F387575

General Info

Members Datasets Scaffolds Average Seq Length
286 108 263 232

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0023391|Ga0453684_0023391_1272_2018
Length 248
Sequence MKFFSVESDLLNDSLALRVLIVDDERPIRRFLRASLGSQFTIFEAENGSDALQLVSVSRPDLVLLDLGLPDLDGVEVTRRLREWTLVPIIVISVRTDEAEKVLALDAGADDYLTKPFSVSELLARMRATLRHCAKPEDEPLYQSGNLMVNLSKRDVLVGGERVALTPTEFGILRALVLHAGRVLTHQQLIKAVWAGNEEADHVVADAHLLRVNVSNLRRKIESNPATPRYILTEPGVGYRLNNDKEPA

Samples

Sample ID Description Type Environment
1 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
2 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
3 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
4 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
5 2818991459 Paenibacillus sp. 597 Isolate Unclassified
6 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
7 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
72 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
73 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
76 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
77 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
85 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
86 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
89 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
93 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
94 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
95 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
96 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
99 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
100 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
101 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
102 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
103 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
104 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
108 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.55
Metatranscriptomes 0
Isolates 2.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.8
Rhizosphere 95.45
Stem 0
Stem Tuber 0
Unclassified 1.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000422 3300003203 Bacteria 19494
2 Ga0065704_10070402 3300005289 Bacteria 26643
3 Ga0065704_10255615 3300005289 Bacteria 978
4 Ga0065707_10084159 3300005295 Bacteria 7592
5 Ga0065707_10091649 3300005295 Bacteria 3901
6 Ga0065707_10096048 3300005295 Bacteria 3308
7 Ga0065707_10099042 3300005295 Bacteria 3036
8 Ga0065707_10186239 3300005295 Bacteria 1387
9 Ga0065707_10232546 3300005295 Bacteria 1182
10 Ga0068869_100875417 3300005334 Bacteria 776
11 Ga0070666_10010759 3300005335 Bacteria 5724
12 Ga0070671_100606504 3300005355 Bacteria 946
13 Ga0070673_100152663 3300005364 Bacteria 1957
14 Ga0070667_100005981 3300005367 Bacteria 10109
15 Ga0070714_100182675 3300005435 Bacteria 1909
16 Ga0070701_10085625 3300005438 Bacteria 1716
17 Ga0070705_100382346 3300005440 Bacteria 1036
18 Ga0070700_100158772 3300005441 Bacteria 1554
19 Ga0070708_100405323 3300005445 Bacteria 1286
20 Ga0070706_100038390 3300005467 Bacteria 4419
21 Ga0070707_100370402 3300005468 Bacteria 1392
22 Ga0070707_100385509 3300005468 Unclassified 1361
23 Ga0070707_100721665 3300005468 Bacteria 960
24 Ga0070698_100008764 3300005471 Bacteria 10890
25 Ga0070698_100010703 3300005471 Bacteria 9767
26 Ga0070698_100029767 3300005471 Bacteria 5666
27 Ga0070699_100013082 3300005518 Bacteria 7150
28 Ga0070699_100401665 3300005518 Bacteria 1239
29 Ga0070697_100057865 3300005536 Bacteria 3153
30 Ga0070697_100095860 3300005536 Bacteria 2461
31 Ga0070697_100224580 3300005536 Bacteria 1601
32 Ga0070697_100278525 3300005536 Bacteria 1435
33 Ga0070695_100206578 3300005545 Bacteria 1407
34 Ga0070695_100608928 3300005545 Bacteria 858
35 Ga0070696_100474881 3300005546 Bacteria 991
36 Ga0068855_100227082 3300005563 Bacteria 2092
37 Ga0070702_100277018 3300005615 Bacteria 1150
38 Ga0070702_100819839 3300005615 Bacteria 721
39 Ga0068864_100208595 3300005618 Bacteria 1798
40 Ga0068870_10111728 3300005840 Bacteria 1561
41 Ga0068858_100009291 3300005842 Bacteria 9385
42 Ga0068860_100075012 3300005843 Bacteria 3217
43 Ga0068862_100013440 3300005844 Bacteria 6777
44 Ga0068862_100704651 3300005844 Unclassified 978
45 Ga0081540_1095597 3300005983 Bacteria 1294
