F387456
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 286 | 173 | 262 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300025913|Ga0207695_10198730|Ga0207695_101987302 |
| Length | 156 |
| Sequence | VRTPQPGDGSSGQWAVNTSMKTFESKVIINKPIAEVYDFLSDLNNHQQLMPDNIIEWASTTDTANFNVQNMARLSLKVESRLENKEIKIVPAEKPPFDLELKWSLAPVNNNTEVLFTIAADLNMMMKMLASGPLQKLADHETQNLTSILTYTQNNR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 3 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 4 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 5 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 6 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 7 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 8 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 9 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 10 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 11 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 12 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 13 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 14 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 15 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 16 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 17 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 18 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 19 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 20 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 21 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 22 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 23 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 24 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 25 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 26 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 27 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 28 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 29 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 30 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 31 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 32 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 33 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 34 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 35 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 36 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 37 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 39 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 95 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 97 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 131 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 132 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 134 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 135 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 136 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 137 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 138 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 139 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 140 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 143 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 144 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 145 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 165 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 166 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 167 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 168 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 169 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 170 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 171 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 172 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 173 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.56 |
| Metatranscriptomes | 1.05 |
| Isolates | 8.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.24 |
| Nodule | 0 |
| Rhizoplane | 2.1 |
| Rhizosphere | 81.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_475676 | 2162886007 | Bacteria | 8397 |
| 2 | JGI24739J22299_10061357 | 3300001989 | Bacteria | 1187 |
| 3 | JGI24737J22298_10002356 | 3300001990 | Bacteria | 6734 |
| 4 | JGI24735J21928_10000050 | 3300002067 | Bacteria | 50872 |
| 5 | JGI25162J39368_1000011 | 3300002737 | Bacteria | 379156 |
| 6 | JGI25157J39369_1002605 | 3300002741 | Bacteria | 4289 |
| 7 | JGI25152J39213_1000476 | 3300002773 | Bacteria | 23167 |
| 8 | rootH1_10055881 | 3300003316 | Bacteria | 1618 |
| 9 | rootH2_10002871 | 3300003320 | Bacteria | 62767 |
| 10 | rootH2_10221640 | 3300003320 | Bacteria | 2153 |
| 11 | rootL2_10078357 | 3300003322 | Bacteria | 1090 |
| 12 | rootH1_10024269 | 3300003323 | Bacteria | 2701 |
| 13 | rootH1_10218449 | 3300003323 | Bacteria | 9817 |
| 14 | rootH1_10245167 | 3300003323 | Bacteria | 1374 |
| 15 | Ga0055536_1000049 | 3300003781 | Bacteria | 113328 |
| 16 | Ga0055530_10049206 | 3300003791 | Bacteria | 987 |
| 17 | Ga0058863_10595060 | 3300004799 | Unclassified | 707 |
| 18 | Ga0065714_10002298 | 3300005288 | Bacteria | 48008 |
| 19 | Ga0065714_10002621 | 3300005288 | Bacteria | 31326 |
| 20 | Ga0065714_10004463 | 3300005288 | Bacteria | 5552 |
