F387464

General Info

Members Datasets Scaffolds Average Seq Length
286 194 286 279

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10064553|Ga0207661_100645533
Length 281
Sequence MPLEARRFTVEPEPRLRGEEVGEGPPVVLCHGITATRSYVLHGSKALPRAGHLVLTYDARGHGESDPAPAGESYGYPELVGDLERVVDARLPEGERFLLGGHSMGAHTAVAYALRHPERLAGLAVIGPTYLGTIQQSSLDYWDGLAAALESDGIEGFLGYIGENQGIDPRWRDSVLRFTRERMLLQVHPEALVRALREVPRSRPFDSIEELRDLEVPALVVASNDDADPGHPYEAAAAYAEALPQAKLVSEAEGESPLAWQGGRLSRALAGFYAEALSSAR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
87 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
88 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
91 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
94 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
102 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
103 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
151 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
186 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
190 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
191 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
192 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.4
Nodule 0
Rhizoplane 11.54
Rhizosphere 80.07
Stem 0
Stem Tuber 0
Unclassified 6.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000917 3300001979 Bacteria 13090
2 JGI24748J21848_1000642 3300002074 Bacteria 3746
3 JGI24034J26672_10000606 3300002239 Bacteria 4599
4 Ga0070683_100024915 3300005329 Bacteria 5365
5 Ga0070683_100041673 3300005329 Bacteria 4226
6 Ga0070683_100043153 3300005329 Bacteria 4156
7 Ga0070683_100044367 3300005329 Bacteria 4100
8 Ga0070670_100172140 3300005331 Bacteria 1878
9 Ga0070666_10031682 3300005335 Bacteria 3491
10 Ga0070666_10047318 3300005335 Bacteria 2887
11 Ga0070682_100000075 3300005337 Bacteria 90547
12 Ga0070689_100249791 3300005340 Unclassified 1463
13 Ga0070691_10000135 3300005341 Bacteria 22871
14 Ga0070691_10000143 3300005341 Bacteria 22475
15 Ga0070675_100000106 3300005354 Bacteria 49336
16 Ga0070671_100350398 3300005355 Bacteria 1260
17 Ga0070688_100000137 3300005365 Bacteria 39585
18 Ga0070659_100008791 3300005366 Bacteria 7397
19 Ga0070659_100082709 3300005366 Bacteria 2565
20 Ga0070667_100031812 3300005367 Bacteria 4398
21 Ga0070667_100087546 3300005367 Bacteria 2673
22 Ga0070713_100000010 3300005436 Bacteria 151790
23 Ga0070710_10125875 3300005437 Bacteria 1557
24 Ga0070663_100001051 3300005455 Bacteria 15108
25 Ga0070678_100018970 3300005456 Bacteria 4470
26 Ga0070685_10000118 3300005466 Bacteria 50597
27 Ga0070679_100016735 3300005530 Bacteria 7085
28 Ga0070684_100031616 3300005535 Bacteria 4508
29 Ga0070684_100071725 3300005535 Bacteria 3048
30 Ga0070684_100079327 3300005535 Bacteria 2902
31 Ga0070672_100000001 3300005543 Bacteria 204624
32 Ga0070686_100062760 3300005544 Bacteria 2405
33 Ga0070665_100005640 3300005548 Bacteria 12868
34 Ga0070665_100241981 3300005548 Bacteria 1805
35 Ga0070665_100325808 3300005548 Bacteria 1540
36 Ga0070665_100344317 3300005548 Unclassified 1496
37 Ga0068854_100000116 3300005578 Bacteria 54986
38 Ga0068856_100000336 3300005614 Bacteria 51580
39 Ga0068852_100000056 3300005616 Bacteria 76111
40 Ga0068852_100013958 3300005616 Bacteria 6163
41 Ga0068864_100000031 3300005618 Bacteria 215331
42 Ga0068866_10058399 3300005718 Bacteria 1992
43 Ga0068851_10000404 3300005834 Bacteria 19513
44 Ga0068863_100000022 3300005841 Bacteria 188278
45 Ga0068860_100191731 3300005843 Bacteria 1978
46 Ga0081455_10012353 3300005937 Bacteria 8520
47 Ga0081540_1000041 3300005983 Bacteria 136874
48 Ga0070716_100068834 3300006173 Bacteria 2072
49 Ga0068871_100116960 3300006358 Bacteria 2248
50 Ga0075430_100106451 3300006846 Bacteria 2339
51 Ga0075433_10001579 3300006852 Bacteria 16871
52 Ga0105245_10000141 3300009098 Bacteria 68413
53 Ga0105247_10000305 3300009101 Bacteria 44071
54 Ga0105242_10000054 3300009176 Bacteria 77765
55 Ga0105238_10136970 3300009551 Bacteria 2426
56 Ga0105239_10121629 3300010375 Bacteria 2899
57 Ga0157371_10012052 3300013102 Bacteria 6627
58 Ga0157370_10026165 3300013104 Bacteria 5764
59 Ga0157369_10000074 3300013105 Bacteria 136668
60 Ga0157374_10072335 3300013296 Bacteria 3253
61 Ga0157378_10005546 3300013297 Bacteria 11048
62 Ga0157372_10000204 3300013307 Bacteria 65798
63 Ga0157375_10000127 3300013308 Bacteria 75142
64 Ga0157375_10002264 3300013308 Bacteria 16666
65 Ga0157375_11128789 3300013308 Bacteria 918
66 Ga0157380_10001049 3300014326 Bacteria 17675
67 Ga0157380_10132829 3300014326 Bacteria 2126
68 Ga0157376_10032333 3300014969 Bacteria 4200
69 Ga0163161_10000053 3300017792 Bacteria 117408
70 Ga0206356_10628584 3300020070 Bacteria 2002
71 Ga0206353_10491276 3300020082 Unclassified 1570
72 Ga0207656_10000269 3300025321 Bacteria 18036
73 Ga0207642_10040285 3300025899 Bacteria 2037
74 Ga0207710_10000157 3300025900 Bacteria 72764
75 Ga0207680_10033315 3300025903 Bacteria 2938
76 Ga0207705_10046627 3300025909 Unclassified 3115
77 Ga0207707_10049152 3300025912 Bacteria 3674