46 Ga0081539_10000773 3300005985 Bacteria 62951
47 Ga0097621_100004770 3300006237 Bacteria 9486
48 Ga0068871_100002681 3300006358 Bacteria 12149
49 Ga0075428_100080591 3300006844 Bacteria 3552
50 Ga0075431_100191201 3300006847 Bacteria 2097
51 Ga0075433_10350849 3300006852 Bacteria 1304
52 Ga0075434_100242597 3300006871 Bacteria 1822
53 Ga0075434_100392023 3300006871 Unclassified 1410
54 Ga0075434_100622723 3300006871 Bacteria 1098
55 Ga0075434_100726555 3300006871 Bacteria 1010
56 Ga0075429_100055143 3300006880 Bacteria 3458
57 Ga0075435_100515600 3300007076 Bacteria 1034
58 Ga0111539_10069576 3300009094 Bacteria 4156
59 Ga0111539_10190172 3300009094 Unclassified 2395
60 Ga0105245_10149744 3300009098 Bacteria 2205
61 Ga0105247_10047652 3300009101 Bacteria 2632
62 Ga0105247_10189119 3300009101 Bacteria 1378
63 Ga0114129_10015984 3300009147 Bacteria 10672
64 Ga0114129_10103141 3300009147 Bacteria 3944
65 Ga0114129_10103341 3300009147 Bacteria 3939
66 Ga0114129_10122022 3300009147 Bacteria 3586
67 Ga0114129_10476985 3300009147 Bacteria 1633
68 Ga0105243_10214248 3300009148 Bacteria 1698
69 Ga0105242_10120981 3300009176 Bacteria 2246
70 Ga0105248_10016064 3300009177 Bacteria 8240
71 Ga0105249_10150896 3300009553 Bacteria 2237
72 Ga0105249_10767423 3300009553 Bacteria 1027
73 Ga0157374_10009230 3300013296 Bacteria 8456
74 Ga0157378_10074778 3300013297 Bacteria 3049
75 Ga0157378_10416364 3300013297 Bacteria 1327
76 Ga0163162_10004073 3300013306 Bacteria 14025
77 Ga0157375_10022967 3300013308 Bacteria 5749
78 Ga0163163_10010586 3300014325 Bacteria 8306
79 Ga0157376_10003539 3300014969 Bacteria 10762
80 Ga0207653_10053978 3300025885 Bacteria 1343
81 Ga0207710_10307961 3300025900 Bacteria 801
82 Ga0207680_10072491 3300025903 Bacteria 2138
83 Ga0207684_10027350 3300025910 Bacteria 4861
84 Ga0207684_10214652 3300025910 Bacteria 1660
85 Ga0207693_10055846 3300025915 Bacteria 3097
86 Ga0207662_10309793 3300025918 Bacteria 1052
87 Ga0207646_10044720 3300025922 Bacteria 3974
88 Ga0207646_10328990 3300025922 Bacteria 1380
89 Ga0207646_10392291 3300025922 Unclassified 1254
90 Ga0207646_10436007 3300025922 Bacteria 1182
91 Ga0207711_10393553 3300025941 Bacteria 1287
92 Ga0207712_10562463 3300025961 Bacteria 982
93 Ga0207658_10080321 3300025986 Bacteria 2497
94 Ga0207703_10005030 3300026035 Bacteria 10720
95 Ga0207703_10256560 3300026035 Bacteria 1579
96 Ga0207703_10723953 3300026035 Bacteria 947
97 Ga0207708_10024828 3300026075 Bacteria 4535
98 Ga0265337_1012561 3300028556 Bacteria 2874
99 Ga0265323_10036262 3300028653 Bacteria 1814
100 Ga0265322_10021750 3300028654 Bacteria 1837
101 Ga0265338_10052820 3300028800 Bacteria 3642
102 Ga0265338_10372094 3300028800 Bacteria 1023
103 Ga0265330_10054594 3300031235 Bacteria 1746
104 Ga0265332_10055848 3300031238 Bacteria 1692
105 Ga0265320_10001510 3300031240 Bacteria 16939
106 Ga0265340_10006088 3300031247 Bacteria 6650
107 Ga0265331_10201366 3300031250 Bacteria 897
108 Ga0265327_10117155 3300031251 Bacteria 1266
109 Ga0265316_10042272 3300031344 Bacteria 3644
110 Ga0265316_10068922 3300031344 Bacteria 2730
111 Ga0265316_10101234 3300031344 Bacteria 2189
112 Ga0307509_10206215 3300031507 Bacteria 1796
113 Ga0265314_10014223 3300031711 Bacteria 6382
114 Ga0373928_0000407 3300035084 Bacteria 8558
115 Ga0373932_0002738 3300035112 Bacteria 4384
116 Ga0373939_0031614 3300035114 Bacteria 1532
117 Ga0373937_0192049 3300036401 Bacteria 1919
118 Ga0451577_0000132 3300042876 Bacteria 167282
119 Ga0451577_0000176 3300042876 Bacteria 141176
120 Ga0451577_0001083 3300042876 Bacteria 39026
121 Ga0451577_0002115 3300042876 Bacteria 24431
122 Ga0451577_0003032 3300042876 Bacteria 19100
123 Ga0451577_0003180 3300042876 Bacteria 18482
124 Ga0451577_0006128 3300042876 Bacteria 12075
125 Ga0451577_0029231 3300042876 Bacteria 4981
126 Ga0451577_0036869 3300042876 Bacteria 4402
127 Ga0451577_0059883 3300042876 Bacteria 3395
128 Ga0451577_0086158 3300042876 Bacteria 2803
129 Ga0451577_0200182 3300042876 Bacteria 1803
130 Ga0451577_0274229 3300042876 Bacteria 1528
131 Ga0451577_0292914 3300042876 Bacteria 1475
132 Ga0451577_0322346 3300042876 Bacteria 1401
133 Ga0451577_0354472 3300042876 Bacteria 1331
134 Ga0451577_0360470 3300042876 Bacteria 1319