| 21 | Ga0065714_10006411 | 3300005288 | Bacteria | 8416 |
| 22 | Ga0065714_10087017 | 3300005288 | Bacteria | 2077 |
| 23 | Ga0065714_10133079 | 3300005288 | Bacteria | 1233 |
| 24 | Ga0065714_10160415 | 3300005288 | Bacteria | 1055 |
| 25 | Ga0065714_10377063 | 3300005288 | Bacteria | 610 |
| 26 | Ga0065704_10000205 | 3300005289 | Bacteria | 128899 |
| 27 | Ga0065704_10001103 | 3300005289 | Bacteria | 14777 |
| 28 | Ga0065704_10452199 | 3300005289 | Unclassified | 704 |
| 29 | Ga0070658_10354605 | 3300005327 | Bacteria | 1256 |
| 30 | Ga0070658_10443750 | 3300005327 | Bacteria | 1118 |
| 31 | Ga0070658_10722075 | 3300005327 | Bacteria | 865 |
| 32 | Ga0070676_10001044 | 3300005328 | Bacteria | 13792 |
| 33 | Ga0070683_100017009 | 3300005329 | Bacteria | 6418 |
| 34 | Ga0068869_100825726 | 3300005334 | Bacteria | 798 |
| 35 | Ga0070680_100027670 | 3300005336 | Bacteria | 4542 |
| 36 | Ga0068868_100057225 | 3300005338 | Bacteria | 3080 |
| 37 | Ga0068868_100314091 | 3300005338 | Bacteria | 1334 |
| 38 | Ga0070660_100085767 | 3300005339 | Bacteria | 2477 |
| 39 | Ga0070671_100006487 | 3300005355 | Bacteria | 9356 |
| 40 | Ga0070673_100059670 | 3300005364 | Bacteria | 3021 |
| 41 | Ga0070659_100001238 | 3300005366 | Bacteria | 18539 |
| 42 | Ga0070659_100013744 | 3300005366 | Bacteria | 6036 |
| 43 | Ga0070678_100006783 | 3300005456 | Bacteria | 6748 |
| 44 | Ga0070662_100000252 | 3300005457 | Bacteria | 31682 |
| 45 | Ga0070662_100911318 | 3300005457 | Bacteria | 750 |
| 46 | Ga0070681_10026161 | 3300005458 | Bacteria | 5868 |
| 47 | Ga0068867_100001529 | 3300005459 | Bacteria | 16051 |
| 48 | Ga0070679_100007348 | 3300005530 | Bacteria | 10294 |
| 49 | Ga0070684_100021371 | 3300005535 | Bacteria | 5384 |
| 50 | Ga0068853_100061162 | 3300005539 | Bacteria | 3257 |
| 51 | Ga0068853_100295330 | 3300005539 | Bacteria | 1496 |
| 52 | Ga0068853_100574388 | 3300005539 | Bacteria | 1069 |
| 53 | Ga0070665_100000104 | 3300005548 | Bacteria | 158048 |
| 54 | Ga0068855_100144493 | 3300005563 | Bacteria | 2710 |
| 55 | Ga0068855_100582609 | 3300005563 | Bacteria | 1208 |
| 56 | Ga0068856_100072337 | 3300005614 | Bacteria | 3414 |
| 57 | Ga0068856_101323990 | 3300005614 | Bacteria | 735 |
| 58 | Ga0068856_101335126 | 3300005614 | Bacteria | 732 |
| 59 | Ga0068856_102186328 | 3300005614 | Bacteria | 562 |
| 60 | Ga0068852_100013746 | 3300005616 | Bacteria | 6204 |
| 61 | Ga0068866_10044794 | 3300005718 | Bacteria | 2215 |
| 62 | Ga0068866_10061095 | 3300005718 | Bacteria | 1956 |
| 63 | Ga0068870_10203246 | 3300005840 | Bacteria | 1202 |
| 64 | Ga0068858_100639032 | 3300005842 | Bacteria | 1034 |
| 65 | Ga0068860_100309682 | 3300005843 | Bacteria | 1548 |
| 66 | Ga0075366_10034894 | 3300006195 | Bacteria | 2964 |
| 67 | Ga0075366_10106066 | 3300006195 | Bacteria | 1689 |
| 68 | Ga0097621_100000212 | 3300006237 | Bacteria | 38270 |
| 69 | Ga0068871_100004872 | 3300006358 | Bacteria | 9375 |
| 70 | Ga0068871_100740009 | 3300006358 | Bacteria | 903 |
| 71 | Ga0068865_100000112 | 3300006881 | Bacteria | 41532 |
| 72 | Ga0105240_10003500 | 3300009093 | Bacteria | 24345 |
| 73 | Ga0105240_10047784 | 3300009093 | Bacteria | 5413 |
| 74 | Ga0105240_10082254 | 3300009093 | Bacteria | 3955 |
| 75 | Ga0105240_10623353 | 3300009093 | Bacteria | 1185 |
| 76 | Ga0105240_10886215 | 3300009093 | Bacteria | 961 |
| 77 | Ga0105243_10050413 | 3300009148 | Bacteria | 3288 |
| 78 | Ga0105241_10028975 | 3300009174 | Bacteria | 4127 |
| 79 | Ga0105241_10031065 | 3300009174 | Bacteria | 3996 |
| 80 | Ga0105242_10466662 | 3300009176 | Bacteria | 1193 |
| 81 | Ga0105237_10004270 | 3300009545 | Bacteria | 16609 |
| 82 | Ga0105237_10008194 | 3300009545 | Bacteria | 11352 |
| 83 | Ga0105238_10036611 | 3300009551 | Bacteria | 4990 |
| 84 | Ga0105239_10001049 | 3300010375 | Bacteria | 38505 |
| 85 | Ga0105239_10017596 | 3300010375 | Bacteria | 7905 |
| 86 | Ga0105239_10490952 | 3300010375 | Bacteria | 1396 |
| 87 | Ga0105239_10798403 | 3300010375 | Bacteria | 1081 |
| 88 | Ga0105246_10033878 | 3300011119 | Bacteria | 3398 |
| 89 | Ga0105246_10234598 | 3300011119 | Bacteria | 1447 |
| 90 | Ga0157373_10000188 | 3300013100 | Bacteria | 50875 |
| 91 | Ga0157373_10006545 | 3300013100 | Bacteria | 8692 |
| 92 | Ga0157373_10010113 | 3300013100 | Bacteria | 6949 |
| 93 | Ga0157373_10053576 | 3300013100 | Unclassified | 2868 |
| 94 | Ga0157371_10010487 | 3300013102 | Bacteria | 7211 |
| 95 | Ga0157371_10010623 | 3300013102 | Bacteria | 7152 |
| 96 | Ga0157371_10017586 | 3300013102 | Bacteria | 5307 |
| 97 | Ga0157370_10004633 | 3300013104 | Bacteria | 15727 |
| 98 | Ga0157370_10026887 | 3300013104 | Bacteria | 5676 |
| 99 | Ga0157370_10043483 | 3300013104 | Bacteria | 4323 |
| 100 | Ga0157370_10064496 | 3300013104 | Bacteria | 3468 |
| 101 | Ga0157370_10150455 | 3300013104 | Bacteria | 2166 |
| 102 | Ga0157370_10192127 | 3300013104 | Bacteria | 1895 |
| 103 | Ga0157370_10399386 | 3300013104 | Bacteria | 1265 |
| 104 | Ga0157370_10435137 | 3300013104 | Bacteria | 1206 |
| 105 | Ga0157369_10111482 | 3300013105 | Bacteria | 2907 |
| 106 | Ga0157369_10114572 | 3300013105 | Bacteria | 2863 |
| 107 | Ga0157369_10970391 | 3300013105 | Bacteria | 871 |
| 108 | Ga0157374_10000408 | 3300013296 | Bacteria | 38980 |