78 Ga0207671_10030872 3300025914 Bacteria 3995
79 Ga0207693_10188165 3300025915 Bacteria 1625
80 Ga0207652_10002832 3300025921 Bacteria 14548
81 Ga0207694_10160087 3300025924 Bacteria 1818
82 Ga0207659_10000013 3300025926 Bacteria 172742
83 Ga0207687_10000036 3300025927 Bacteria 121934
84 Ga0207687_10001139 3300025927 Bacteria 18097
85 Ga0207700_10000007 3300025928 Bacteria 345720
86 Ga0207700_10011893 3300025928 Bacteria 5579
87 Ga0207644_10227083 3300025931 Bacteria 1482
88 Ga0207690_10002231 3300025932 Bacteria 11820
89 Ga0207690_10059812 3300025932 Bacteria 2583
90 Ga0207686_10000073 3300025934 Bacteria 92009
91 Ga0207670_10237082 3300025936 Unclassified 1404
92 Ga0207665_10133364 3300025939 Bacteria 1765
93 Ga0207691_10000529 3300025940 Bacteria 38127
94 Ga0207661_10000988 3300025944 Bacteria 18799
95 Ga0207661_10029272 3300025944 Bacteria 4228
96 Ga0207661_10064553 3300025944 Bacteria 2968
97 Ga0207661_10138755 3300025944 Bacteria 2090
98 Ga0207640_10000134 3300025981 Bacteria 54961
99 Ga0207658_10036883 3300025986 Bacteria 3507
100 Ga0207658_10114773 3300025986 Bacteria 2136
101 Ga0207678_10004187 3300026067 Bacteria 12947
102 Ga0207702_10000368 3300026078 Bacteria 51559
103 Ga0207641_10000016 3300026088 Bacteria 307363
104 Ga0207676_10000031 3300026095 Bacteria 215877
105 Ga0207683_10028825 3300026121 Bacteria 4803
106 Ga0207698_10000101 3300026142 Bacteria 54530
107 Ga0207698_10002404 3300026142 Bacteria 11077
108 Ga0268266_10004992 3300028379 Bacteria 12539
109 Ga0268266_10009821 3300028379 Bacteria 8412
110 Ga0268266_10085692 3300028379 Bacteria 2753
111 Ga0268266_10608556 3300028379 Unclassified 1050
112 Ga0268264_10252331 3300028381 Bacteria 1639
113 Ga0265326_10015403 3300028558 Bacteria 2219
114 Ga0265319_1000105 3300028563 Bacteria 65502
115 Ga0265322_10055109 3300028654 Unclassified 1128
116 Ga0265338_10000507 3300028800 Bacteria 69026
117 Ga0265320_10127064 3300031240 Unclassified 1159
118 Ga0265325_10010137 3300031241 Bacteria 5471
119 Ga0373937_0031383 3300036401 Bacteria 4815
120 Ga0316582_0355400 3300036647 Unclassified 1008
121 Ga0451807_0508820 3300041486 Bacteria 1262
122 Ga0466963_0000008 3300044694 Bacteria 74916
123 Ga0466967_0000001 3300045976 Bacteria 229823
124 Ga0495592_0000267 3300046454 Bacteria 44729
125 Ga0495629_0000411 3300046459 Bacteria 35904
126 Ga0495629_0003930 3300046459 Bacteria 11175
127 Ga0495629_0167360 3300046459 Bacteria 1526
128 Ga0495651_0158958 3300046462 Bacteria 1621
129 Ga0495653_0037461 3300046463 Bacteria 3810
130 Ga0495662_0000071 3300046476 Bacteria 35579
131 Ga0495594_0000030 3300046499 Bacteria 66443
132 Ga0495606_0000586 3300046507 Bacteria 57795
133 Ga0495608_0000007 3300046511 Bacteria 313495
134 Ga0495618_0181090 3300046514 Bacteria 1339
135 Ga0495628_0034399 3300046516 Bacteria 4076
136 Ga0495630_0000075 3300046517 Bacteria 77378
137 Ga0495652_0000037 3300046529 Bacteria 133232
138 Ga0495652_0004607 3300046529 Bacteria 13143
139 Ga0495640_0024479 3300046533 Bacteria 4391
140 Ga0495586_0001547 3300046535 Bacteria 12691
141 Ga0495587_0003745 3300046536 Bacteria 10084
142 Ga0495621_0000640 3300046539 Bacteria 8793
143 Ga0495645_0217042 3300046543 Bacteria 1288
144 Ga0495622_0000080 3300046557 Bacteria 85557
145 Ga0495634_0000031 3300046642 Bacteria 110396
146 Ga0495634_0000381 3300046642 Bacteria 43342
147 Ga0495625_0000409 3300046660 Bacteria 65188
148 Ga0495657_0000001 3300046675 Bacteria 445641
149 Ga0495657_0019688 3300046675 Bacteria 4865
150 Ga0495647_0000081 3300046681 Bacteria 23561
151 Ga0495658_0002140 3300046683 Bacteria 10004
152 Ga0495658_0173307 3300046683 Bacteria 1336
153 Ga0495613_0000005 3300046689 Bacteria 222558
154 Ga0495613_0000041 3300046689 Bacteria 130784
155 Ga0495624_0000027 3300046690 Bacteria 93611
156 Ga0495600_0001753 3300046809 Bacteria 12131
157 Ga0495600_0067913 3300046809 Bacteria 2330
158 Ga0495604_0000050 3300047317 Bacteria 108094
159 Ga0495604_0000718 3300047317 Bacteria 28069
160 Ga0495604_0020717 3300047317 Bacteria 5250
161 Ga0495674_0000030 3300047319 Bacteria 115975
162 Ga0495676_0000805 3300047321 Bacteria 26189
163 Ga0495676_0068323 3300047321 Bacteria 2746
164 Ga0495680_0014070 3300047322 Bacteria 6951
165 Ga0495675_0000055 3300047444 Bacteria 77878
166 Ga0495686_0022979 3300047472 Bacteria 4119
167 Ga0495593_0051787 3300047673 Bacteria 2171
168 Ga0495602_0000007 3300048088 Bacteria 273212
169 Ga0496100_0000001 3300048903 Bacteria 530179
170 Ga0496101_0000004 3300048904 Bacteria 331599
171 Ga0496102_0000211 3300048905 Bacteria 77793
172 Ga0496102_0086379 3300048905 Bacteria 2897
173 Ga0496102_0142577 3300048905 Bacteria 2247
174 Ga0496103_0000174 3300048906 Bacteria 67124
175 Ga0496103_0015343 3300048906 Bacteria 4557
176 Ga0496103_0045689 3300048906 Bacteria 2702
177 Ga0496104_0000387 3300048907 Bacteria 38531
178 Ga0496104_0064858 3300048907 Bacteria 3465
179 Ga0496105_0000004 3300048908 Bacteria 475798
180 Ga0496105_0001994 3300048908 Bacteria 14717
181 Ga0496105_0035366 3300048908 Bacteria 4111
