ga0373937_0474476
495 Ga0439456_039473
496 Ga0439435_0027229
497 Ga0439460_0173118
498 Ga0451577_0026993
499 Ga0451577_0052138
500 Ga0451577_0327077
501 Ga0453684_0200747
502 Ga0453684_0392692
503 Ga0495629_0111012
504 Ga0495580_0045683
505 Ga0495639_0118419
506 Ga0495594_0159677
507 Ga0495586_0134238
508 Ga0495586_0199552
509 Ga0495587_0036755
510 Ga0495621_0020829
511 Ga0495645_0192372
512 Ga0495633_0137488
513 Ga0495588_0000928
514 Ga0495599_0010147
515 Ga0495599_0187687
516 Ga0495658_0038129
517 Ga0495658_0224208
518 Ga0495674_0606059
519 Ga0495674_0721774
520 Ga0495680_0118762
521 Ga0495684_0053377
522 Ga0496101_0001196
523 Ga0496104_0042190
524 Ga0496104_0305129
525 Ga0496104_0990928
526 Ga0496105_0399767
527 Ga0496112_0025603
528 Ga0496113_0025524
529 Ga0496114_0000611
530 Ga0496114_0342918
531 Ga0501034_0017788
532 Ga0501039_0009753
533 Ga0501039_0461813
534 Ga0501040_0006142
535 Ga0501040_0406425
536 Ga0501041_0003660
537 Ga0501043_0111265
538 Ga0501046_0473936
539 Ga0501047_0006566
540 Ga0501048_0011695
541 Ga0501074_0384340
542 Ga0501075_0001280
543 Ga0501076_0133316
544 Ga0501077_0020000
545 Ga0501080_0148274
546 Ga0501080_0516003
547 Ga0501081_0002268
548 Ga0501083_0124391
549 Ga0501044_0009943
550 Ga0501045_0001013
551 nmdc:mga0k408_11847_c1
552 nmdc:mga06z11_74153_c1
553 nmdc:mga05p37_268664_c1
554 nmdc:mga05p37_297073_c1
555 nmdc:mga05p37_87958_c1
556 nmdc:mga09592_398578_c1
557 nmdc:mga06r32_14332_c1
558 nmdc:mga06r32_24843_c1
559 nmdc:mga06r32_51834_c1
560 nmdc:mga08y16_108274_c1
561 nmdc:mga08y16_258_c1
562 nmdc:mga08y16_300_c1
563 nmdc:mga08y16_60856_c1
564 nmdc:mga0n895_152530_c1
565 nmdc:mga0rr50_4184_c1
566 nmdc:mga0a205_110182_c1
567 Ga0495595_0093517
568 Ga0501084_0031243
569 Ga0501084_0136516
570 Ga0530510_0417436

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pd2-assembly1.cif.gz_A crystal structure of (st0148) conserved hypothetical from sulfolobus tokodaii strain7 0.7542 59 227
2pd2-assembly1.cif.gz_A crystal structure of (st0148) conserved hypothetical from sulfolobus tokodaii strain7 0.735 59 227
3wrw-assembly3.cif.gz_E crystal structure of the n-terminal domain of resistance protein 0.6546 56 106
5v0t-assembly4.cif.gz_D crystal structure of an alpha,alpha-trehalose-phosphate synthase (udp-forming) from burkholderia xenovorans in complex with glucose-6-phosphate 0.5163 49 100
4xtr-assembly1.cif.gz_A structure of get3 bound to the transmembrane domain of pep12 0.5158 48 102
ID Description Score Start End Superfamily
af_Q9VBQ3_1_70_1.10.533.10 Mainly Alpha;Orthogonal Bundle;Death Domain, Fas;Death Domain, Fas 0.9667 170 199 1.10.533.10
2pd2B00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.735 59 227 3.40.1260.10
2pd2B00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.7183 59 227 3.40.1260.10
1l1sA00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.6825 58 227 3.40.1260.10
1l1sA00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.6661 58 227 3.40.1260.10
ID Description Score Start End GO Terms
AF-A0A2V8K4W2-F1-model_v4 Uncharacterized protein 0.9582 60 226
AF-A0A2V8K4W2-F1-model_v4 Uncharacterized protein 0.9418 60 226
AF-A0A3D3BVA1-F1-model_v4 Uncharacterized protein 0.9417 54 229
AF-A0A2E0N7U6-F1-model_v4 Uncharacterized protein 0.929 76 224
AF-A0A2E8L5F4-F1-model_v4 Uncharacterized protein 0.9223 76 188

Map