| 109 | Ga0157374_10000618 | 3300013296 | Bacteria | 31268 |
| 110 | Ga0157374_10655561 | 3300013296 | Bacteria | 1062 |
| 111 | Ga0157374_11049740 | 3300013296 | Bacteria | 835 |
| 112 | Ga0157378_10077124 | 3300013297 | Bacteria | 3004 |
| 113 | Ga0157378_10285850 | 3300013297 | Bacteria | 1591 |
| 114 | Ga0157378_10603155 | 3300013297 | Bacteria | 1109 |
| 115 | Ga0163162_10000034 | 3300013306 | Bacteria | 149611 |
| 116 | Ga0163162_10002037 | 3300013306 | Bacteria | 19017 |
| 117 | Ga0163162_10017250 | 3300013306 | Bacteria | 7063 |
| 118 | Ga0163162_10020734 | 3300013306 | Bacteria | 6461 |
| 119 | Ga0163162_11520051 | 3300013306 | Bacteria | 763 |
| 120 | Ga0157372_10000458 | 3300013307 | Bacteria | 44772 |
| 121 | Ga0157372_10002874 | 3300013307 | Bacteria | 18616 |
| 122 | Ga0157372_10143418 | 3300013307 | Bacteria | 2754 |
| 123 | Ga0157372_10185310 | 3300013307 | Bacteria | 2410 |
| 124 | Ga0157372_10421767 | 3300013307 | Bacteria | 1555 |
| 125 | Ga0157375_10472158 | 3300013308 | Bacteria | 1420 |
| 126 | Ga0182008_10000069 | 3300014497 | Bacteria | 82281 |
| 127 | Ga0182008_10000247 | 3300014497 | Bacteria | 41952 |
| 128 | Ga0182008_10011758 | 3300014497 | Bacteria | 4645 |
| 129 | Ga0182008_10017588 | 3300014497 | Bacteria | 3708 |
| 130 | Ga0182008_10036578 | 3300014497 | Bacteria | 2457 |
| 131 | Ga0182008_10424206 | 3300014497 | Bacteria | 719 |
| 132 | Ga0157377_10091612 | 3300014745 | Bacteria | 1796 |
| 133 | Ga0157377_11228668 | 3300014745 | Unclassified | 582 |
| 134 | Ga0157376_10373056 | 3300014969 | Bacteria | 1372 |
| 135 | Ga0182006_1000210 | 3300015261 | Bacteria | 57485 |
| 136 | Ga0182006_1014724 | 3300015261 | Bacteria | 3367 |
| 137 | Ga0182007_10025866 | 3300015262 | Bacteria | 2040 |
| 138 | Ga0182007_10032178 | 3300015262 | Bacteria | 1783 |
| 139 | Ga0182007_10053162 | 3300015262 | Bacteria | 1334 |
| 140 | Ga0163161_10000572 | 3300017792 | Bacteria | 29561 |
| 141 | Ga0163161_10001264 | 3300017792 | Bacteria | 18909 |
| 142 | Ga0163161_10534645 | 3300017792 | Bacteria | 959 |
| 143 | Ga0163161_10646595 | 3300017792 | Bacteria | 876 |
| 144 | Ga0206351_10493462 | 3300020077 | Bacteria | 1396 |
| 145 | Ga0154015_1323683 | 3300020610 | Bacteria | 763 |
| 146 | Ga0209437_100017 | 3300025233 | Bacteria | 694471 |
| 147 | Ga0209026_1001114 | 3300025250 | Bacteria | 12764 |
| 148 | Ga0209026_1001326 | 3300025250 | Bacteria | 11129 |
| 149 | Ga0209676_1000001 | 3300025292 | Bacteria | 1852142 |
| 150 | Ga0209050_1000258 | 3300025298 | Bacteria | 113741 |
| 151 | Ga0207642_10202337 | 3300025899 | Bacteria | 1098 |
| 152 | Ga0207642_10293010 | 3300025899 | Bacteria | 940 |
| 153 | Ga0207647_10000514 | 3300025904 | Bacteria | 30831 |
| 154 | Ga0207645_10000167 | 3300025907 | Bacteria | 52468 |
| 155 | Ga0207705_10143441 | 3300025909 | Unclassified | 1785 |
| 156 | Ga0207705_10288964 | 3300025909 | Bacteria | 1256 |
| 157 | Ga0207705_10653079 | 3300025909 | Unclassified | 818 |
| 158 | Ga0207705_10904668 | 3300025909 | Bacteria | 683 |
| 159 | Ga0207705_10907965 | 3300025909 | Bacteria | 682 |
| 160 | Ga0207654_10055383 | 3300025911 | Bacteria | 2296 |
| 161 | Ga0207654_10076537 | 3300025911 | Bacteria | 2003 |
| 162 | Ga0207707_10037179 | 3300025912 | Bacteria | 4253 |
| 163 | Ga0207695_10007902 | 3300025913 | Bacteria | 13423 |
| 164 | Ga0207695_10015236 | 3300025913 | Bacteria | 9064 |
| 165 | Ga0207695_10198730 | 3300025913 | Bacteria | 1920 |
| 166 | Ga0207695_10876572 | 3300025913 | Bacteria | 777 |
| 167 | Ga0207671_10097149 | 3300025914 | Bacteria | 2227 |
| 168 | Ga0207671_10156151 | 3300025914 | Bacteria | 1765 |
| 169 | Ga0207660_10049661 | 3300025917 | Bacteria | 2976 |
| 170 | Ga0207657_10119968 | 3300025919 | Bacteria | 2164 |
| 171 | Ga0207657_10130747 | 3300025919 | Bacteria | 2057 |
| 172 | Ga0207657_10314686 | 3300025919 | Bacteria | 1239 |
| 173 | Ga0207652_10042546 | 3300025921 | Bacteria | 3867 |
| 174 | Ga0207694_10201311 | 3300025924 | Bacteria | 1620 |
| 175 | Ga0207644_10011082 | 3300025931 | Bacteria | 5955 |
| 176 | Ga0207644_10877155 | 3300025931 | Bacteria | 752 |
| 177 | Ga0207690_10000943 | 3300025932 | Bacteria | 18615 |
| 178 | Ga0207706_10000844 | 3300025933 | Bacteria | 31664 |
| 179 | Ga0207706_10045275 | 3300025933 | Bacteria | 3899 |
| 180 | Ga0207686_10071663 | 3300025934 | Bacteria | 2231 |
| 181 | Ga0207709_10058161 | 3300025935 | Bacteria | 2401 |
| 182 | Ga0207704_10000062 | 3300025938 | Bacteria | 76334 |
| 183 | Ga0207689_10684136 | 3300025942 | Bacteria | 865 |
| 184 | Ga0207661_10041014 | 3300025944 | Bacteria | 3642 |
| 185 | Ga0207667_10744395 | 3300025949 | Bacteria | 980 |
| 186 | Ga0207651_10013233 | 3300025960 | Bacteria | 4711 |
| 187 | Ga0207677_10054475 | 3300026023 | Bacteria | 2730 |
| 188 | Ga0207677_10088954 | 3300026023 | Bacteria | 2241 |
| 189 | Ga0207639_10196050 | 3300026041 | Bacteria | 1729 |
| 190 | Ga0207639_10207436 | 3300026041 | Bacteria | 1685 |
| 191 | Ga0207639_10336385 | 3300026041 | Bacteria | 1345 |
| 192 | Ga0207702_10181201 | 3300026078 | Bacteria | 1940 |
| 193 | Ga0207702_11256018 | 3300026078 | Bacteria | 735 |
| 194 | Ga0207648_10000294 | 3300026089 | Bacteria | 54322 |