182 Ga0496106_0000076 3300048909 Bacteria 79088
183 Ga0496106_0000139 3300048909 Bacteria 54238
184 Ga0496107_0000005 3300048910 Bacteria 281747
185 Ga0496107_0029709 3300048910 Bacteria 3891
186 Ga0496107_0119822 3300048910 Bacteria 1938
187 Ga0496108_0010488 3300048911 Bacteria 7526
188 Ga0496109_0000218 3300048912 Bacteria 56316
189 Ga0496109_0416746 3300048912 Bacteria 1269
190 Ga0496110_0000038 3300048913 Bacteria 64272
191 Ga0496111_0000708 3300048914 Bacteria 17669
192 Ga0496112_0000025 3300048915 Bacteria 146197
193 Ga0496112_0004155 3300048915 Bacteria 12190
194 Ga0496113_0000027 3300048916 Bacteria 63463
195 Ga0496113_0002454 3300048916 Bacteria 10798
196 Ga0496113_0009653 3300048916 Bacteria 6338
197 Ga0496114_0000039 3300048917 Bacteria 138486
198 Ga0496114_0054573 3300048917 Unclassified 3333
199 Ga0496115_0000011 3300048918 Bacteria 222529
200 Ga0496115_0000162 3300048918 Bacteria 62522
201 Ga0496116_0000176 3300048919 Bacteria 128426
202 Ga0496117_0002925 3300048920 Bacteria 20664
203 Ga0496117_0136630 3300048920 Bacteria 1476
204 Ga0496117_0207118 3300048920 Bacteria 1103
205 Ga0496118_0004080 3300048921 Bacteria 17711
206 Ga0496118_0043640 3300048921 Bacteria 3521
207 Ga0496118_0114197 3300048921 Bacteria 1781
208 Ga0496119_0002021 3300048922 Bacteria 22972
209 Ga0496119_0027230 3300048922 Bacteria 3935
210 Ga0496120_0011386 3300048923 Bacteria 6118
211 Ga0496121_0023938 3300048924 Bacteria 5856
212 Ga0496121_0031381 3300048924 Bacteria 4855
213 Ga0496121_0123937 3300048924 Bacteria 1946
214 Ga0496124_0022997 3300048927 Bacteria 5702
215 Ga0496125_0059810 3300048928 Bacteria 3067
216 Ga0496125_0061159 3300048928 Bacteria 3022
217 Ga0496125_0161092 3300048928 Bacteria 1524
218 Ga0496126_0028478 3300048929 Bacteria 5322
219 Ga0496126_0134856 3300048929 Unclassified 2130
220 Ga0496126_0250283 3300048929 Bacteria 1477
221 Ga0501031_0001129 3300049568 Bacteria 16227
222 Ga0501032_0001889 3300049569 Bacteria 16548
223 Ga0501033_0001429 3300049570 Bacteria 21198
224 Ga0501034_0045739 3300049571 Bacteria 4421
225 Ga0501034_0072679 3300049571 Bacteria 3448
226 Ga0501036_0001887 3300049572 Bacteria 16280
227 Ga0501036_0129951 3300049572 Bacteria 2127
228 Ga0501037_0000985 3300049573 Bacteria 21110
229 Ga0501038_0002804 3300049574 Bacteria 16230
230 Ga0501039_0016006 3300049575 Bacteria 5743
231 Ga0501039_0132371 3300049575 Bacteria 1957
232 Ga0501040_0205432 3300049576 Bacteria 1399
233 Ga0501042_0016081 3300049578 Bacteria 5134
234 Ga0501042_0038138 3300049578 Bacteria 3412
235 Ga0501042_0130370 3300049578 Bacteria 1812
236 Ga0501043_0002678 3300049579 Bacteria 14939
237 Ga0501046_0002843 3300049580 Bacteria 16106
238 Ga0501047_0000430 3300049581 Bacteria 46649
239 Ga0501047_0008425 3300049581 Bacteria 9727
240 Ga0501048_0001723 3300049582 Bacteria 16662
241 Ga0501048_0155568 3300049582 Bacteria 1617
242 Ga0501069_0009217 3300049585 Bacteria 5206
243 Ga0501069_0018141 3300049585 Bacteria 3795
244 Ga0501070_0000592 3300049586 Bacteria 33029
245 Ga0501070_0010951 3300049586 Bacteria 7655
246 Ga0501071_0105127 3300049587 Bacteria 2084
247 Ga0501072_0127673 3300049588 Bacteria 2026
248 Ga0501073_0005921 3300049589 Bacteria 9129
249 Ga0501074_0030104 3300049590 Bacteria 3934
250 Ga0501074_0218528 3300049590 Bacteria 1357
251 Ga0501079_0006383 3300049741 Bacteria 8853
252 Ga0501079_0016857 3300049741 Bacteria 5578
253 Ga0501079_0200469 3300049741 Bacteria 1559
254 Ga0501080_0017371 3300049742 Bacteria 6652
255 Ga0501083_0005790 3300049744 Bacteria 8752
256 Ga0501083_0009461 3300049744 Bacteria 6883
257 Ga0501035_0001710 3300049822 Bacteria 22170
258 Ga0501035_0378042 3300049822 Unclassified 1182
259 Ga0501044_0002472 3300049823 Bacteria 21084
260 Ga0501044_0126150 3300049823 Bacteria 2557
261 Ga0501044_0169253 3300049823 Bacteria 2157
262 Ga0501045_0105435 3300049824 Bacteria 2089
263 Ga0501045_0135598 3300049824 Bacteria 1830
264 nmdc:mga0qj67_56147_c1 3300050509 Bacteria 3121
265 nmdc:mga0a205_113_c1 3300050515 Bacteria 30301
266 nmdc:mga0a205_366_c1 3300050515 Bacteria 34091
267 Ga0495601_0000043 3300053077 Bacteria 77025
268 Ga0495612_0000114 3300053078 Bacteria 34233
269 Ga0495612_0007813 3300053078 Bacteria 4363
270 Ga0495655_0000002 3300053083 Bacteria 312752
271 Ga0495655_0003067 3300053083 Bacteria 2715
272 Ga0495595_0000002 3300053084 Bacteria 445641
273 Ga0495595_0004795 3300053084 Bacteria 5447
274 Ga0495619_0000047 3300053085 Bacteria 102152
275 Ga0495619_0000084 3300053085 Bacteria 70164
276 Ga0495619_0000494 3300053085 Bacteria 26437
277 Ga0495619_0000827 3300053085 Bacteria 20290
278 Ga0495619_0014402 3300053085 Bacteria 4994
279 Ga0495619_0121224 3300053085 Bacteria 1793
280 Ga0500566_0013791 3300053094 Bacteria 4755
281 Ga0500595_052184 3300053119 Unclassified 1264
282 Ga0500628_000001 3300053129 Bacteria 564074
283 Ga0500658_0011176 3300053134 Unclassified 3306
284 Ga0501084_0055290 3300054114 Bacteria 3321
285 Ga0501084_0668113 3300054114 Bacteria 877
286 Ga0501082_0010118 3300060353 Bacteria 8119