135 Ga0451577_0391901 3300042876 Bacteria 1260
136 Ga0451577_0399149 3300042876 Unclassified 1248
137 Ga0451577_0456490 3300042876 Unclassified 1160
138 Ga0451577_0499876 3300042876 Bacteria 1104
139 Ga0451577_1085338 3300042876 Bacteria 717
140 Ga0453683_0000002 3300044673 Bacteria 1244396
141 Ga0453683_0000196 3300044673 Bacteria 82692
142 Ga0453683_0000593 3300044673 Bacteria 40062
143 Ga0453683_0007297 3300044673 Bacteria 7528
144 Ga0453683_0012798 3300044673 Bacteria 5491
145 Ga0453683_0024785 3300044673 Bacteria 3814
146 Ga0453683_0029851 3300044673 Bacteria 3446
147 Ga0453683_0054346 3300044673 Bacteria 2506
148 Ga0453683_0113615 3300044673 Bacteria 1703
149 Ga0453683_0158690 3300044673 Bacteria 1430
150 Ga0453683_0159918 3300044673 Bacteria 1425
151 Ga0453683_0167031 3300044673 Bacteria 1393
152 Ga0453683_0377874 3300044673 Bacteria 912
153 Ga0453683_0436383 3300044673 Bacteria 846
154 Ga0453684_0000035 3300044712 Bacteria 725956
155 Ga0453684_0000125 3300044712 Bacteria 336972
156 Ga0453684_0000263 3300044712 Bacteria 226494
157 Ga0453684_0000465 3300044712 Bacteria 161517
158 Ga0453684_0000853 3300044712 Bacteria 102730
159 Ga0453684_0001258 3300044712 Bacteria 76274
160 Ga0453684_0002539 3300044712 Bacteria 43957
161 Ga0453684_0002633 3300044712 Bacteria 42891
162 Ga0453684_0003169 3300044712 Bacteria 37787
163 Ga0453684_0003542 3300044712 Bacteria 34919
164 Ga0453684_0003827 3300044712 Bacteria 33190
165 Ga0453684_0006766 3300044712 Bacteria 21578
166 Ga0453684_0010114 3300044712 Bacteria 16206
167 Ga0453684_0010793 3300044712 Bacteria 15490
168 Ga0453684_0011529 3300044712 Bacteria 14792
169 Ga0453684_0015140 3300044712 Bacteria 12235
170 Ga0453684_0016115 3300044712 Bacteria 11725
171 Ga0453684_0016474 3300044712 Bacteria 11550
172 Ga0453684_0017710 3300044712 Bacteria 11005
173 Ga0453684_0019704 3300044712 Bacteria 10242
174 Ga0453684_0023391 3300044712 Bacteria 9107
175 Ga0453684_0023527 3300044712 Bacteria 9063
176 Ga0453684_0026371 3300044712 Bacteria 8399
177 Ga0453684_0027226 3300044712 Bacteria 8207
178 Ga0453684_0031834 3300044712 Bacteria 7397
179 Ga0453684_0032065 3300044712 Bacteria 7366
180 Ga0453684_0037541 3300044712 Bacteria 6648
181 Ga0453684_0041844 3300044712 Bacteria 6186
182 Ga0453684_0043877 3300044712 Bacteria 5999
183 Ga0453684_0048244 3300044712 Bacteria 5635
184 Ga0453684_0062072 3300044712 Bacteria 4790
185 Ga0453684_0068723 3300044712 Bacteria 4497
186 Ga0453684_0074525 3300044712 Bacteria 4272
187 Ga0453684_0076597 3300044712 Bacteria 4198
188 Ga0453684_0085735 3300044712 Bacteria 3912
189 Ga0453684_0088505 3300044712 Bacteria 3834
190 Ga0453684_0098384 3300044712 Bacteria 3587
191 Ga0453684_0111722 3300044712 Bacteria 3319
192 Ga0453684_0117419 3300044712 Bacteria 3220
193 Ga0453684_0119810 3300044712 Bacteria 3180
194 Ga0453684_0131778 3300044712 Bacteria 2998
195 Ga0453684_0151269 3300044712 Bacteria 2758
196 Ga0453684_0165342 3300044712 Bacteria 2612
197 Ga0453684_0168848 3300044712 Bacteria 2580
198 Ga0453684_0171530 3300044712 Bacteria 2556
199 Ga0453684_0175794 3300044712 Bacteria 2518
200 Ga0453684_0180879 3300044712 Bacteria 2475
201 Ga0453684_0191445 3300044712 Bacteria 2393
202 Ga0453684_0233826 3300044712 Bacteria 2120
203 Ga0453684_0235208 3300044712 Bacteria 2113
204 Ga0453684_0280891 3300044712 Bacteria 1899
205 Ga0453684_0284330 3300044712 Bacteria 1885
206 Ga0453684_0288859 3300044712 Bacteria 1868
207 Ga0453684_0299357 3300044712 Bacteria 1828
208 Ga0453684_0387921 3300044712 Bacteria 1567
209 Ga0453684_0392510 3300044712 Bacteria 1556
210 Ga0453684_0410777 3300044712 Bacteria 1514
211 Ga0453684_0423492 3300044712 Bacteria 1487
212 Ga0453684_0436158 3300044712 Bacteria 1460
213 Ga0453684_0511304 3300044712 Bacteria 1328
214 Ga0453684_0561802 3300044712 Bacteria 1255
215 Ga0453684_0620051 3300044712 Bacteria 1183
216 Ga0453684_0666108 3300044712 Bacteria 1134
217 Ga0453684_0994506 3300044712 Bacteria 892
218 Ga0451576_0000187 3300045051 Bacteria 155783
219 Ga0451576_0000226 3300045051 Bacteria 138181
220 Ga0451576_0000248 3300045051 Bacteria 132398
221 Ga0451576_0001317 3300045051 Bacteria 42974
222 Ga0451576_0004914 3300045051 Bacteria 17056
223 Ga0451576_0014669 3300045051 Bacteria 8710
224 Ga0451576_0024009 3300045051 Bacteria 6591
225 Ga0451576_0038708 3300045051 Bacteria 5047
226 Ga0451576_0044413 3300045051 Bacteria 4684
227 Ga0451576_0064716 3300045051 Bacteria 3808
228 Ga0451576_0065072 3300045051 Bacteria 3796
229 Ga0451576_0080065 3300045051 Bacteria 3399
230 Ga0451576_0118938 3300045051 Bacteria 2751
231 Ga0451576_0126430 3300045051 Bacteria 2663
232 Ga0451576_0147650 3300045051 Bacteria 2452
233 Ga0451576_0149827 3300045051 Bacteria 2433
234 Ga0451576_0242355 3300045051 Bacteria 1883
235 Ga0451576_0327328 3300045051 Bacteria 1604
236 Ga0451576_0347703 3300045051 Bacteria 1552
237 Ga0451576_0447979 3300045051 Bacteria 1355
238 Ga0451576_0732749 3300045051 Bacteria 1038
239 Ga0451576_0760495 3300045051 Bacteria 1018
240 Ga0495653_0639433 3300046463 Bacteria 651
241 Ga0496104_0020695 3300048907 Bacteria 6032
242 Ga0496105_0184296 3300048908 Bacteria 1708
243 Ga0496106_0500711 3300048909 Bacteria 976
244 Ga0496108_0001667 3300048911 Bacteria 17617
245 Ga0496108_0575940 3300048911 Bacteria 981
246 Ga0496109_0003516 3300048912 Bacteria 13091
247 Ga0496110_0007659 3300048913 Bacteria 8641
248 Ga0496111_0087958 3300048914 Bacteria 2274
249 Ga0501072_0348794 3300049588 Bacteria 1175
250 Ga0501075_0131510 3300049591 Bacteria 1907
251 Ga0501076_0129443 3300049592 Bacteria 2047
252 nmdc:mga05p37_115201_c1 3300050507 Bacteria 3304
253 nmdc:mga05p37_132881_c1 3300050507 Bacteria 3053
254 nmdc:mga05p37_350877_c1 3300050507 Bacteria 1737
255 nmdc:mga09592_440133_c1 3300050508 Bacteria 1125
256 nmdc:mga08y16_385045_c1 3300050511 Bacteria 1437
257 nmdc:mga0n895_161905_c1 3300050512 Bacteria 2269
258 nmdc:mga0n895_222223_c1 3300050512 Bacteria 1917
259 nmdc:mga0n895_394812_c1 3300050512 Bacteria 1399
260 nmdc:mga0n895_831849_c1 3300050512 Bacteria 912
261 nmdc:mga0a205_185984_c1 3300050515 Bacteria 1970
262 nmdc:mga0a205_306815_c1 3300050515 Unclassified 1459
263 Ga0530510_0879593 3300061734 Bacteria 684

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0760495 Ga0451576_0760495_41_637 197
2 3300044712 Ga0453684_0016474 Ga0453684_0016474_1647_2261 200
3 3300044712 Ga0453684_0620051 Ga0453684_0620051_537_1163 206
4 3300042876 Ga0451577_0274229 Ga0451577_0274229_31_657 208
5 3300046463 Ga0495653_0639433 Ga0495653_0639433_11_640 209
6 3300050512 nmdc:mga0n895_394812_c1 nmdc:mga0n895_394812_c1_742_1374 210
7 3300061734 Ga0530510_0879593 Ga0530510_0879593_28_660 210
8 3300044712 Ga0453684_0119810 Ga0453684_0119810_2435_3127 212
9 3300044712 Ga0453684_0068723 Ga0453684_0068723_209_895 215
10 3300042876 Ga0451577_0002115 Ga0451577_0002115_5628_6299 220
11 3300044712 Ga0453684_0000035 Ga0453684_0000035_158218_158889 220
12 3300042876 Ga0451577_1085338 Ga0451577_1085338_16_696 223
13 iso_pu_bacteria 2585428059 2587741537 223
14 iso_pu_bacteria 2643221676 2644424265 223
15 iso_pu_bacteria 2818991459 2819671577 223
16 iso_pu_bacteria 2904755435 2904761047 223
17 iso_pu_bacteria 2919425241 2919428137 223
18 3300005983 Ga0081540_1095597 Ga0081540_10955971 225
19 3300042876 Ga0451577_0059883 Ga0451577_0059883_324_1004 225
20 3300044712 Ga0453684_0000125 Ga0453684_0000125_221552_222244 225
21 3300044712 Ga0453684_0561802 Ga0453684_0561802_335_1015 225
22 3300005295 Ga0065707_10186239 Ga0065707_101862392 226
23 3300013296 Ga0157374_10009230 Ga0157374_100092307 226
24 3300014325 Ga0163163_10010586 Ga0163163_100105865 226
25 3300025915 Ga0207693_10055846 Ga0207693_100558462 226
26 3300035114 Ga0373939_0031614 Ga0373939_0031614_497_1177 226
27 3300048907 Ga0496104_0020695 Ga0496104_0020695_3370_4077 226
28 3300048908 Ga0496105_0184296 Ga0496105_0184296_931_1638 226
29 3300048912 Ga0496109_0003516 Ga0496109_0003516_9757_10464 226
30 3300048913 Ga0496110_0007659 Ga0496110_0007659_5331_6038 226
31 3300048914 Ga0496111_0087958 Ga0496111_0087958_1432_2139 226
32 3300009094 Ga0111539_10190172 Ga0111539_101901722 227
33 3300025941 Ga0207711_10393553 Ga0207711_103935532 227
34 3300028654 Ga0265322_10021750 Ga0265322_100217502 227
35 3300031235 Ga0265330_10054594 Ga0265330_100545942 227
36 3300031344 Ga0265316_10068922 Ga0265316_100689223 227
37 3300031344 Ga0265316_10101234 Ga0265316_101012343 227
38 3300042876 Ga0451577_0003180 Ga0451577_0003180_12407_13105 227
39 3300042876 Ga0451577_0499876 Ga0451577_0499876_116_814 227
40 3300044673 Ga0453683_0000002 Ga0453683_0000002_837869_838567 227
41 3300044673 Ga0453683_0054346 Ga0453683_0054346_616_1314 227
42 3300044673 Ga0453683_0113615 Ga0453683_0113615_590_1288 227
43 3300044673 Ga0453683_0159918 Ga0453683_0159918_59_757 227
44 3300044712 Ga0453684_0011529 Ga0453684_0011529_11513_12211 227
45 3300044712 Ga0453684_0011529 Ga0453684_0011529_8813_9511 227
46 3300044712 Ga0453684_0019704 Ga0453684_0019704_2810_3508 227
47 3300044712 Ga0453684_0026371 Ga0453684_0026371_2100_2798 227
48 3300044712 Ga0453684_0026371 Ga0453684_0026371_5120_5818 227
49 3300044712 Ga0453684_0031834 Ga0453684_0031834_1188_1886 227
50 3300044712 Ga0453684_0074525 Ga0453684_0074525_2605_3303 227
51 3300044712 Ga0453684_0088505 Ga0453684_0088505_2113_2820 227
52 3300045051 Ga0451576_0001317 Ga0451576_0001317_14899_15597 227
53 3300045051 Ga0451576_0327328 Ga0451576_0327328_509_1207 227
54 3300005289 Ga0065704_10070402 Ga0065704_1007040212 228
55 3300005289 Ga0065704_10255615 Ga0065704_102556151 228
56 3300005295 Ga0065707_10084159 Ga0065707_100841593 228
57 3300005295 Ga0065707_10091649 Ga0065707_100916492 228
58 3300005295 Ga0065707_10099042 Ga0065707_100990422 228
59 3300005295 Ga0065707_10232546 Ga0065707_102325461 228
60 3300005334 Ga0068869_100875417 Ga0068869_1008754171 228
61 3300005438 Ga0070701_10085625 Ga0070701_100856251 228
62 3300005440 Ga0070705_100382346 Ga0070705_1003823462 228
63 3300005441 Ga0070700_100158772 Ga0070700_1001587721 228
64 3300005468 Ga0070707_100385509 Ga0070707_1003855091 228
65 3300005471 Ga0070698_100008764 Ga0070698_1000087645 228
66 3300005471 Ga0070698_100010703 Ga0070698_10001070310 228
67 3300005518 Ga0070699_100013082 Ga0070699_1000130824 228
68 3300005536 Ga0070697_100095860 Ga0070697_1000958602 228
69 3300005545 Ga0070695_100206578 Ga0070695_1002065782 228
70 3300005545 Ga0070695_100608928 Ga0070695_1006089281 228
71 3300005615 Ga0070702_100277018 Ga0070702_1002770181 228
72 3300005615 Ga0070702_100819839 Ga0070702_1008198391 228
73 3300005840 Ga0068870_10111728 Ga0068870_101117282 228
74 3300005844 Ga0068862_100013440 Ga0068862_1000134402 228
75 3300005844 Ga0068862_100704651 Ga0068862_1007046511 228
76 3300006847 Ga0075431_100191201 Ga0075431_1001912012 228
77 3300006852 Ga0075433_10350849 Ga0075433_103508492 228
78 3300006871 Ga0075434_100242597 Ga0075434_1002425972 228
79 3300006871 Ga0075434_100622723 Ga0075434_1006227232 228
80 3300006871 Ga0075434_100726555 Ga0075434_1007265551 228
81 3300007076 Ga0075435_100515600 Ga0075435_1005156001 228
82 3300009094 Ga0111539_10069576 Ga0111539_100695762 228
83 3300009101 Ga0105247_10189119 Ga0105247_101891192 228
84 3300009147 Ga0114129_10015984 Ga0114129_1001598410 228
85 3300009147 Ga0114129_10103341 Ga0114129_101033412 228
86 3300009148 Ga0105243_10214248 Ga0105243_102142482 228
87 3300009553 Ga0105249_10150896 Ga0105249_101508962 228
88 3300009553 Ga0105249_10767423 Ga0105249_107674232 228
89 3300025885 Ga0207653_10053978 Ga0207653_100539782 228
90 3300025900 Ga0207710_10307961 Ga0207710_103079611 228
91 3300025918 Ga0207662_10309793 Ga0207662_103097931 228
92 3300025922 Ga0207646_10392291 Ga0207646_103922912 228
93 3300025961 Ga0207712_10562463 Ga0207712_105624632 228
94 3300026035 Ga0207703_10256560 Ga0207703_102565602 228
95 3300026035 Ga0207703_10723953 Ga0207703_107239531 228
96 3300026075 Ga0207708_10024828 Ga0207708_100248284 228
97 3300028653 Ga0265323_10036262 Ga0265323_100362622 228
98 3300028800 Ga0265338_10052820 Ga0265338_100528202 228
99 3300031247 Ga0265340_10006088 Ga0265340_100060885 228
100 3300031344 Ga0265316_10042272 Ga0265316_100422723 228
101 3300042876 Ga0451577_0002115 Ga0451577_0002115_4416_5102 228
102 3300042876 Ga0451577_0003032 Ga0451577_0003032_441_1151 228
103 3300042876 Ga0451577_0003032 Ga0451577_0003032_4454_5167 228
104 3300042876 Ga0451577_0003180 Ga0451577_0003180_15092_15817 228
105 3300042876 Ga0451577_0006128 Ga0451577_0006128_10586_11272 228
106 3300042876 Ga0451577_0354472 Ga0451577_0354472_273_983 228
107 3300042876 Ga0451577_0360470 Ga0451577_0360470_251_961 228
108 3300042876 Ga0451577_0399149 Ga0451577_0399149_51_737 228
109 3300044673 Ga0453683_0167031 Ga0453683_0167031_545_1255 228
110 3300044673 Ga0453683_0436383 Ga0453683_0436383_115_801 228
111 3300044712 Ga0453684_0000035 Ga0453684_0000035_157006_157692 228
112 3300044712 Ga0453684_0000125 Ga0453684_0000125_227955_228641 228
113 3300044712 Ga0453684_0000263 Ga0453684_0000263_109357_110043 228
114 3300044712 Ga0453684_0001258 Ga0453684_0001258_54913_55599 228
115 3300044712 Ga0453684_0003169 Ga0453684_0003169_6382_7071 228
116 3300044712 Ga0453684_0003169 Ga0453684_0003169_7351_8037 228
117 3300044712 Ga0453684_0003542 Ga0453684_0003542_10372_11076 228
118 3300044712 Ga0453684_0003827 Ga0453684_0003827_29531_30217 228
119 3300044712 Ga0453684_0006766 Ga0453684_0006766_6544_7257 228
120 3300044712 Ga0453684_0010114 Ga0453684_0010114_6164_6850 228
121 3300044712 Ga0453684_0017710 Ga0453684_0017710_3922_4635 228
122 3300044712 Ga0453684_0027226 Ga0453684_0027226_3395_4105 228
123 3300044712 Ga0453684_0031834 Ga0453684_0031834_3873_4598 228
124 3300044712 Ga0453684_0037541 Ga0453684_0037541_3404_4114 228
125 3300044712 Ga0453684_0043877 Ga0453684_0043877_916_1626 228
126 3300044712 Ga0453684_0048244 Ga0453684_0048244_3521_4231 228
127 3300044712 Ga0453684_0076597 Ga0453684_0076597_804_1490 228
128 3300044712 Ga0453684_0085735 Ga0453684_0085735_2262_2948 228
129 3300044712 Ga0453684_0117419 Ga0453684_0117419_2486_3196 228
130 3300044712 Ga0453684_0165342 Ga0453684_0165342_746_1456 228
131 3300044712 Ga0453684_0191445 Ga0453684_0191445_459_1145 228
132 3300044712 Ga0453684_0666108 Ga0453684_0666108_60_746 228
133 3300045051 Ga0451576_0014669 Ga0451576_0014669_2488_3177 228
134 3300045051 Ga0451576_0024009 Ga0451576_0024009_4821_5531 228
135 3300045051 Ga0451576_0038708 Ga0451576_0038708_657_1367 228
136 3300045051 Ga0451576_0064716 Ga0451576_0064716_1750_2436 228
137 3300045051 Ga0451576_0118938 Ga0451576_0118938_173_859 228
138 3300045051 Ga0451576_0126430 Ga0451576_0126430_1056_1769 228
139 3300045051 Ga0451576_0149827 Ga0451576_0149827_446_1135 228
140 3300045051 Ga0451576_0242355 Ga0451576_0242355_1124_1831 228
141 3300045051 Ga0451576_0347703 Ga0451576_0347703_746_1456 228
142 3300045051 Ga0451576_0447979 Ga0451576_0447979_178_864 228
143 3300048911 Ga0496108_0575940 Ga0496108_0575940_189_875 228
144 3300049588 Ga0501072_0348794 Ga0501072_0348794_422_1108 228
145 3300049591 Ga0501075_0131510 Ga0501075_0131510_773_1459 228
146 3300049592 Ga0501076_0129443 Ga0501076_0129443_1296_1982 228
147 3300050507 nmdc:mga05p37_132881_c1 nmdc:mga05p37_132881_c1_255_941 228
148 3300050511 nmdc:mga08y16_385045_c1 nmdc:mga08y16_385045_c1_389_1099 228
149 3300050512 nmdc:mga0n895_161905_c1 nmdc:mga0n895_161905_c1_308_994 228
150 3300050512 nmdc:mga0n895_222223_c1 nmdc:mga0n895_222223_c1_273_983 228
151 3300050512 nmdc:mga0n895_831849_c1 nmdc:mga0n895_831849_c1_128_814 228
152 3300050515 nmdc:mga0a205_185984_c1 nmdc:mga0a205_185984_c1_1125_1811 228
153 3300005435 Ga0070714_100182675 Ga0070714_1001826752 229
154 3300005471 Ga0070698_100029767 Ga0070698_1000297677 229
155 3300005563 Ga0068855_100227082 Ga0068855_1002270822 229
156 3300025910 Ga0207684_10214652 Ga0207684_102146522 229
157 3300028556 Ga0265337_1012561 Ga0265337_10125613 229
158 3300031238 Ga0265332_10055848 Ga0265332_100558483 229
159 3300031240 Ga0265320_10001510 Ga0265320_100015102 229
160 3300031250 Ga0265331_10201366 Ga0265331_102013661 229
161 3300031711 Ga0265314_10014223 Ga0265314_100142236 229
162 3300042876 Ga0451577_0086158 Ga0451577_0086158_1819_2523 229
163 3300042876 Ga0451577_0391901 Ga0451577_0391901_373_1074 229
164 3300044712 Ga0453684_0000125 Ga0453684_0000125_217481_218194 229
165 3300044712 Ga0453684_0000263 Ga0453684_0000263_110448_111149 229
166 3300044712 Ga0453684_0002633 Ga0453684_0002633_40064_40762 229
167 3300044712 Ga0453684_0002633 Ga0453684_0002633_41080_41787 229
168 3300044712 Ga0453684_0015140 Ga0453684_0015140_5978_6682 229
169 3300044712 Ga0453684_0023391 Ga0453684_0023391_1272_2018 229
170 3300044712 Ga0453684_0062072 Ga0453684_0062072_2890_3579 229
171 3300044712 Ga0453684_0098384 Ga0453684_0098384_665_1369 229
172 3300044712 Ga0453684_0151269 Ga0453684_0151269_92_790 229
173 3300044712 Ga0453684_0180879 Ga0453684_0180879_725_1426 229
174 3300044712 Ga0453684_0235208 Ga0453684_0235208_372_1061 229
175 3300044712 Ga0453684_0299357 Ga0453684_0299357_164_868 229
176 3300044712 Ga0453684_0387921 Ga0453684_0387921_301_990 229
177 3300045051 Ga0451576_0000187 Ga0451576_0000187_17632_18330 229
178 3300045051 Ga0451576_0000187 Ga0451576_0000187_18780_19493 229
179 3300045051 Ga0451576_0004914 Ga0451576_0004914_10729_11418 229
180 3300003203 JGI25406J46586_10000422 JGI25406J46586_1000042211 230
181 3300005295 Ga0065707_10096048 Ga0065707_100960482 230
182 3300005335 Ga0070666_10010759 Ga0070666_100107594 230
183 3300005355 Ga0070671_100606504 Ga0070671_1006065041 230
184 3300005364 Ga0070673_100152663 Ga0070673_1001526632 230
185 3300005367 Ga0070667_100005981 Ga0070667_1000059814 230
186 3300005445 Ga0070708_100405323 Ga0070708_1004053231 230
187 3300005467 Ga0070706_100038390 Ga0070706_1000383903 230
188 3300005468 Ga0070707_100370402 Ga0070707_1003704022 230
189 3300005468 Ga0070707_100721665 Ga0070707_1007216651 230
190 3300005518 Ga0070699_100401665 Ga0070699_1004016652 230
191 3300005536 Ga0070697_100057865 Ga0070697_1000578655 230
192 3300005536 Ga0070697_100224580 Ga0070697_1002245801 230
193 3300005536 Ga0070697_100278525 Ga0070697_1002785252 230
194 3300005546 Ga0070696_100474881 Ga0070696_1004748811 230
195 3300005618 Ga0068864_100208595 Ga0068864_1002085952 230
196 3300005842 Ga0068858_100009291 Ga0068858_1000092914 230
197 3300005843 Ga0068860_100075012 Ga0068860_1000750121 230
198 3300005985 Ga0081539_10000773 Ga0081539_1000077316 230
199 3300006237 Ga0097621_100004770 Ga0097621_1000047705 230
200 3300006358 Ga0068871_100002681 Ga0068871_1000026819 230
201 3300006844 Ga0075428_100080591 Ga0075428_1000805912 230
202 3300006871 Ga0075434_100392023 Ga0075434_1003920232 230
203 3300006880 Ga0075429_100055143 Ga0075429_1000551432 230
204 3300009098 Ga0105245_10149744 Ga0105245_101497443 230
205 3300009101 Ga0105247_10047652 Ga0105247_100476522 230
206 3300009147 Ga0114129_10103141 Ga0114129_101031414 230
207 3300009147 Ga0114129_10122022 Ga0114129_101220222 230
208 3300009147 Ga0114129_10476985 Ga0114129_104769852 230
209 3300009176 Ga0105242_10120981 Ga0105242_101209812 230
210 3300009177 Ga0105248_10016064 Ga0105248_100160645 230
211 3300013297 Ga0157378_10074778 Ga0157378_100747782 230
212 3300013297 Ga0157378_10416364 Ga0157378_104163641 230
213 3300013306 Ga0163162_10004073 Ga0163162_100040735 230
214 3300013308 Ga0157375_10022967 Ga0157375_100229673 230
215 3300014969 Ga0157376_10003539 Ga0157376_100035394 230
216 3300025903 Ga0207680_10072491 Ga0207680_100724913 230
217 3300025910 Ga0207684_10027350 Ga0207684_100273501 230
218 3300025922 Ga0207646_10044720 Ga0207646_100447203 230
219 3300025922 Ga0207646_10328990 Ga0207646_103289901 230
220 3300025922 Ga0207646_10436007 Ga0207646_104360072 230
221 3300025986 Ga0207658_10080321 Ga0207658_100803212 230
222 3300026035 Ga0207703_10005030 Ga0207703_100050308 230
223 3300028800 Ga0265338_10372094 Ga0265338_103720942 230
224 3300031251 Ga0265327_10117155 Ga0265327_101171552 230
225 3300031507 Ga0307509_10206215 Ga0307509_102062152 230
226 3300035084 Ga0373928_0000407 Ga0373928_0000407_431_1135 230
227 3300035112 Ga0373932_0002738 Ga0373932_0002738_564_1268 230
228 3300036401 Ga0373937_0192049 Ga0373937_0192049_866_1585 230
229 3300042876 Ga0451577_0000132 Ga0451577_0000132_65570_66274 230
230 3300042876 Ga0451577_0000176 Ga0451577_0000176_27754_28458 230
231 3300042876 Ga0451577_0001083 Ga0451577_0001083_26444_27151 230
232 3300042876 Ga0451577_0003180 Ga0451577_0003180_5910_6614 230
233 3300042876 Ga0451577_0029231 Ga0451577_0029231_2570_3277 230
234 3300042876 Ga0451577_0036869 Ga0451577_0036869_1502_2194 230
235 3300042876 Ga0451577_0200182 Ga0451577_0200182_1026_1718 230
236 3300042876 Ga0451577_0292914 Ga0451577_0292914_717_1409 230
237 3300042876 Ga0451577_0322346 Ga0451577_0322346_208_915 230
238 3300042876 Ga0451577_0456490 Ga0451577_0456490_202_900 230
239 3300044673 Ga0453683_0000196 Ga0453683_0000196_2811_3518 230
240 3300044673 Ga0453683_0000593 Ga0453683_0000593_28155_28862 230
241 3300044673 Ga0453683_0007297 Ga0453683_0007297_134_841 230
242 3300044673 Ga0453683_0012798 Ga0453683_0012798_1000_1707 230
243 3300044673 Ga0453683_0024785 Ga0453683_0024785_1207_1911 230
244 3300044673 Ga0453683_0029851 Ga0453683_0029851_1839_2540 230
245 3300044673 Ga0453683_0158690 Ga0453683_0158690_620_1327 230
246 3300044673 Ga0453683_0377874 Ga0453683_0377874_171_863 230
247 3300044712 Ga0453684_0000465 Ga0453684_0000465_76711_77418 230
248 3300044712 Ga0453684_0000853 Ga0453684_0000853_5461_6165 230
249 3300044712 Ga0453684_0002539 Ga0453684_0002539_41035_41739 230
250 3300044712 Ga0453684_0003542 Ga0453684_0003542_4006_4710 230
251 3300044712 Ga0453684_0006766 Ga0453684_0006766_197_895 230
252 3300044712 Ga0453684_0010793 Ga0453684_0010793_13941_14648 230
253 3300044712 Ga0453684_0016115 Ga0453684_0016115_6289_6993 230
254 3300044712 Ga0453684_0023527 Ga0453684_0023527_3338_4039 230
255 3300044712 Ga0453684_0032065 Ga0453684_0032065_2606_3304 230
256 3300044712 Ga0453684_0041844 Ga0453684_0041844_2350_3054 230
257 3300044712 Ga0453684_0111722 Ga0453684_0111722_1372_2076 230
258 3300044712 Ga0453684_0131778 Ga0453684_0131778_316_1008 230
259 3300044712 Ga0453684_0168848 Ga0453684_0168848_424_1116 230
260 3300044712 Ga0453684_0171530 Ga0453684_0171530_740_1432 230
261 3300044712 Ga0453684_0175794 Ga0453684_0175794_1328_2020 230
262 3300044712 Ga0453684_0233826 Ga0453684_0233826_848_1540 230
263 3300044712 Ga0453684_0280891 Ga0453684_0280891_852_1544 230
264 3300044712 Ga0453684_0284330 Ga0453684_0284330_474_1181 230
265 3300044712 Ga0453684_0288859 Ga0453684_0288859_112_804 230
266 3300044712 Ga0453684_0392510 Ga0453684_0392510_589_1281 230
267 3300044712 Ga0453684_0410777 Ga0453684_0410777_766_1458 230
268 3300044712 Ga0453684_0423492 Ga0453684_0423492_758_1459 230
269 3300044712 Ga0453684_0436158 Ga0453684_0436158_345_1037 230
270 3300044712 Ga0453684_0511304 Ga0453684_0511304_544_1248 230
271 3300044712 Ga0453684_0994506 Ga0453684_0994506_83_784 230
272 3300045051 Ga0451576_0000226 Ga0451576_0000226_33953_34654 230
273 3300045051 Ga0451576_0000248 Ga0451576_0000248_21074_21781 230
274 3300045051 Ga0451576_0044413 Ga0451576_0044413_1086_1793 230
275 3300045051 Ga0451576_0065072 Ga0451576_0065072_984_1682 230
276 3300045051 Ga0451576_0080065 Ga0451576_0080065_1387_2091 230
277 3300045051 Ga0451576_0147650 Ga0451576_0147650_1684_2391 230
278 3300045051 Ga0451576_0732749 Ga0451576_0732749_74_781 230
279 3300048909 Ga0496106_0500711 Ga0496106_0500711_66_785 230
280 3300048911 Ga0496108_0001667 Ga0496108_0001667_3594_4313 230
281 3300050507 nmdc:mga05p37_115201_c1 nmdc:mga05p37_115201_c1_2424_3116 230
282 3300050507 nmdc:mga05p37_350877_c1 nmdc:mga05p37_350877_c1_636_1346 230
283 3300050508 nmdc:mga09592_440133_c1 nmdc:mga09592_440133_c1_259_951 230
284 3300050515 nmdc:mga0a205_306815_c1 nmdc:mga0a205_306815_c1_259_951 230
285 iso_pu_bacteria 2744054900 2746091411 230
286 iso_pu_bacteria 2744054901 2746097305 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

19

127

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

160

241

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9889 6 122
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.988 6 122
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9871 6 122
1zh4-assembly1.cif.gz_A crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe 0.9857 6 124
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9795 6 124
ID Description Score Start End Superfamily
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9987 6 83 3.40.50.2300
af_P9WGM7_2_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.99 5 83 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9879 6 83 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9786 6 83 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9752 5 83 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7Y5QFY7-F1-model_v4 Response regulator transcription factor 0.9838 6 125 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7X7W0G5-F1-model_v4 Stage 0 sporulation protein A homolog 0.9804 5 127 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A4Y8Z719-F1-model_v4 deleted 0.9769 4 126
AF-A0A8A3QW11-F1-model_v4 deleted 0.9736 5 122
AF-A0A7W1LUU8-F1-model_v4 Response regulator transcription factor 0.9728 5 128 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
89.71 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map