| 195 | Ga0207674_10603612 | 3300026116 | Bacteria | 1060 |
| 196 | Ga0207674_11435330 | 3300026116 | Bacteria | 659 |
| 197 | Ga0207683_10014312 | 3300026121 | Bacteria | 6759 |
| 198 | Ga0207698_10447463 | 3300026142 | Bacteria | 1246 |
| 199 | Ga0268266_10000108 | 3300028379 | Bacteria | 171915 |
| 200 | Ga0268264_11264342 | 3300028381 | Bacteria | 748 |
| 201 | Ga0307517_10013924 | 3300028786 | Bacteria | 10867 |
| 202 | Ga0307515_10104435 | 3300028794 | Bacteria | 3385 |
| 203 | Ga0307515_10132717 | 3300028794 | Bacteria | 2730 |
| 204 | Ga0307515_10884040 | 3300028794 | Unclassified | 523 |
| 205 | Ga0265338_10098101 | 3300028800 | Bacteria | 2398 |
| 206 | Ga0316177_1174560 | 3300030731 | Bacteria | 5757 |
| 207 | Ga0307513_10360482 | 3300031456 | Bacteria | 1199 |
| 208 | Ga0307412_10000004 | 3300031911 | Bacteria | 544053 |
| 209 | Ga0307412_12116726 | 3300031911 | Bacteria | 523 |
| 210 | Ga0307414_10000477 | 3300032004 | Bacteria | 20980 |
| 211 | Ga0307414_10007084 | 3300032004 | Bacteria | 6289 |
| 212 | Ga0307414_10023212 | 3300032004 | Bacteria | 3930 |
| 213 | Ga0307414_10073531 | 3300032004 | Bacteria | 2473 |
| 214 | Ga0307414_10330909 | 3300032004 | Unclassified | 1300 |
| 215 | Ga0307414_11952521 | 3300032004 | Bacteria | 548 |
| 216 | Ga0307510_10007852 | 3300033180 | Bacteria | 12715 |
| 217 | Ga0395899_0000912 | 3300037312 | Bacteria | 27790 |
| 218 | Ga0395900_0000585 | 3300037418 | Bacteria | 50049 |
| 219 | Ga0395900_0000626 | 3300037418 | Bacteria | 47534 |
| 220 | Ga0395900_0346046 | 3300037418 | Bacteria | 1461 |
| 221 | Ga0395905_0002809 | 3300037471 | Bacteria | 19078 |
| 222 | Ga0395901_0001558 | 3300038443 | Bacteria | 23767 |
| 223 | Ga0451802_1214773 | 3300041460 | Unclassified | 783 |
| 224 | Ga0451806_135767 | 3300041462 | Bacteria | 520 |
| 225 | Ga0451807_0459631 | 3300041486 | Unclassified | 569 |
| 226 | Ga0451807_0846600 | 3300041486 | Bacteria | 1104 |
| 227 | Ga0495650_0000003 | 3300046471 | Bacteria | 900730 |
| 228 | Ga0495650_0117240 | 3300046471 | Bacteria | 983 |
| 229 | Ga0495585_0000136 | 3300046492 | Bacteria | 79721 |
| 230 | Ga0495607_0399980 | 3300046501 | Bacteria | 625 |
| 231 | Ga0495583_0059342 | 3300046506 | Bacteria | 1715 |
| 232 | Ga0495606_0000002 | 3300046507 | Bacteria | 554637 |
| 233 | Ga0495610_0005035 | 3300046512 | Bacteria | 9548 |
| 234 | Ga0495616_0005731 | 3300046513 | Bacteria | 7607 |
| 235 | Ga0495632_0055794 | 3300046519 | Bacteria | 1933 |
| 236 | Ga0495644_0040886 | 3300046523 | Bacteria | 1747 |
| 237 | Ga0495609_0048802 | 3300046538 | Bacteria | 1890 |
| 238 | Ga0495668_0091089 | 3300046616 | Bacteria | 1671 |
| 239 | Ga0495625_0000005 | 3300046660 | Bacteria | 596135 |
| 240 | Ga0495625_0479191 | 3300046660 | Bacteria | 764 |
| 241 | Ga0495661_0000244 | 3300046665 | Bacteria | 62633 |
| 242 | Ga0495661_0022796 | 3300046665 | Bacteria | 4070 |
| 243 | Ga0495670_0243873 | 3300046691 | Bacteria | 957 |
| 244 | Ga0495671_0644701 | 3300046692 | Bacteria | 503 |
| 245 | Ga0495649_0000003 | 3300046694 | Bacteria | 880817 |
| 246 | Ga0495683_0113264 | 3300047323 | Bacteria | 1293 |
| 247 | Ga0495687_000544 | 3300047443 | Bacteria | 45065 |
| 248 | Ga0495687_003544 | 3300047443 | Bacteria | 11232 |
| 249 | Ga0495686_0015810 | 3300047472 | Bacteria | 5136 |
| 250 | Ga0495686_0082950 | 3300047472 | Bacteria | 1956 |
| 251 | Ga0495686_0105630 | 3300047472 | Bacteria | 1694 |
| 252 | Ga0496115_0090359 | 3300048918 | Bacteria | 2502 |
| 253 | Ga0496122_0001629 | 3300048925 | Bacteria | 35029 |
| 254 | Ga0496123_0000906 | 3300048926 | Bacteria | 46669 |
| 255 | Ga0496125_0045231 | 3300048928 | Bacteria | 3709 |
| 256 | Ga0501241_130684 | 3300049758 | Unclassified | 565 |
| 257 | nmdc:mga0k408_121631_c1 | 3300050493 | Bacteria | 1546 |
| 258 | nmdc:mga0k408_469311_c1 | 3300050493 | Bacteria | 747 |
| 259 | Ga0500651_0000207 | 3300053093 | Bacteria | 36951 |
| 260 | Ga0500569_090926 | 3300053109 | Bacteria | 989 |
| 261 | Ga0500608_001289 | 3300053122 | Bacteria | 8921 |
| 262 | Ga0500618_048544 | 3300053125 | Bacteria | 964 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2599185184 | 2599477970 | 127 |
| 2 | iso_pu_bacteria | 2857627736 | 2857630176 | 127 |
| 3 | iso_pu_bacteria | 2928078545 | 2928079931 | 127 |
| 4 | iso_pu_bacteria | 2928147474 | 2928147614 | 127 |
| 5 | iso_pu_bacteria | 2932082852 | 2932083628 | 127 |
| 6 | iso_pu_bacteria | 2585427687 | 2586211026 | 128 |
| 7 | iso_pu_bacteria | 2738541283 | 2738754292 | 128 |
| 8 | iso_pu_bacteria | 2738541284 | 2738762950 | 128 |
| 9 | iso_pu_bacteria | 2738541302 | 2738855777 | 128 |
| 10 | iso_pu_bacteria | 2738543023 | 2739301651 | 128 |
| 11 | iso_pu_bacteria | 2739367651 | 2739590173 | 128 |
| 12 | iso_pu_bacteria | 2739367656 | 2739615395 | 128 |
| 13 | iso_pu_bacteria | 2739367663 | 2739644400 | 128 |
| 14 | iso_pu_bacteria | 2775506987 | 2776614558 | 128 |
| 15 | iso_pu_bacteria | 2818991437 | 2819548443 | 128 |
| 16 | iso_pu_bacteria | 2842909656 | 2842913945 | 128 |
| 17 | iso_pu_bacteria | 2849281842 | 2849283688 | 128 |
| 18 | iso_pu_bacteria | 2852627209 | 2852627688 | 128 |
| 19 | iso_pu_bacteria | 2896344016 | 2896344125 | 128 |
| 20 | iso_pu_bacteria | 2898713307 | 2898715275 | 128 |