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300054114 Ga0501084_0668113 Ga0501084_0668113_19_774 236
2 3300046454 Ga0495592_0000267 Ga0495592_0000267_6196_7032 254
3 3300046689 Ga0495613_0000005 Ga0495613_0000005_45256_46092 261
4 3300006852 Ga0075433_10001579 Ga0075433_100015796 262
5 3300046463 Ga0495653_0037461 Ga0495653_0037461_2732_3562 262
6 3300050515 nmdc:mga0a205_113_c1 nmdc:mga0a205_113_c1_17724_18554 262
7 3300009176 Ga0105242_10000054 Ga0105242_1000005459 263
8 3300025934 Ga0207686_10000073 Ga0207686_100000736 263
9 3300047321 Ga0495676_0068323 Ga0495676_0068323_867_1706 263
10 3300048911 Ga0496108_0010488 Ga0496108_0010488_3900_4730 263
11 3300048912 Ga0496109_0000218 Ga0496109_0000218_10284_11114 263
12 3300005329 Ga0070683_100043153 Ga0070683_1000431532 264
13 3300025944 Ga0207661_10029272 Ga0207661_100292722 264
14 3300048915 Ga0496112_0004155 Ga0496112_0004155_8386_9231 264
15 3300048916 Ga0496113_0000027 Ga0496113_0000027_11446_12291 264
16 3300005329 Ga0070683_100044367 Ga0070683_1000443675 265
17 3300005354 Ga0070675_100000106 Ga0070675_10000010612 265
18 3300005535 Ga0070684_100071725 Ga0070684_1000717252 265
19 3300005616 Ga0068852_100013958 Ga0068852_1000139586 265
20 3300020070 Ga0206356_10628584 Ga0206356_106285841 265
21 3300025926 Ga0207659_10000013 Ga0207659_1000001327 265
22 3300025928 Ga0207700_10011893 Ga0207700_100118936 265
23 3300025944 Ga0207661_10000988 Ga0207661_100009886 265
24 3300026142 Ga0207698_10002404 Ga0207698_1000240412 265
25 3300045976 Ga0466967_0000001 Ga0466967_0000001_48570_49412 265
26 3300046533 Ga0495640_0024479 Ga0495640_0024479_972_1814 265
27 3300047319 Ga0495674_0000030 Ga0495674_0000030_71659_72501 265
28 3300048929 Ga0496126_0028478 Ga0496126_0028478_3102_3947 265
29 3300005341 Ga0070691_10000143 Ga0070691_100001436 266
30 3300005983 Ga0081540_1000041 Ga0081540_100004150 266
31 3300036647 Ga0316582_0355400 Ga0316582_0355400_99_944 266
32 3300047472 Ga0495686_0022979 Ga0495686_0022979_3148_3993 266
33 3300048918 Ga0496115_0000162 Ga0496115_0000162_12620_13465 266
34 3300005366 Ga0070659_100082709 Ga0070659_1000827094 267
35 3300005535 Ga0070684_100079327 Ga0070684_1000793273 267
36 3300025932 Ga0207690_10059812 Ga0207690_100598124 267
37 3300025915 Ga0207693_10188165 Ga0207693_101881651 270
38 3300053085 Ga0495619_0000084 Ga0495619_0000084_17845_18714 270
39 3300036401 Ga0373937_0031383 Ga0373937_0031383_3092_3913 272
40 3300046514 Ga0495618_0181090 Ga0495618_0181090_320_1141 272
41 3300046516 Ga0495628_0034399 Ga0495628_0034399_1221_2042 272
42 3300046683 Ga0495658_0173307 Ga0495658_0173307_171_992 272
43 3300046809 Ga0495600_0067913 Ga0495600_0067913_414_1235 272
44 3300048907 Ga0496104_0000387 Ga0496104_0000387_3751_4602 272
45 3300048908 Ga0496105_0001994 Ga0496105_0001994_10905_11756 272
46 3300053078 Ga0495612_0000114 Ga0495612_0000114_32143_32964 272
47 3300053085 Ga0495619_0014402 Ga0495619_0014402_1098_1919 272
48 3300053085 Ga0495619_0121224 Ga0495619_0121224_176_997 272
49 3300005618 Ga0068864_100000031 Ga0068864_10000003131 273
50 3300026095 Ga0207676_10000031 Ga0207676_1000003131 273
51 3300046535 Ga0495586_0001547 Ga0495586_0001547_8430_9257 274
52 3300053085 Ga0495619_0000047 Ga0495619_0000047_52777_53628 274
53 3300005544 Ga0070686_100062760 Ga0070686_1000627602 275
54 3300006173 Ga0070716_100068834 Ga0070716_1000688342 275
55 3300013308 Ga0157375_10000127 Ga0157375_100001278 275
56 3300017792 Ga0163161_10000053 Ga0163161_1000005363 275
57 3300025939 Ga0207665_10133364 Ga0207665_101333642 275
58 3300046462 Ga0495651_0158958 Ga0495651_0158958_516_1346 275
59 3300046476 Ga0495662_0000071 Ga0495662_0000071_26897_27733 275
60 3300046675 Ga0495657_0019688 Ga0495657_0019688_2858_3697 275
61 3300049578 Ga0501042_0038138 Ga0501042_0038138_1277_2113 275
62 3300044694 Ga0466963_0000008 Ga0466963_0000008_22912_23751 276
63 3300046642 Ga0495634_0000031 Ga0495634_0000031_64229_65062 276
64 3300005548 Ga0070665_100241981 Ga0070665_1002419813 277
65 3300005841 Ga0068863_100000022 Ga0068863_100000022126 277
66 3300013308 Ga0157375_11128789 Ga0157375_111287891 277
67 3300026088 Ga0207641_10000016 Ga0207641_10000016248 277
68 3300028379 Ga0268266_10085692 Ga0268266_100856924 277
69 3300048905 Ga0496102_0000211 Ga0496102_0000211_68241_69077 277
70 3300048906 Ga0496103_0000174 Ga0496103_0000174_49782_50618 277
71 3300048909 Ga0496106_0000139 Ga0496106_0000139_551_1387 277
72 3300048910 Ga0496107_0119822 Ga0496107_0119822_508_1344 277