| 21 | iso_pu_bacteria | 2902048731 | 2902053055 | 128 |
| 22 | iso_pu_bacteria | 2919186247 | 2919187859 | 128 |
| 23 | iso_pu_bacteria | 2939664404 | 2939664874 | 128 |
| 24 | iso_pu_bacteria | 2954016120 | 2954016564 | 128 |
| 25 | 3300013296 | Ga0157374_11049740 | Ga0157374_110497402 | 130 |
| 26 | 3300001989 | JGI24739J22299_10061357 | JGI24739J22299_100613572 | 131 |
| 27 | 3300001990 | JGI24737J22298_10002356 | JGI24737J22298_1000235610 | 131 |
| 28 | 3300002067 | JGI24735J21928_10000050 | JGI24735J21928_1000005012 | 131 |
| 29 | 3300002737 | JGI25162J39368_1000011 | JGI25162J39368_1000011173 | 131 |
| 30 | 3300002741 | JGI25157J39369_1002605 | JGI25157J39369_10026056 | 131 |
| 31 | 3300003316 | rootH1_10055881 | rootH1_100558812 | 131 |
| 32 | 3300003320 | rootH2_10002871 | rootH2_100028717 | 131 |
| 33 | 3300003320 | rootH2_10221640 | rootH2_102216402 | 131 |
| 34 | 3300003322 | rootL2_10078357 | rootL2_100783571 | 131 |
| 35 | 3300003323 | rootH1_10024269 | rootH1_100242693 | 131 |
| 36 | 3300003323 | rootH1_10218449 | rootH1_102184492 | 131 |
| 37 | 3300003323 | rootH1_10245167 | rootH1_102451672 | 131 |
| 38 | 3300004799 | Ga0058863_10595060 | Ga0058863_105950601 | 131 |
| 39 | 3300005288 | Ga0065714_10133079 | Ga0065714_101330791 | 131 |
| 40 | 3300005288 | Ga0065714_10377063 | Ga0065714_103770631 | 131 |
| 41 | 3300005327 | Ga0070658_10354605 | Ga0070658_103546052 | 131 |
| 42 | 3300005327 | Ga0070658_10443750 | Ga0070658_104437502 | 131 |
| 43 | 3300005327 | Ga0070658_10722075 | Ga0070658_107220751 | 131 |
| 44 | 3300005328 | Ga0070676_10001044 | Ga0070676_1000104411 | 131 |
| 45 | 3300005329 | Ga0070683_100017009 | Ga0070683_1000170097 | 131 |
| 46 | 3300005334 | Ga0068869_100825726 | Ga0068869_1008257261 | 131 |
| 47 | 3300005336 | Ga0070680_100027670 | Ga0070680_1000276703 | 131 |
| 48 | 3300005338 | Ga0068868_100057225 | Ga0068868_1000572252 | 131 |
| 49 | 3300005338 | Ga0068868_100314091 | Ga0068868_1003140912 | 131 |
| 50 | 3300005339 | Ga0070660_100085767 | Ga0070660_1000857674 | 131 |
| 51 | 3300005355 | Ga0070671_100006487 | Ga0070671_1000064879 | 131 |
| 52 | 3300005364 | Ga0070673_100059670 | Ga0070673_1000596703 | 131 |
| 53 | 3300005366 | Ga0070659_100001238 | Ga0070659_10000123816 | 131 |
| 54 | 3300005366 | Ga0070659_100013744 | Ga0070659_1000137442 | 131 |
| 55 | 3300005456 | Ga0070678_100006783 | Ga0070678_1000067833 | 131 |
| 56 | 3300005457 | Ga0070662_100000252 | Ga0070662_1000002524 | 131 |
| 57 | 3300005457 | Ga0070662_100911318 | Ga0070662_1009113181 | 131 |
| 58 | 3300005458 | Ga0070681_10026161 | Ga0070681_100261613 | 131 |
| 59 | 3300005459 | Ga0068867_100001529 | Ga0068867_10000152912 | 131 |
| 60 | 3300005530 | Ga0070679_100007348 | Ga0070679_1000073484 | 131 |
| 61 | 3300005535 | Ga0070684_100021371 | Ga0070684_1000213717 | 131 |
| 62 | 3300005539 | Ga0068853_100061162 | Ga0068853_1000611622 | 131 |
| 63 | 3300005539 | Ga0068853_100295330 | Ga0068853_1002953302 | 131 |
| 64 | 3300005539 | Ga0068853_100574388 | Ga0068853_1005743882 | 131 |
| 65 | 3300005548 | Ga0070665_100000104 | Ga0070665_100000104103 | 131 |
| 66 | 3300005563 | Ga0068855_100144493 | Ga0068855_1001444933 | 131 |
| 67 | 3300005563 | Ga0068855_100582609 | Ga0068855_1005826091 | 131 |
| 68 | 3300005614 | Ga0068856_100072337 | Ga0068856_1000723373 | 131 |
| 69 | 3300005614 | Ga0068856_101323990 | Ga0068856_1013239902 | 131 |
| 70 | 3300005614 | Ga0068856_101335126 | Ga0068856_1013351261 | 131 |
| 71 | 3300005614 | Ga0068856_102186328 | Ga0068856_1021863281 | 131 |
| 72 | 3300005616 | Ga0068852_100013746 | Ga0068852_1000137466 | 131 |
| 73 | 3300005718 | Ga0068866_10044794 | Ga0068866_100447942 | 131 |
| 74 | 3300005718 | Ga0068866_10061095 | Ga0068866_100610953 | 131 |
| 75 | 3300005840 | Ga0068870_10203246 | Ga0068870_102032462 | 131 |
| 76 | 3300005842 | Ga0068858_100639032 | Ga0068858_1006390321 | 131 |
| 77 | 3300005843 | Ga0068860_100309682 | Ga0068860_1003096822 | 131 |
| 78 | 3300006195 | Ga0075366_10034894 | Ga0075366_100348943 | 131 |
| 79 | 3300006195 | Ga0075366_10106066 | Ga0075366_101060662 | 131 |
| 80 | 3300006237 | Ga0097621_100000212 | Ga0097621_10000021234 | 131 |
| 81 | 3300006358 | Ga0068871_100004872 | Ga0068871_1000048726 | 131 |
| 82 | 3300006358 | Ga0068871_100740009 | Ga0068871_1007400091 | 131 |
| 83 | 3300006881 | Ga0068865_100000112 | Ga0068865_1000001126 | 131 |
| 84 | 3300009093 | Ga0105240_10003500 | Ga0105240_1000350012 | 131 |
| 85 | 3300009093 | Ga0105240_10047784 | Ga0105240_100477845 | 131 |
| 86 | 3300009093 | Ga0105240_10082254 | Ga0105240_100822542 | 131 |
| 87 | 3300009093 | Ga0105240_10623353 | Ga0105240_106233532 | 131 |
| 88 | 3300009093 | Ga0105240_10886215 | Ga0105240_108862152 | 131 |
| 89 | 3300009148 | Ga0105243_10050413 | Ga0105243_100504133 | 131 |
| 90 | 3300009174 | Ga0105241_10028975 | Ga0105241_100289755 | 131 |
| 91 | 3300009174 | Ga0105241_10031065 | Ga0105241_100310652 | 131 |
| 92 | 3300009176 | Ga0105242_10466662 | Ga0105242_104666621 | 131 |
| 93 | 3300009545 | Ga0105237_10008194 | Ga0105237_1000819410 | 131 |
| 94 | 3300009551 | Ga0105238_10036611 | Ga0105238_100366114 | 131 |
| 95 | 3300010375 | Ga0105239_10001049 | Ga0105239_100010492 | 131 |
| 96 | 3300010375 | Ga0105239_10017596 | Ga0105239_100175963 | 131 |
| 97 | 3300010375 | Ga0105239_10490952 | Ga0105239_104909522 | 131 |
| 98 | 3300010375 | Ga0105239_10798403 | Ga0105239_107984031 | 131 |
| 99 | 3300011119 | Ga0105246_10033878 | Ga0105246_100338786 | 131 |
| 100 | 3300011119 | Ga0105246_10234598 | Ga0105246_102345982 | 131 |
| 101 | 3300013100 | Ga0157373_10000188 | Ga0157373_1000018831 | 131 |
| 102 | 3300013102 | Ga0157371_10017586 | Ga0157371_100175867 | 131 |
| 103 | 3300013104 | Ga0157370_10043483 | Ga0157370_100434833 | 131 |
| 104 | 3300013105 | Ga0157369_10114572 | Ga0157369_101145722 | 131 |
| 105 | 3300013105 | Ga0157369_10970391 | Ga0157369_109703911 | 131 |
| 106 | 3300013296 | Ga0157374_10000408 | Ga0157374_1000040834 | 131 |
| 107 | 3300013296 | Ga0157374_10000618 | Ga0157374_1000061832 | 131 |
| 108 | 3300013296 | Ga0157374_10655561 | Ga0157374_106555612 | 131 |
| 109 | 3300013297 | Ga0157378_10077124 | Ga0157378_100771244 | 131 |
| 110 | 3300013297 | Ga0157378_10285850 | Ga0157378_102858503 | 131 |
| 111 | 3300013297 | Ga0157378_10603155 | Ga0157378_106031552 | 131 |
| 112 | 3300013306 | Ga0163162_10000034 | Ga0163162_1000003467 | 131 |
| 113 | 3300013306 | Ga0163162_10002037 | Ga0163162_1000203722 | 131 |
| 114 | 3300013306 | Ga0163162_10017250 | Ga0163162_1001725010 | 131 |
| 115 | 3300013307 | Ga0157372_10000458 | Ga0157372_1000045827 | 131 |
| 116 | 3300013307 | Ga0157372_10002874 | Ga0157372_1000287418 | 131 |
| 117 | 3300013307 | Ga0157372_10143418 | Ga0157372_101434183 | 131 |
| 118 | 3300013307 | Ga0157372_10185310 | Ga0157372_101853102 | 131 |
| 119 | 3300013307 | Ga0157372_10421767 | Ga0157372_104217672 | 131 |
| 120 | 3300013308 | Ga0157375_10472158 | Ga0157375_104721582 | 131 |
| 121 | 3300014745 | Ga0157377_10091612 | Ga0157377_100916122 | 131 |
| 122 | 3300014745 | Ga0157377_11228668 | Ga0157377_112286681 | 131 |
| 123 | 3300014969 | Ga0157376_10373056 | Ga0157376_103730562 | 131 |
| 124 | 3300015262 | Ga0182007_10025866 | Ga0182007_100258661 | 131 |
| 125 | 3300020077 | Ga0206351_10493462 | Ga0206351_104934621 | 131 |
| 126 | 3300020610 | Ga0154015_1323683 | Ga0154015_13236832 | 131 |
| 127 | 3300025233 | Ga0209437_100017 | Ga0209437_100017336 | 131 |
| 128 | 3300025250 | Ga0209026_1001114 | Ga0209026_10011146 | 131 |
| 129 | 3300025250 | Ga0209026_1001326 | Ga0209026_10013267 | 131 |
| 130 | 3300025899 | Ga0207642_10202337 | Ga0207642_102023372 | 131 |
| 131 | 3300025899 | Ga0207642_10293010 | Ga0207642_102930102 | 131 |
| 132 | 3300025904 | Ga0207647_10000514 | Ga0207647_100005144 | 131 |
| 133 | 3300025907 | Ga0207645_10000167 | Ga0207645_1000016736 | 131 |
| 134 | 3300025909 | Ga0207705_10143441 | Ga0207705_101434412 | 131 |
| 135 | 3300025909 | Ga0207705_10288964 | Ga0207705_102889641 | 131 |
| 136 | 3300025909 | Ga0207705_10653079 | Ga0207705_106530792 | 131 |
| 137 | 3300025909 | Ga0207705_10904668 | Ga0207705_109046681 | 131 |
| 138 | 3300025909 | Ga0207705_10907965 | Ga0207705_109079652 | 131 |
| 139 | 3300025911 | Ga0207654_10055383 | Ga0207654_100553834 | 131 |
| 140 | 3300025911 | Ga0207654_10076537 | Ga0207654_100765372 | 131 |
| 141 | 3300025912 | Ga0207707_10037179 | Ga0207707_100371793 | 131 |
| 142 | 3300025913 | Ga0207695_10007902 | Ga0207695_1000790215 | 131 |
| 143 | 3300025913 | Ga0207695_10015236 | Ga0207695_100152369 | 131 |
| 144 | 3300025913 | Ga0207695_10198730 | Ga0207695_101987302 | 131 |
| 145 | 3300025913 | Ga0207695_10876572 | Ga0207695_108765722 | 131 |
| 146 | 3300025914 | Ga0207671_10156151 | Ga0207671_101561512 | 131 |
| 147 | 3300025917 | Ga0207660_10049661 | Ga0207660_100496612 | 131 |
| 148 | 3300025919 | Ga0207657_10119968 | Ga0207657_101199684 | 131 |
| 149 | 3300025919 | Ga0207657_10130747 | Ga0207657_101307473 | 131 |
| 150 | 3300025919 | Ga0207657_10314686 | Ga0207657_103146862 | 131 |
| 151 | 3300025921 | Ga0207652_10042546 | Ga0207652_100425463 | 131 |
| 152 | 3300025924 | Ga0207694_10201311 | Ga0207694_102013113 | 131 |
| 153 | 3300025931 | Ga0207644_10011082 | Ga0207644_100110827 | 131 |
| 154 | 3300025931 | Ga0207644_10877155 | Ga0207644_108771552 | 131 |
| 155 | 3300025932 | Ga0207690_10000943 | Ga0207690_1000094311 | 131 |
| 156 | 3300025933 | Ga0207706_10000844 | Ga0207706_1000084431 | 131 |
| 157 | 3300025933 | Ga0207706_10045275 | Ga0207706_100452753 | 131 |
| 158 | 3300025934 | Ga0207686_10071663 | Ga0207686_100716632 | 131 |
| 159 | 3300025935 | Ga0207709_10058161 | Ga0207709_100581612 | 131 |
| 160 | 3300025938 | Ga0207704_10000062 | Ga0207704_1000006249 | 131 |
| 161 | 3300025942 | Ga0207689_10684136 | Ga0207689_106841362 | 131 |
| 162 | 3300025944 | Ga0207661_10041014 | Ga0207661_100410146 | 131 |
| 163 | 3300025949 | Ga0207667_10744395 | Ga0207667_107443952 | 131 |
| 164 | 3300025960 | Ga0207651_10013233 | Ga0207651_100132334 | 131 |
| 165 | 3300026023 | Ga0207677_10054475 | Ga0207677_100544754 | 131 |
| 166 | 3300026023 | Ga0207677_10088954 | Ga0207677_100889543 | 131 |
| 167 | 3300026041 | Ga0207639_10196050 | Ga0207639_101960502 | 131 |
| 168 | 3300026041 | Ga0207639_10207436 | Ga0207639_102074362 | 131 |
| 169 | 3300026041 | Ga0207639_10336385 | Ga0207639_103363852 | 131 |