73 3300048920 Ga0496117_0136630 Ga0496117_0136630_414_1250 277
74 3300053083 Ga0495655_0000002 Ga0495655_0000002_257245_258081 277
75 3300053129 Ga0500628_000001 Ga0500628_000001_345914_346750 277
76 3300005535 Ga0070684_100031616 Ga0070684_1000316164 278
77 3300005834 Ga0068851_10000404 Ga0068851_1000040415 278
78 3300006846 Ga0075430_100106451 Ga0075430_1001064513 278
79 3300025321 Ga0207656_10000269 Ga0207656_100002696 278
80 3300050509 nmdc:mga0qj67_56147_c1 nmdc:mga0qj67_56147_c1_2055_2915 278
81 3300053083 Ga0495655_0003067 Ga0495655_0003067_852_1691 278
82 3300002074 JGI24748J21848_1000642 JGI24748J21848_10006422 279
83 3300002239 JGI24034J26672_10000606 JGI24034J26672_100006064 279
84 3300005335 Ga0070666_10047318 Ga0070666_100473183 279
85 3300005337 Ga0070682_100000075 Ga0070682_10000007568 279
86 3300005340 Ga0070689_100249791 Ga0070689_1002497912 279
87 3300005341 Ga0070691_10000135 Ga0070691_100001356 279
88 3300005365 Ga0070688_100000137 Ga0070688_10000013724 279
89 3300005366 Ga0070659_100008791 Ga0070659_1000087918 279
90 3300005367 Ga0070667_100087546 Ga0070667_1000875461 279
91 3300005436 Ga0070713_100000010 Ga0070713_10000001091 279
92 3300005456 Ga0070678_100018970 Ga0070678_1000189703 279
93 3300005466 Ga0070685_10000118 Ga0070685_1000011824 279
94 3300005543 Ga0070672_100000001 Ga0070672_10000000134 279
95 3300005548 Ga0070665_100005640 Ga0070665_1000056408 279
96 3300005548 Ga0070665_100344317 Ga0070665_1003443173 279
97 3300005578 Ga0068854_100000116 Ga0068854_1000001166 279
98 3300005614 Ga0068856_100000336 Ga0068856_10000033656 279
99 3300005616 Ga0068852_100000056 Ga0068852_10000005655 279
100 3300005718 Ga0068866_10058399 Ga0068866_100583993 279
101 3300006358 Ga0068871_100116960 Ga0068871_1001169603 279
102 3300009098 Ga0105245_10000141 Ga0105245_1000014119 279
103 3300010375 Ga0105239_10121629 Ga0105239_101216292 279
104 3300013102 Ga0157371_10012052 Ga0157371_100120525 279
105 3300013104 Ga0157370_10026165 Ga0157370_100261657 279
106 3300013105 Ga0157369_10000074 Ga0157369_1000007495 279
107 3300013297 Ga0157378_10005546 Ga0157378_1000554610 279
108 3300013307 Ga0157372_10000204 Ga0157372_1000020430 279
109 3300013308 Ga0157375_10002264 Ga0157375_100022644 279
110 3300014326 Ga0157380_10001049 Ga0157380_100010495 279
111 3300014326 Ga0157380_10132829 Ga0157380_101328293 279
112 3300020082 Ga0206353_10491276 Ga0206353_104912762 279
113 3300025899 Ga0207642_10040285 Ga0207642_100402853 279
114 3300025903 Ga0207680_10033315 Ga0207680_100333153 279
115 3300025909 Ga0207705_10046627 Ga0207705_100466273 279
116 3300025927 Ga0207687_10000036 Ga0207687_1000003659 279
117 3300025927 Ga0207687_10001139 Ga0207687_100011395 279
118 3300025928 Ga0207700_10000007 Ga0207700_10000007292 279
119 3300025932 Ga0207690_10002231 Ga0207690_100022317 279
120 3300025936 Ga0207670_10237082 Ga0207670_102370822 279
121 3300025940 Ga0207691_10000529 Ga0207691_1000052910 279
122 3300025981 Ga0207640_10000134 Ga0207640_100001346 279
123 3300025986 Ga0207658_10114773 Ga0207658_101147731 279
124 3300026078 Ga0207702_10000368 Ga0207702_100003686 279
125 3300026121 Ga0207683_10028825 Ga0207683_100288255 279
126 3300026142 Ga0207698_10000101 Ga0207698_1000010155 279
127 3300028379 Ga0268266_10004992 Ga0268266_1000499210 279
128 3300028379 Ga0268266_10608556 Ga0268266_106085561 279
129 3300046459 Ga0495629_0000411 Ga0495629_0000411_5699_6541 279
130 3300046459 Ga0495629_0167360 Ga0495629_0167360_27_872 279
131 3300046507 Ga0495606_0000586 Ga0495606_0000586_48443_49285 279
132 3300046511 Ga0495608_0000007 Ga0495608_0000007_57585_58427 279
133 3300046517 Ga0495630_0000075 Ga0495630_0000075_26472_27314 279
134 3300046539 Ga0495621_0000640 Ga0495621_0000640_218_1060 279
135 3300046660 Ga0495625_0000409 Ga0495625_0000409_20803_21666 279
136 3300046675 Ga0495657_0000001 Ga0495657_0000001_189731_190573 279
137 3300046681 Ga0495647_0000081 Ga0495647_0000081_6141_6983 279
138 3300046683 Ga0495658_0002140 Ga0495658_0002140_4702_5544 279
139 3300046689 Ga0495613_0000041 Ga0495613_0000041_128164_129006 279
140 3300046690 Ga0495624_0000027 Ga0495624_0000027_28084_28926 279
141 3300046809 Ga0495600_0001753 Ga0495600_0001753_8548_9390 279
142 3300047317 Ga0495604_0000050 Ga0495604_0000050_47023_47868 279
143 3300047317 Ga0495604_0000718 Ga0495604_0000718_19666_20508 279
144 3300047317 Ga0495604_0020717 Ga0495604_0020717_408_1250 279
145 3300047444 Ga0495675_0000055 Ga0495675_0000055_19239_20081 279
146 3300047673 Ga0495593_0051787 Ga0495593_0051787_686_1528 279
147 3300048088 Ga0495602_0000007 Ga0495602_0000007_210658_211500 279
148 3300048913 Ga0496110_0000038 Ga0496110_0000038_17184_18026 279
149 3300048914 Ga0496111_0000708 Ga0496111_0000708_9082_9924 279
150 3300048915 Ga0496112_0000025 Ga0496112_0000025_54713_55555 279
151 3300048916 Ga0496113_0009653 Ga0496113_0009653_829_1671 279
152 3300048917 Ga0496114_0054573 Ga0496114_0054573_472_1314 279
153 3300048929 Ga0496126_0134856 Ga0496126_0134856_586_1431 279
154 3300049572 Ga0501036_0129951 Ga0501036_0129951_1080_1922 279
155 3300049575 Ga0501039_0132371 Ga0501039_0132371_114_956 279
156 3300049578 Ga0501042_0130370 Ga0501042_0130370_106_948 279
157 3300049581 Ga0501047_0008425 Ga0501047_0008425_3804_4649 279
158 3300049741 Ga0501079_0200469 Ga0501079_0200469_403_1245 279
159 3300049824 Ga0501045_0105435 Ga0501045_0105435_1052_1894 279
160 3300050515 nmdc:mga0a205_366_c1 nmdc:mga0a205_366_c1_24803_25651 279
161 3300053077 Ga0495601_0000043 Ga0495601_0000043_36864_37706 279
162 3300053078 Ga0495612_0007813 Ga0495612_0007813_2263_3105 279
163 3300053084 Ga0495595_0000002 Ga0495595_0000002_255069_255911 279
164 3300053084 Ga0495595_0004795 Ga0495595_0004795_440_1282 279
165 3300053085 Ga0495619_0000494 Ga0495619_0000494_19503_20345 279
166 3300053085 Ga0495619_0000827 Ga0495619_0000827_14488_15330 279
167 3300005329 Ga0070683_100024915 Ga0070683_1000249155 280
168 3300005329 Ga0070683_100041673 Ga0070683_1000416733 280
169 3300005331 Ga0070670_100172140 Ga0070670_1001721403 280
170 3300005335 Ga0070666_10031682 Ga0070666_100316824 280
171 3300005355 Ga0070671_100350398 Ga0070671_1003503981 280
172 3300005367 Ga0070667_100031812 Ga0070667_1000318122 280
173 3300005437 Ga0070710_10125875 Ga0070710_101258753 280
174 3300005455 Ga0070663_100001051 Ga0070663_10000105113 280
175 3300005530 Ga0070679_100016735 Ga0070679_1000167356 280
176 3300005548 Ga0070665_100325808 Ga0070665_1003258081 280
177 3300005843 Ga0068860_100191731 Ga0068860_1001917312 280
178 3300005937 Ga0081455_10012353 Ga0081455_100123536 280
179 3300009551 Ga0105238_10136970 Ga0105238_101369701 280
180 3300013296 Ga0157374_10072335 Ga0157374_100723352 280
181 3300014969 Ga0157376_10032333 Ga0157376_100323335 280
182 3300025912 Ga0207707_10049152 Ga0207707_100491525 280
183 3300025914 Ga0207671_10030872 Ga0207671_100308724 280
184 3300025921 Ga0207652_10002832 Ga0207652_100028325 280
185 3300025924 Ga0207694_10160087 Ga0207694_101600871 280
186 3300025931 Ga0207644_10227083 Ga0207644_102270832 280
187 3300025944 Ga0207661_10064553 Ga0207661_100645533 280
188 3300025944 Ga0207661_10138755 Ga0207661_101387552 280
189 3300025986 Ga0207658_10036883 Ga0207658_100368834 280
190 3300026067 Ga0207678_10004187 Ga0207678_100041875 280
191 3300028379 Ga0268266_10009821 Ga0268266_100098211 280
192 3300028381 Ga0268264_10252331 Ga0268264_102523312 280
193 3300028558 Ga0265326_10015403 Ga0265326_100154032 280
194 3300028563 Ga0265319_1000105 Ga0265319_100010556 280
195 3300028654 Ga0265322_10055109 Ga0265322_100551092 280
196 3300028800 Ga0265338_10000507 Ga0265338_1000050719 280
197 3300031240 Ga0265320_10127064 Ga0265320_101270641 280
198 3300031241 Ga0265325_10010137 Ga0265325_100101375 280
199 3300041486 Ga0451807_0508820 Ga0451807_0508820_352_1197 280
200 3300046459 Ga0495629_0003930 Ga0495629_0003930_4733_5578 280
201 3300046499 Ga0495594_0000030 Ga0495594_0000030_56308_57192 280
202 3300046529 Ga0495652_0000037 Ga0495652_0000037_78342_79187 280
203 3300046529 Ga0495652_0004607 Ga0495652_0004607_4924_5772 280
204 3300046536 Ga0495587_0003745 Ga0495587_0003745_1726_2571 280
205 3300046543 Ga0495645_0217042 Ga0495645_0217042_282_1130 280
206 3300046557 Ga0495622_0000080 Ga0495622_0000080_17555_18439 280
207 3300046642 Ga0495634_0000381 Ga0495634_0000381_5627_6484 280
208 3300047321 Ga0495676_0000805 Ga0495676_0000805_17861_18706 280
209 3300047322 Ga0495680_0014070 Ga0495680_0014070_1903_2748 280
210 3300048903 Ga0496100_0000001 Ga0496100_0000001_478163_479008 280
211 3300048904 Ga0496101_0000004 Ga0496101_0000004_279515_280360 280
212 3300048905 Ga0496102_0086379 Ga0496102_0086379_46_897 280
213 3300048905 Ga0496102_0142577 Ga0496102_0142577_1051_1899 280
214 3300048906 Ga0496103_0015343 Ga0496103_0015343_2476_3324 280
215 3300048906 Ga0496103_0045689 Ga0496103_0045689_1760_2608 280
216 3300048907 Ga0496104_0064858 Ga0496104_0064858_2089_2940 280
217 3300048908 Ga0496105_0000004 Ga0496105_0000004_154762_155604 280
218 3300048908 Ga0496105_0035366 Ga0496105_0035366_1969_2820 280
219 3300048909 Ga0496106_0000076 Ga0496106_0000076_75353_76198 280
220 3300048910 Ga0496107_0000005 Ga0496107_0000005_51240_52085 280
221 3300048910 Ga0496107_0029709 Ga0496107_0029709_1545_2396 280
222 3300048912 Ga0496109_0416746 Ga0496109_0416746_387_1238 280
223 3300048916 Ga0496113_0002454 Ga0496113_0002454_5868_6716 280
224 3300048917 Ga0496114_0000039 Ga0496114_0000039_88441_89286 280
225 3300048918 Ga0496115_0000011 Ga0496115_0000011_45650_46495 280
226 3300048919 Ga0496116_0000176 Ga0496116_0000176_38030_38878 280
227 3300048920 Ga0496117_0002925 Ga0496117_0002925_13152_14003 280
228 3300048920 Ga0496117_0207118 Ga0496117_0207118_69_917 280
229 3300048921 Ga0496118_0004080 Ga0496118_0004080_7080_7931 280
230 3300048921 Ga0496118_0043640 Ga0496118_0043640_718_1566 280
231 3300048921 Ga0496118_0114197 Ga0496118_0114197_316_1164 280
232 3300048922 Ga0496119_0002021 Ga0496119_0002021_3503_4351 280
233 3300048922 Ga0496119_0027230 Ga0496119_0027230_858_1709 280
234 3300048923 Ga0496120_0011386 Ga0496120_0011386_1433_2281 280
235 3300048924 Ga0496121_0023938 Ga0496121_0023938_3883_4734 280
236 3300048924 Ga0496121_0031381 Ga0496121_0031381_43_891 280
237 3300048924 Ga0496121_0123937 Ga0496121_0123937_743_1591 280
238 3300048927 Ga0496124_0022997 Ga0496124_0022997_3766_4614 280
239 3300048928 Ga0496125_0059810 Ga0496125_0059810_1242_2090 280
240 3300048928 Ga0496125_0061159 Ga0496125_0061159_2146_2997 280
241 3300048928 Ga0496125_0161092 Ga0496125_0161092_156_1004 280
242 3300048929 Ga0496126_0250283 Ga0496126_0250283_433_1281 280
243 3300049568 Ga0501031_0001129 Ga0501031_0001129_9702_10553 280
244 3300049569 Ga0501032_0001889 Ga0501032_0001889_9898_10749 280
245 3300049570 Ga0501033_0001429 Ga0501033_0001429_9530_10381 280
246 3300049571 Ga0501034_0045739 Ga0501034_0045739_2456_3307 280
247 3300049571 Ga0501034_0072679 Ga0501034_0072679_2402_3253 280
248 3300049572 Ga0501036_0001887 Ga0501036_0001887_5667_6518 280
249 3300049573 Ga0501037_0000985 Ga0501037_0000985_9563_10414 280
250 3300049574 Ga0501038_0002804 Ga0501038_0002804_5804_6655 280
251 3300049575 Ga0501039_0016006 Ga0501039_0016006_2372_3223 280
252 3300049576 Ga0501040_0205432 Ga0501040_0205432_367_1218 280
253 3300049578 Ga0501042_0016081 Ga0501042_0016081_364_1215 280
254 3300049579 Ga0501043_0002678 Ga0501043_0002678_6027_6878 280
255 3300049580 Ga0501046_0002843 Ga0501046_0002843_5698_6549 280
256 3300049581 Ga0501047_0000430 Ga0501047_0000430_9558_10409 280
257 3300049582 Ga0501048_0001723 Ga0501048_0001723_9786_10637 280
258 3300049582 Ga0501048_0155568 Ga0501048_0155568_484_1338 280
259 3300049585 Ga0501069_0009217 Ga0501069_0009217_3001_3855 280
260 3300049585 Ga0501069_0018141 Ga0501069_0018141_2203_3054 280
261 3300049586 Ga0501070_0000592 Ga0501070_0000592_26144_26995 280
262 3300049586 Ga0501070_0010951 Ga0501070_0010951_5311_6159 280
263 3300049587 Ga0501071_0105127 Ga0501071_0105127_1052_1906 280
264 3300049588 Ga0501072_0127673 Ga0501072_0127673_498_1349 280
265 3300049589 Ga0501073_0005921 Ga0501073_0005921_6029_6880 280
266 3300049590 Ga0501074_0030104 Ga0501074_0030104_867_1718 280
267 3300049590 Ga0501074_0218528 Ga0501074_0218528_415_1263 280
268 3300049741 Ga0501079_0006383 Ga0501079_0006383_5761_6612 280
269 3300049741 Ga0501079_0016857 Ga0501079_0016857_1157_2011 280
270 3300049742 Ga0501080_0017371 Ga0501080_0017371_205_1056 280
271 3300049744 Ga0501083_0005790 Ga0501083_0005790_2256_3107 280
272 3300049744 Ga0501083_0009461 Ga0501083_0009461_4749_5600 280
273 3300049822 Ga0501035_0001710 Ga0501035_0001710_15521_16372 280
274 3300049822 Ga0501035_0378042 Ga0501035_0378042_291_1142 280
275 3300049823 Ga0501044_0002472 Ga0501044_0002472_8171_9022 280
276 3300049823 Ga0501044_0126150 Ga0501044_0126150_1530_2378 280
277 3300049823 Ga0501044_0169253 Ga0501044_0169253_1045_1896 280
278 3300049824 Ga0501045_0135598 Ga0501045_0135598_505_1356 280
279 3300053094 Ga0500566_0013791 Ga0500566_0013791_2171_3016 280
280 3300053119 Ga0500595_052184 Ga0500595_052184_266_1114 280
281 3300053134 Ga0500658_0011176 Ga0500658_0011176_724_1572 280
282 3300054114 Ga0501084_0055290 Ga0501084_0055290_2276_3127 280
283 3300060353 Ga0501082_0010118 Ga0501082_0010118_2249_3100 280
284 3300001979 JGI24740J21852_10000917 JGI24740J21852_100009174 281
285 3300009101 Ga0105247_10000305 Ga0105247_1000030511 281
286 3300025900 Ga0207710_10000157 Ga0207710_100001577 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

25

247

0.82

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

25

263

0.68

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

27

259

0.62

Structural Annotation

Top 5 Hits

ID Description Score Start End
4uhd-assembly1.cif.gz_A structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) 0.8089 4 279
5a62-assembly1.cif.gz_A-2 hydrolytic potential of the ammonia-oxidizing thaumarchaeon nitrososphaera gargenis - crystal structure and activity profiles of carboxylesterases linked to their metabolic function 0.8053 7 279
7dq9-assembly4.cif.gz_D crystal structure of a type-a feruloyl esterase from gut alistipes shahii 0.8035 7 274
4uhd-assembly1.cif.gz_A structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) 0.8035 4 279
2xua-assembly1.cif.gz_A crystal structure of the enol-lactonase from burkholderia xenovorans lb400 0.8006 7 274
ID Description Score Start End Superfamily
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8694 6 90 3.40.50.12270
af_I6Y1I1_6_215_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.835 24 253 3.40.50.1820
af_I6Y1I1_6_215_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8169 24 253 3.40.50.1820
2xuaH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8099 16 274 3.40.50.1820
af_A0A0R0JZV5_20_305_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8056 5 273 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1Q3NGW1-F1-model_v4 deleted 0.9545 19 276
AF-A0A1Q3NGW1-F1-model_v4 deleted 0.9329 19 276
AF-A0A7V8ZF32-F1-model_v4 Alpha/beta hydrolase 0.9218 2 276 GO:0016787
AF-A0A7W0RAZ0-F1-model_v4 Alpha/beta fold hydrolase 0.9189 17 205 GO:0016020
GO:0016787
AF-A0A7V8ZF32-F1-model_v4 Alpha/beta hydrolase 0.8995 2 276 GO:0016787

Feature Viewer

pLDDT pTM Quality
92.25 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map