| 170 | 3300026078 | Ga0207702_10181201 | Ga0207702_101812013 | 131 |
| 171 | 3300026078 | Ga0207702_11256018 | Ga0207702_112560181 | 131 |
| 172 | 3300026089 | Ga0207648_10000294 | Ga0207648_1000029410 | 131 |
| 173 | 3300026116 | Ga0207674_10603612 | Ga0207674_106036122 | 131 |
| 174 | 3300026116 | Ga0207674_11435330 | Ga0207674_114353301 | 131 |
| 175 | 3300026121 | Ga0207683_10014312 | Ga0207683_100143127 | 131 |
| 176 | 3300026142 | Ga0207698_10447463 | Ga0207698_104474633 | 131 |
| 177 | 3300028379 | Ga0268266_10000108 | Ga0268266_1000010899 | 131 |
| 178 | 3300028381 | Ga0268264_11264342 | Ga0268264_112643422 | 131 |
| 179 | 3300028786 | Ga0307517_10013924 | Ga0307517_1001392410 | 131 |
| 180 | 3300028794 | Ga0307515_10104435 | Ga0307515_101044355 | 131 |
| 181 | 3300028794 | Ga0307515_10884040 | Ga0307515_108840401 | 131 |
| 182 | 3300028800 | Ga0265338_10098101 | Ga0265338_100981012 | 131 |
| 183 | 3300031911 | Ga0307412_12116726 | Ga0307412_121167261 | 131 |
| 184 | 3300032004 | Ga0307414_10330909 | Ga0307414_103309092 | 131 |
| 185 | 3300033180 | Ga0307510_10007852 | Ga0307510_100078527 | 131 |
| 186 | 3300037312 | Ga0395899_0000912 | Ga0395899_0000912_2581_2976 | 131 |
| 187 | 3300037418 | Ga0395900_0000585 | Ga0395900_0000585_28868_29263 | 131 |
| 188 | 3300037418 | Ga0395900_0000626 | Ga0395900_0000626_26643_27038 | 131 |
| 189 | 3300037418 | Ga0395900_0346046 | Ga0395900_0346046_975_1370 | 131 |
| 190 | 3300037471 | Ga0395905_0002809 | Ga0395905_0002809_1888_2283 | 131 |
| 191 | 3300038443 | Ga0395901_0001558 | Ga0395901_0001558_2875_3270 | 131 |
| 192 | 3300041460 | Ga0451802_1214773 | Ga0451802_1214773_133_528 | 131 |
| 193 | 3300041486 | Ga0451807_0459631 | Ga0451807_0459631_63_458 | 131 |
| 194 | 3300046471 | Ga0495650_0000003 | Ga0495650_0000003_191666_192061 | 131 |
| 195 | 3300046471 | Ga0495650_0117240 | Ga0495650_0117240_209_604 | 131 |
| 196 | 3300046492 | Ga0495585_0000136 | Ga0495585_0000136_2697_3092 | 131 |
| 197 | 3300046506 | Ga0495583_0059342 | Ga0495583_0059342_536_931 | 131 |
| 198 | 3300046507 | Ga0495606_0000002 | Ga0495606_0000002_526547_526942 | 131 |
| 199 | 3300046512 | Ga0495610_0005035 | Ga0495610_0005035_3619_4014 | 131 |
| 200 | 3300046513 | Ga0495616_0005731 | Ga0495616_0005731_2706_3101 | 131 |
| 201 | 3300046519 | Ga0495632_0055794 | Ga0495632_0055794_275_670 | 131 |
| 202 | 3300046523 | Ga0495644_0040886 | Ga0495644_0040886_229_630 | 131 |
| 203 | 3300046616 | Ga0495668_0091089 | Ga0495668_0091089_902_1297 | 131 |
| 204 | 3300046660 | Ga0495625_0000005 | Ga0495625_0000005_308682_309077 | 131 |
| 205 | 3300046660 | Ga0495625_0479191 | Ga0495625_0479191_283_678 | 131 |
| 206 | 3300046665 | Ga0495661_0000244 | Ga0495661_0000244_41257_41655 | 131 |
| 207 | 3300046665 | Ga0495661_0022796 | Ga0495661_0022796_3017_3412 | 131 |
| 208 | 3300046691 | Ga0495670_0243873 | Ga0495670_0243873_456_857 | 131 |
| 209 | 3300046692 | Ga0495671_0644701 | Ga0495671_0644701_94_489 | 131 |
| 210 | 3300046694 | Ga0495649_0000003 | Ga0495649_0000003_308670_309065 | 131 |
| 211 | 3300047323 | Ga0495683_0113264 | Ga0495683_0113264_852_1247 | 131 |
| 212 | 3300047443 | Ga0495687_000544 | Ga0495687_000544_25350_25745 | 131 |
| 213 | 3300047443 | Ga0495687_003544 | Ga0495687_003544_8131_8526 | 131 |
| 214 | 3300047472 | Ga0495686_0015810 | Ga0495686_0015810_3167_3562 | 131 |
| 215 | 3300047472 | Ga0495686_0082950 | Ga0495686_0082950_839_1234 | 131 |
| 216 | 3300047472 | Ga0495686_0105630 | Ga0495686_0105630_1134_1529 | 131 |
| 217 | 3300049758 | Ga0501241_130684 | Ga0501241_130684_50_445 | 131 |
| 218 | 3300050493 | nmdc:mga0k408_121631_c1 | nmdc:mga0k408_121631_c1_212_607 | 131 |
| 219 | 3300050493 | nmdc:mga0k408_469311_c1 | nmdc:mga0k408_469311_c1_256_651 | 131 |
| 220 | 3300053109 | Ga0500569_090926 | Ga0500569_090926_49_444 | 131 |
| 221 | 3300053122 | Ga0500608_001289 | Ga0500608_001289_8323_8718 | 131 |
| 222 | 3300053125 | Ga0500618_048544 | Ga0500618_048544_314_709 | 131 |
| 223 | 2162886007 | SwRhRL2b_contig_475676 | SwRhRL2b_0167.00008660 | 132 |
| 224 | 3300002773 | JGI25152J39213_1000476 | JGI25152J39213_100047615 | 132 |
| 225 | 3300003781 | Ga0055536_1000049 | Ga0055536_100004972 | 132 |
| 226 | 3300003791 | Ga0055530_10049206 | Ga0055530_100492062 | 132 |
| 227 | 3300005288 | Ga0065714_10002298 | Ga0065714_1000229822 | 132 |
| 228 | 3300005288 | Ga0065714_10002621 | Ga0065714_1000262111 | 132 |
| 229 | 3300005288 | Ga0065714_10004463 | Ga0065714_100044633 | 132 |
| 230 | 3300005288 | Ga0065714_10006411 | Ga0065714_100064112 | 132 |
| 231 | 3300005288 | Ga0065714_10087017 | Ga0065714_100870172 | 132 |
| 232 | 3300005288 | Ga0065714_10160415 | Ga0065714_101604152 | 132 |
| 233 | 3300005289 | Ga0065704_10000205 | Ga0065704_100002058 | 132 |
| 234 | 3300005289 | Ga0065704_10001103 | Ga0065704_100011033 | 132 |
| 235 | 3300005289 | Ga0065704_10452199 | Ga0065704_104521991 | 132 |
| 236 | 3300009545 | Ga0105237_10004270 | Ga0105237_100042703 | 132 |
| 237 | 3300013100 | Ga0157373_10006545 | Ga0157373_100065453 | 132 |
| 238 | 3300013100 | Ga0157373_10010113 | Ga0157373_100101138 | 132 |
| 239 | 3300013100 | Ga0157373_10053576 | Ga0157373_100535762 | 132 |
| 240 | 3300013102 | Ga0157371_10010487 | Ga0157371_100104876 | 132 |
| 241 | 3300013102 | Ga0157371_10010623 | Ga0157371_100106234 | 132 |
| 242 | 3300013104 | Ga0157370_10004633 | Ga0157370_100046336 | 132 |
| 243 | 3300013104 | Ga0157370_10026887 | Ga0157370_100268871 | 132 |
| 244 | 3300013104 | Ga0157370_10064496 | Ga0157370_100644962 | 132 |
| 245 | 3300013104 | Ga0157370_10150455 | Ga0157370_101504552 | 132 |
| 246 | 3300013104 | Ga0157370_10192127 | Ga0157370_101921274 | 132 |
| 247 | 3300013104 | Ga0157370_10399386 | Ga0157370_103993862 | 132 |
| 248 | 3300013104 | Ga0157370_10435137 | Ga0157370_104351372 | 132 |
| 249 | 3300013105 | Ga0157369_10111482 | Ga0157369_101114824 | 132 |
| 250 | 3300013306 | Ga0163162_10020734 | Ga0163162_100207345 | 132 |
| 251 | 3300013306 | Ga0163162_11520051 | Ga0163162_115200512 | 132 |
| 252 | 3300014497 | Ga0182008_10000069 | Ga0182008_1000006954 | 132 |
| 253 | 3300014497 | Ga0182008_10000247 | Ga0182008_100002476 | 132 |
| 254 | 3300014497 | Ga0182008_10011758 | Ga0182008_100117581 | 132 |
| 255 | 3300014497 | Ga0182008_10017588 | Ga0182008_100175885 | 132 |
| 256 | 3300014497 | Ga0182008_10036578 | Ga0182008_100365782 | 132 |
| 257 | 3300014497 | Ga0182008_10424206 | Ga0182008_104242062 | 132 |
| 258 | 3300015261 | Ga0182006_1000210 | Ga0182006_100021046 | 132 |
| 259 | 3300015261 | Ga0182006_1014724 | Ga0182006_10147243 | 132 |
| 260 | 3300015262 | Ga0182007_10032178 | Ga0182007_100321782 | 132 |
| 261 | 3300015262 | Ga0182007_10053162 | Ga0182007_100531622 | 132 |
| 262 | 3300017792 | Ga0163161_10000572 | Ga0163161_1000057212 | 132 |
| 263 | 3300017792 | Ga0163161_10001264 | Ga0163161_1000126418 | 132 |
| 264 | 3300017792 | Ga0163161_10534645 | Ga0163161_105346451 | 132 |
| 265 | 3300017792 | Ga0163161_10646595 | Ga0163161_106465951 | 132 |
| 266 | 3300025292 | Ga0209676_1000001 | Ga0209676_100000127 | 132 |
| 267 | 3300025298 | Ga0209050_1000258 | Ga0209050_100025872 | 132 |
| 268 | 3300025914 | Ga0207671_10097149 | Ga0207671_100971494 | 132 |
| 269 | 3300028794 | Ga0307515_10132717 | Ga0307515_101327173 | 132 |
| 270 | 3300030731 | Ga0316177_1174560 | Ga0316177_11745602 | 132 |
| 271 | 3300031456 | Ga0307513_10360482 | Ga0307513_103604822 | 132 |
| 272 | 3300031911 | Ga0307412_10000004 | Ga0307412_10000004364 | 132 |
| 273 | 3300032004 | Ga0307414_10000477 | Ga0307414_1000047713 | 132 |
| 274 | 3300032004 | Ga0307414_10007084 | Ga0307414_100070841 | 132 |
| 275 | 3300032004 | Ga0307414_10023212 | Ga0307414_100232122 | 132 |
| 276 | 3300032004 | Ga0307414_10073531 | Ga0307414_100735312 | 132 |
| 277 | 3300032004 | Ga0307414_11952521 | Ga0307414_119525211 | 132 |
| 278 | 3300041462 | Ga0451806_135767 | Ga0451806_135767_47_445 | 132 |
| 279 | 3300041486 | Ga0451807_0846600 | Ga0451807_0846600_26_424 | 132 |
| 280 | 3300046501 | Ga0495607_0399980 | Ga0495607_0399980_80_478 | 132 |
| 281 | 3300046538 | Ga0495609_0048802 | Ga0495609_0048802_525_923 | 132 |
| 282 | 3300048918 | Ga0496115_0090359 | Ga0496115_0090359_1194_1592 | 132 |
| 283 | 3300048925 | Ga0496122_0001629 | Ga0496122_0001629_63_461 | 132 |
| 284 | 3300048926 | Ga0496123_0000906 | Ga0496123_0000906_45825_46223 | 132 |
| 285 | 3300048928 | Ga0496125_0045231 | Ga0496125_0045231_2999_3397 | 132 |
| 286 | 3300053093 | Ga0500651_0000207 | Ga0500651_0000207_4005_4403 | 132 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cnw-assembly1.cif.gz_A | three-dimensional structure of the protein xoxi (q81ay6) from bacillus cereus. northeast structural genomics consortium target bcr196. | 0.8269 | 1 | 130 |
| 2qpv-assembly1.cif.gz_A | crystal structure of uncharacterized protein atu1531 | 0.8175 | 1 | 131 |
| 3cnw-assembly1.cif.gz_A | three-dimensional structure of the protein xoxi (q81ay6) from bacillus cereus. northeast structural genomics consortium target bcr196. | 0.8104 | 1 | 130 |
| 3f08-assembly1.cif.gz_A | crystal structure of the putative uncharacterized protein q6hg14 from bacilllus thuringiensis. northeast structural genomics consortium target bur153. | 0.8037 | 2 | 130 |
| 7wa9-assembly1.cif.gz_A | crystal structure of msmeg_5634 from mycobacterium smegmatis | 0.7994 | 1 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53961_7_149_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8204 | 4 | 130 | 3.30.530.20 |
| af_I6X666_8_157_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8109 | 2 | 131 | 3.30.530.20 |
| af_P9WJ05_1_142_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.7988 | 1 | 130 | 3.30.530.20 |
| af_B6SQM0_1_154_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.7973 | 2 | 130 | 3.30.530.20 |
| af_P9WLU7_2_142_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.7949 | 2 | 130 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A316H8B0-F1-model_v4 | Polyketide cyclase/dehydrase/lipid transport protein | 0.9944 | 1 | 132 |
|
| AF-A0A316H8B0-F1-model_v4 | Polyketide cyclase/dehydrase/lipid transport protein | 0.9795 | 1 | 132 |
|
| AF-A0A6A2F399-F1-model_v4 | SRPBCC family protein | 0.9745 | 1 | 130 |
|
| AF-A0A3D1H2F2-F1-model_v4 | SRPBCC family protein | 0.9651 | 1 | 130 |
|
| AF-A0A3C0QYK3-F1-model_v4 | Orotate phosphoribosyltransferase | 0.9629 | 1 | 132 |
GO:0016757
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar