F387456

General Info

Members Datasets Scaffolds Average Seq Length
286 173 262 131

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10198730|Ga0207695_101987302
Length 156
Sequence VRTPQPGDGSSGQWAVNTSMKTFESKVIINKPIAEVYDFLSDLNNHQQLMPDNIIEWASTTDTANFNVQNMARLSLKVESRLENKEIKIVPAEKPPFDLELKWSLAPVNNNTEVLFTIAADLNMMMKMLASGPLQKLADHETQNLTSILTYTQNNR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2738541284 Pedobacter sp. YR016 Isolate Unclassified
6 2738541302 Pedobacter sp. CF074 Isolate Unclassified
7 2738543023 Pedobacter sp. OK628 Isolate Unclassified
8 2739367651 Pedobacter sp. OK291 Isolate Unclassified
9 2739367656 Pedobacter sp. CF523 Isolate Unclassified
10 2739367663 Pedobacter sp. YR510 Isolate Unclassified
11 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
12 2818991437 Pedobacter terrae 518 Isolate Unclassified
13 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
14 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
15 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
16 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
17 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
18 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
19 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
20 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
21 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
22 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
23 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
24 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
25 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
26 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
27 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
28 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
29 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
30 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
31 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
32 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
33 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
34 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
96 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
97 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
131 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
143 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
144 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
145 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
151 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
152 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
153 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
154 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
162 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
166 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
171 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
172 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
173 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.56
Metatranscriptomes 1.05
Isolates 8.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.24
Nodule 0
Rhizoplane 2.1
Rhizosphere 81.47
Stem 0
Stem Tuber 0
Unclassified 11.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_475676 2162886007 Bacteria 8397
2 JGI24739J22299_10061357 3300001989 Bacteria 1187
3 JGI24737J22298_10002356 3300001990 Bacteria 6734
4 JGI24735J21928_10000050 3300002067 Bacteria 50872
5 JGI25162J39368_1000011 3300002737 Bacteria 379156
6 JGI25157J39369_1002605 3300002741 Bacteria 4289
7 JGI25152J39213_1000476 3300002773 Bacteria 23167
8 rootH1_10055881 3300003316 Bacteria 1618
9 rootH2_10002871 3300003320 Bacteria 62767
10 rootH2_10221640 3300003320 Bacteria 2153
11 rootL2_10078357 3300003322 Bacteria 1090
12 rootH1_10024269 3300003323 Bacteria 2701
13 rootH1_10218449 3300003323 Bacteria 9817
14 rootH1_10245167 3300003323 Bacteria 1374
15 Ga0055536_1000049 3300003781 Bacteria 113328
16 Ga0055530_10049206 3300003791 Bacteria 987
17 Ga0058863_10595060 3300004799 Unclassified 707
18 Ga0065714_10002298 3300005288 Bacteria 48008
19 Ga0065714_10002621 3300005288 Bacteria 31326
20 Ga0065714_10004463 3300005288 Bacteria 5552
21 Ga0065714_10006411 3300005288 Bacteria 8416
22 Ga0065714_10087017 3300005288 Bacteria 2077
23 Ga0065714_10133079 3300005288 Bacteria 1233
24 Ga0065714_10160415 3300005288 Bacteria 1055
25 Ga0065714_10377063 3300005288 Bacteria 610
26 Ga0065704_10000205 3300005289 Bacteria 128899
27 Ga0065704_10001103 3300005289 Bacteria 14777
28 Ga0065704_10452199 3300005289 Unclassified 704
29 Ga0070658_10354605 3300005327 Bacteria 1256
30 Ga0070658_10443750 3300005327 Bacteria 1118
31 Ga0070658_10722075 3300005327 Bacteria 865
32 Ga0070676_10001044 3300005328 Bacteria 13792
33 Ga0070683_100017009 3300005329 Bacteria 6418
34 Ga0068869_100825726 3300005334 Bacteria 798
35 Ga0070680_100027670 3300005336 Bacteria 4542
36 Ga0068868_100057225 3300005338 Bacteria 3080
37 Ga0068868_100314091 3300005338 Bacteria 1334
38 Ga0070660_100085767 3300005339 Bacteria 2477
39 Ga0070671_100006487 3300005355 Bacteria 9356
40 Ga0070673_100059670 3300005364 Bacteria 3021
41 Ga0070659_100001238 3300005366 Bacteria 18539
42 Ga0070659_100013744 3300005366 Bacteria 6036
43 Ga0070678_100006783 3300005456 Bacteria 6748
44 Ga0070662_100000252 3300005457 Bacteria 31682
45 Ga0070662_100911318 3300005457 Bacteria 750
46 Ga0070681_10026161 3300005458 Bacteria 5868
47 Ga0068867_100001529 3300005459 Bacteria 16051
48 Ga0070679_100007348 3300005530 Bacteria 10294
49 Ga0070684_100021371 3300005535 Bacteria 5384
50 Ga0068853_100061162 3300005539 Bacteria 3257
51 Ga0068853_100295330 3300005539 Bacteria 1496
52 Ga0068853_100574388 3300005539 Bacteria 1069
53 Ga0070665_100000104 3300005548 Bacteria 158048
54 Ga0068855_100144493 3300005563 Bacteria 2710
55 Ga0068855_100582609 3300005563 Bacteria 1208
56 Ga0068856_100072337 3300005614 Bacteria 3414
57 Ga0068856_101323990 3300005614 Bacteria 735
58 Ga0068856_101335126 3300005614 Bacteria 732
59 Ga0068856_102186328 3300005614 Bacteria 562
60 Ga0068852_100013746 3300005616 Bacteria 6204
61 Ga0068866_10044794 3300005718 Bacteria 2215
62 Ga0068866_10061095 3300005718 Bacteria 1956
63 Ga0068870_10203246 3300005840 Bacteria 1202
64 Ga0068858_100639032 3300005842 Bacteria 1034
65 Ga0068860_100309682 3300005843 Bacteria 1548
66 Ga0075366_10034894 3300006195 Bacteria 2964
67 Ga0075366_10106066 3300006195 Bacteria 1689
68 Ga0097621_100000212 3300006237 Bacteria 38270
69 Ga0068871_100004872 3300006358 Bacteria 9375
70 Ga0068871_100740009 3300006358 Bacteria 903
71 Ga0068865_100000112 3300006881 Bacteria 41532
72 Ga0105240_10003500 3300009093 Bacteria 24345
73 Ga0105240_10047784 3300009093 Bacteria 5413
74 Ga0105240_10082254 3300009093 Bacteria 3955
75 Ga0105240_10623353 3300009093 Bacteria 1185
76 Ga0105240_10886215 3300009093 Bacteria 961
77 Ga0105243_10050413 3300009148 Bacteria 3288
78 Ga0105241_10028975 3300009174 Bacteria 4127
79 Ga0105241_10031065 3300009174 Bacteria 3996
80 Ga0105242_10466662 3300009176 Bacteria 1193
81 Ga0105237_10004270 3300009545 Bacteria 16609
82 Ga0105237_10008194 3300009545 Bacteria 11352
83 Ga0105238_10036611 3300009551 Bacteria 4990
84 Ga0105239_10001049 3300010375 Bacteria 38505
85 Ga0105239_10017596 3300010375 Bacteria 7905
86 Ga0105239_10490952 3300010375 Bacteria 1396
87 Ga0105239_10798403 3300010375 Bacteria 1081
88 Ga0105246_10033878 3300011119 Bacteria 3398
89 Ga0105246_10234598 3300011119 Bacteria 1447
90 Ga0157373_10000188 3300013100 Bacteria 50875
91 Ga0157373_10006545 3300013100 Bacteria 8692
92 Ga0157373_10010113 3300013100 Bacteria 6949
93 Ga0157373_10053576 3300013100 Unclassified 2868
94 Ga0157371_10010487 3300013102 Bacteria 7211
95 Ga0157371_10010623 3300013102 Bacteria 7152
96 Ga0157371_10017586 3300013102 Bacteria 5307
97 Ga0157370_10004633 3300013104 Bacteria 15727
98 Ga0157370_10026887 3300013104 Bacteria 5676
99 Ga0157370_10043483 3300013104 Bacteria 4323
100 Ga0157370_10064496 3300013104 Bacteria 3468
101 Ga0157370_10150455 3300013104 Bacteria 2166
102 Ga0157370_10192127 3300013104 Bacteria 1895
103 Ga0157370_10399386 3300013104 Bacteria 1265
104 Ga0157370_10435137 3300013104 Bacteria 1206
105 Ga0157369_10111482 3300013105 Bacteria 2907
106 Ga0157369_10114572 3300013105 Bacteria 2863
107 Ga0157369_10970391 3300013105 Bacteria 871
108 Ga0157374_10000408 3300013296 Bacteria 38980
109 Ga0157374_10000618 3300013296 Bacteria 31268
110 Ga0157374_10655561 3300013296 Bacteria 1062
111 Ga0157374_11049740 3300013296 Bacteria 835
112 Ga0157378_10077124 3300013297 Bacteria 3004
113 Ga0157378_10285850 3300013297 Bacteria 1591
114 Ga0157378_10603155 3300013297 Bacteria 1109
115 Ga0163162_10000034 3300013306 Bacteria 149611
116 Ga0163162_10002037 3300013306 Bacteria 19017
117 Ga0163162_10017250 3300013306 Bacteria 7063
118 Ga0163162_10020734 3300013306 Bacteria 6461
119 Ga0163162_11520051 3300013306 Bacteria 763
120 Ga0157372_10000458 3300013307 Bacteria 44772
121 Ga0157372_10002874 3300013307 Bacteria 18616
122 Ga0157372_10143418 3300013307 Bacteria 2754
123 Ga0157372_10185310 3300013307 Bacteria 2410
124 Ga0157372_10421767 3300013307 Bacteria 1555
125 Ga0157375_10472158 3300013308 Bacteria 1420
126 Ga0182008_10000069 3300014497 Bacteria 82281
127 Ga0182008_10000247 3300014497 Bacteria 41952
128 Ga0182008_10011758 3300014497 Bacteria 4645
129 Ga0182008_10017588 3300014497 Bacteria 3708
130 Ga0182008_10036578 3300014497 Bacteria 2457
131 Ga0182008_10424206 3300014497 Bacteria 719
132 Ga0157377_10091612 3300014745 Bacteria 1796
133 Ga0157377_11228668 3300014745 Unclassified 582
134 Ga0157376_10373056 3300014969 Bacteria 1372
135 Ga0182006_1000210 3300015261 Bacteria 57485
136 Ga0182006_1014724 3300015261 Bacteria 3367
137 Ga0182007_10025866 3300015262 Bacteria 2040
138 Ga0182007_10032178 3300015262 Bacteria 1783
139 Ga0182007_10053162 3300015262 Bacteria 1334
140 Ga0163161_10000572 3300017792 Bacteria 29561
141 Ga0163161_10001264 3300017792 Bacteria 18909
142 Ga0163161_10534645 3300017792 Bacteria 959
143 Ga0163161_10646595 3300017792 Bacteria 876
144 Ga0206351_10493462 3300020077 Bacteria 1396
145 Ga0154015_1323683 3300020610 Bacteria 763
146 Ga0209437_100017 3300025233 Bacteria 694471
147 Ga0209026_1001114 3300025250 Bacteria 12764
148 Ga0209026_1001326 3300025250 Bacteria 11129
149 Ga0209676_1000001 3300025292 Bacteria 1852142
150 Ga0209050_1000258 3300025298 Bacteria 113741
151 Ga0207642_10202337 3300025899 Bacteria 1098
152 Ga0207642_10293010 3300025899 Bacteria 940
153 Ga0207647_10000514 3300025904 Bacteria 30831
154 Ga0207645_10000167 3300025907 Bacteria 52468
155 Ga0207705_10143441 3300025909 Unclassified 1785
156 Ga0207705_10288964 3300025909 Bacteria 1256
157 Ga0207705_10653079 3300025909 Unclassified 818
158 Ga0207705_10904668 3300025909 Bacteria 683
159 Ga0207705_10907965 3300025909 Bacteria 682
160 Ga0207654_10055383 3300025911 Bacteria 2296
161 Ga0207654_10076537 3300025911 Bacteria 2003
162 Ga0207707_10037179 3300025912 Bacteria 4253
163 Ga0207695_10007902 3300025913 Bacteria 13423
164 Ga0207695_10015236 3300025913 Bacteria 9064
165 Ga0207695_10198730 3300025913 Bacteria 1920
166 Ga0207695_10876572 3300025913 Bacteria 777
167 Ga0207671_10097149 3300025914 Bacteria 2227
168 Ga0207671_10156151 3300025914 Bacteria 1765
169 Ga0207660_10049661 3300025917 Bacteria 2976
170 Ga0207657_10119968 3300025919 Bacteria 2164
171 Ga0207657_10130747 3300025919 Bacteria 2057
172 Ga0207657_10314686 3300025919 Bacteria 1239
173 Ga0207652_10042546 3300025921 Bacteria 3867
174 Ga0207694_10201311 3300025924 Bacteria 1620
175 Ga0207644_10011082 3300025931 Bacteria 5955
176 Ga0207644_10877155 3300025931 Bacteria 752
177 Ga0207690_10000943 3300025932 Bacteria 18615
178 Ga0207706_10000844 3300025933 Bacteria 31664
179 Ga0207706_10045275 3300025933 Bacteria 3899
180 Ga0207686_10071663 3300025934 Bacteria 2231
181 Ga0207709_10058161 3300025935 Bacteria 2401
182 Ga0207704_10000062 3300025938 Bacteria 76334
183 Ga0207689_10684136 3300025942 Bacteria 865
184 Ga0207661_10041014 3300025944 Bacteria 3642
185 Ga0207667_10744395 3300025949 Bacteria 980
186 Ga0207651_10013233 3300025960 Bacteria 4711
187 Ga0207677_10054475 3300026023 Bacteria 2730
188 Ga0207677_10088954 3300026023 Bacteria 2241
189 Ga0207639_10196050 3300026041 Bacteria 1729
190 Ga0207639_10207436 3300026041 Bacteria 1685
191 Ga0207639_10336385 3300026041 Bacteria 1345
192 Ga0207702_10181201 3300026078 Bacteria 1940
193 Ga0207702_11256018 3300026078 Bacteria 735
194 Ga0207648_10000294 3300026089 Bacteria 54322
195 Ga0207674_10603612 3300026116 Bacteria 1060
196 Ga0207674_11435330 3300026116 Bacteria 659
197 Ga0207683_10014312 3300026121 Bacteria 6759
198 Ga0207698_10447463 3300026142 Bacteria 1246
199 Ga0268266_10000108 3300028379 Bacteria 171915
200 Ga0268264_11264342 3300028381 Bacteria 748
201 Ga0307517_10013924 3300028786 Bacteria 10867
202 Ga0307515_10104435 3300028794 Bacteria 3385
203 Ga0307515_10132717 3300028794 Bacteria 2730
204 Ga0307515_10884040 3300028794 Unclassified 523
205 Ga0265338_10098101 3300028800 Bacteria 2398
206 Ga0316177_1174560 3300030731 Bacteria 5757
207 Ga0307513_10360482 3300031456 Bacteria 1199
208 Ga0307412_10000004 3300031911 Bacteria 544053
209 Ga0307412_12116726 3300031911 Bacteria 523
210 Ga0307414_10000477 3300032004 Bacteria 20980
211 Ga0307414_10007084 3300032004 Bacteria 6289
212 Ga0307414_10023212 3300032004 Bacteria 3930
213 Ga0307414_10073531 3300032004 Bacteria 2473
214 Ga0307414_10330909 3300032004 Unclassified 1300
215 Ga0307414_11952521 3300032004 Bacteria 548
216 Ga0307510_10007852 3300033180 Bacteria 12715
217 Ga0395899_0000912 3300037312 Bacteria 27790
218 Ga0395900_0000585 3300037418 Bacteria 50049
219 Ga0395900_0000626 3300037418 Bacteria 47534
220 Ga0395900_0346046 3300037418 Bacteria 1461
221 Ga0395905_0002809 3300037471 Bacteria 19078
222 Ga0395901_0001558 3300038443 Bacteria 23767
223 Ga0451802_1214773 3300041460 Unclassified 783
224 Ga0451806_135767 3300041462 Bacteria 520
225 Ga0451807_0459631 3300041486 Unclassified 569
226 Ga0451807_0846600 3300041486 Bacteria 1104
227 Ga0495650_0000003 3300046471 Bacteria 900730
228 Ga0495650_0117240 3300046471 Bacteria 983
229 Ga0495585_0000136 3300046492 Bacteria 79721
230 Ga0495607_0399980 3300046501 Bacteria 625
231 Ga0495583_0059342 3300046506 Bacteria 1715
232 Ga0495606_0000002 3300046507 Bacteria 554637
233 Ga0495610_0005035 3300046512 Bacteria 9548
234 Ga0495616_0005731 3300046513 Bacteria 7607
235 Ga0495632_0055794 3300046519 Bacteria 1933
236 Ga0495644_0040886 3300046523 Bacteria 1747
237 Ga0495609_0048802 3300046538 Bacteria 1890
238 Ga0495668_0091089 3300046616 Bacteria 1671
239 Ga0495625_0000005 3300046660 Bacteria 596135
240 Ga0495625_0479191 3300046660 Bacteria 764
241 Ga0495661_0000244 3300046665 Bacteria 62633
242 Ga0495661_0022796 3300046665 Bacteria 4070
243 Ga0495670_0243873 3300046691 Bacteria 957
244 Ga0495671_0644701 3300046692 Bacteria 503
245 Ga0495649_0000003 3300046694 Bacteria 880817
246 Ga0495683_0113264 3300047323 Bacteria 1293
247 Ga0495687_000544 3300047443 Bacteria 45065
248 Ga0495687_003544 3300047443 Bacteria 11232
249 Ga0495686_0015810 3300047472 Bacteria 5136
250 Ga0495686_0082950 3300047472 Bacteria 1956
251 Ga0495686_0105630 3300047472 Bacteria 1694
252 Ga0496115_0090359 3300048918 Bacteria 2502
253 Ga0496122_0001629 3300048925 Bacteria 35029
254 Ga0496123_0000906 3300048926 Bacteria 46669
255 Ga0496125_0045231 3300048928 Bacteria 3709
256 Ga0501241_130684 3300049758 Unclassified 565
257 nmdc:mga0k408_121631_c1 3300050493 Bacteria 1546
258 nmdc:mga0k408_469311_c1 3300050493 Bacteria 747
259 Ga0500651_0000207 3300053093 Bacteria 36951
260 Ga0500569_090926 3300053109 Bacteria 989
261 Ga0500608_001289 3300053122 Bacteria 8921
262 Ga0500618_048544 3300053125 Bacteria 964

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2599185184 2599477970 127
2 iso_pu_bacteria 2857627736 2857630176 127
3 iso_pu_bacteria 2928078545 2928079931 127
4 iso_pu_bacteria 2928147474 2928147614 127
5 iso_pu_bacteria 2932082852 2932083628 127
6 iso_pu_bacteria 2585427687 2586211026 128
7 iso_pu_bacteria 2738541283 2738754292 128
8 iso_pu_bacteria 2738541284 2738762950 128
9 iso_pu_bacteria 2738541302 2738855777 128
10 iso_pu_bacteria 2738543023 2739301651 128
11 iso_pu_bacteria 2739367651 2739590173 128
12 iso_pu_bacteria 2739367656 2739615395 128
13 iso_pu_bacteria 2739367663 2739644400 128
14 iso_pu_bacteria 2775506987 2776614558 128
15 iso_pu_bacteria 2818991437 2819548443 128
16 iso_pu_bacteria 2842909656 2842913945 128
17 iso_pu_bacteria 2849281842 2849283688 128
18 iso_pu_bacteria 2852627209 2852627688 128
19 iso_pu_bacteria 2896344016 2896344125 128
20 iso_pu_bacteria 2898713307 2898715275 128
21 iso_pu_bacteria 2902048731 2902053055 128
22 iso_pu_bacteria 2919186247 2919187859 128
23 iso_pu_bacteria 2939664404 2939664874 128
24 iso_pu_bacteria 2954016120 2954016564 128
25 3300013296 Ga0157374_11049740 Ga0157374_110497402 130
26 3300001989 JGI24739J22299_10061357 JGI24739J22299_100613572 131
27 3300001990 JGI24737J22298_10002356 JGI24737J22298_1000235610 131
28 3300002067 JGI24735J21928_10000050 JGI24735J21928_1000005012 131
29 3300002737 JGI25162J39368_1000011 JGI25162J39368_1000011173 131
30 3300002741 JGI25157J39369_1002605 JGI25157J39369_10026056 131
31 3300003316 rootH1_10055881 rootH1_100558812 131
32 3300003320 rootH2_10002871 rootH2_100028717 131
33 3300003320 rootH2_10221640 rootH2_102216402 131
34 3300003322 rootL2_10078357 rootL2_100783571 131
35 3300003323 rootH1_10024269 rootH1_100242693 131
36 3300003323 rootH1_10218449 rootH1_102184492 131
37 3300003323 rootH1_10245167 rootH1_102451672 131
38 3300004799 Ga0058863_10595060 Ga0058863_105950601 131
39 3300005288 Ga0065714_10133079 Ga0065714_101330791 131
40 3300005288 Ga0065714_10377063 Ga0065714_103770631 131
41 3300005327 Ga0070658_10354605 Ga0070658_103546052 131
42 3300005327 Ga0070658_10443750 Ga0070658_104437502 131
43 3300005327 Ga0070658_10722075 Ga0070658_107220751 131
44 3300005328 Ga0070676_10001044 Ga0070676_1000104411 131
45 3300005329 Ga0070683_100017009 Ga0070683_1000170097 131
46 3300005334 Ga0068869_100825726 Ga0068869_1008257261 131
47 3300005336 Ga0070680_100027670 Ga0070680_1000276703 131
48 3300005338 Ga0068868_100057225 Ga0068868_1000572252 131
49 3300005338 Ga0068868_100314091 Ga0068868_1003140912 131
50 3300005339 Ga0070660_100085767 Ga0070660_1000857674 131
51 3300005355 Ga0070671_100006487 Ga0070671_1000064879 131
52 3300005364 Ga0070673_100059670 Ga0070673_1000596703 131
53 3300005366 Ga0070659_100001238 Ga0070659_10000123816 131
54 3300005366 Ga0070659_100013744 Ga0070659_1000137442 131
55 3300005456 Ga0070678_100006783 Ga0070678_1000067833 131
56 3300005457 Ga0070662_100000252 Ga0070662_1000002524 131
57 3300005457 Ga0070662_100911318 Ga0070662_1009113181 131
58 3300005458 Ga0070681_10026161 Ga0070681_100261613 131
59 3300005459 Ga0068867_100001529 Ga0068867_10000152912 131
60 3300005530 Ga0070679_100007348 Ga0070679_1000073484 131
61 3300005535 Ga0070684_100021371 Ga0070684_1000213717 131
62 3300005539 Ga0068853_100061162 Ga0068853_1000611622 131
63 3300005539 Ga0068853_100295330 Ga0068853_1002953302 131
64 3300005539 Ga0068853_100574388 Ga0068853_1005743882 131
65 3300005548 Ga0070665_100000104 Ga0070665_100000104103 131
66 3300005563 Ga0068855_100144493 Ga0068855_1001444933 131
67 3300005563 Ga0068855_100582609 Ga0068855_1005826091 131
68 3300005614 Ga0068856_100072337 Ga0068856_1000723373 131
69 3300005614 Ga0068856_101323990 Ga0068856_1013239902 131
70 3300005614 Ga0068856_101335126 Ga0068856_1013351261 131
71 3300005614 Ga0068856_102186328 Ga0068856_1021863281 131
72 3300005616 Ga0068852_100013746 Ga0068852_1000137466 131
73 3300005718 Ga0068866_10044794 Ga0068866_100447942 131
74 3300005718 Ga0068866_10061095 Ga0068866_100610953 131
75 3300005840 Ga0068870_10203246 Ga0068870_102032462 131
76 3300005842 Ga0068858_100639032 Ga0068858_1006390321 131
77 3300005843 Ga0068860_100309682 Ga0068860_1003096822 131
78 3300006195 Ga0075366_10034894 Ga0075366_100348943 131
79 3300006195 Ga0075366_10106066 Ga0075366_101060662 131
80 3300006237 Ga0097621_100000212 Ga0097621_10000021234 131
81 3300006358 Ga0068871_100004872 Ga0068871_1000048726 131
82 3300006358 Ga0068871_100740009 Ga0068871_1007400091 131
83 3300006881 Ga0068865_100000112 Ga0068865_1000001126 131
84 3300009093 Ga0105240_10003500 Ga0105240_1000350012 131
85 3300009093 Ga0105240_10047784 Ga0105240_100477845 131
86 3300009093 Ga0105240_10082254 Ga0105240_100822542 131
87 3300009093 Ga0105240_10623353 Ga0105240_106233532 131
88 3300009093 Ga0105240_10886215 Ga0105240_108862152 131
89 3300009148 Ga0105243_10050413 Ga0105243_100504133 131
90 3300009174 Ga0105241_10028975 Ga0105241_100289755 131
91 3300009174 Ga0105241_10031065 Ga0105241_100310652 131
92 3300009176 Ga0105242_10466662 Ga0105242_104666621 131
93 3300009545 Ga0105237_10008194 Ga0105237_1000819410 131
94 3300009551 Ga0105238_10036611 Ga0105238_100366114 131
95 3300010375 Ga0105239_10001049 Ga0105239_100010492 131
96 3300010375 Ga0105239_10017596 Ga0105239_100175963 131
97 3300010375 Ga0105239_10490952 Ga0105239_104909522 131
98 3300010375 Ga0105239_10798403 Ga0105239_107984031 131
99 3300011119 Ga0105246_10033878 Ga0105246_100338786 131
100 3300011119 Ga0105246_10234598 Ga0105246_102345982 131
101 3300013100 Ga0157373_10000188 Ga0157373_1000018831 131
102 3300013102 Ga0157371_10017586 Ga0157371_100175867 131
103 3300013104 Ga0157370_10043483 Ga0157370_100434833 131
104 3300013105 Ga0157369_10114572 Ga0157369_101145722 131
105 3300013105 Ga0157369_10970391 Ga0157369_109703911 131
106 3300013296 Ga0157374_10000408 Ga0157374_1000040834 131
107 3300013296 Ga0157374_10000618 Ga0157374_1000061832 131
108 3300013296 Ga0157374_10655561 Ga0157374_106555612 131
109 3300013297 Ga0157378_10077124 Ga0157378_100771244 131
110 3300013297 Ga0157378_10285850 Ga0157378_102858503 131
111 3300013297 Ga0157378_10603155 Ga0157378_106031552 131
112 3300013306 Ga0163162_10000034 Ga0163162_1000003467 131
113 3300013306 Ga0163162_10002037 Ga0163162_1000203722 131
114 3300013306 Ga0163162_10017250 Ga0163162_1001725010 131
115 3300013307 Ga0157372_10000458 Ga0157372_1000045827 131
116 3300013307 Ga0157372_10002874 Ga0157372_1000287418 131
117 3300013307 Ga0157372_10143418 Ga0157372_101434183 131
118 3300013307 Ga0157372_10185310 Ga0157372_101853102 131
119 3300013307 Ga0157372_10421767 Ga0157372_104217672 131
120 3300013308 Ga0157375_10472158 Ga0157375_104721582 131
121 3300014745 Ga0157377_10091612 Ga0157377_100916122 131
122 3300014745 Ga0157377_11228668 Ga0157377_112286681 131
123 3300014969 Ga0157376_10373056 Ga0157376_103730562 131
124 3300015262 Ga0182007_10025866 Ga0182007_100258661 131
125 3300020077 Ga0206351_10493462 Ga0206351_104934621 131
126 3300020610 Ga0154015_1323683 Ga0154015_13236832 131
127 3300025233 Ga0209437_100017 Ga0209437_100017336 131
128 3300025250 Ga0209026_1001114 Ga0209026_10011146 131
129 3300025250 Ga0209026_1001326 Ga0209026_10013267 131
130 3300025899 Ga0207642_10202337 Ga0207642_102023372 131
131 3300025899 Ga0207642_10293010 Ga0207642_102930102 131
132 3300025904 Ga0207647_10000514 Ga0207647_100005144 131
133 3300025907 Ga0207645_10000167 Ga0207645_1000016736 131
134 3300025909 Ga0207705_10143441 Ga0207705_101434412 131
135 3300025909 Ga0207705_10288964 Ga0207705_102889641 131
136 3300025909 Ga0207705_10653079 Ga0207705_106530792 131
137 3300025909 Ga0207705_10904668 Ga0207705_109046681 131
138 3300025909 Ga0207705_10907965 Ga0207705_109079652 131
139 3300025911 Ga0207654_10055383 Ga0207654_100553834 131
140 3300025911 Ga0207654_10076537 Ga0207654_100765372 131
141 3300025912 Ga0207707_10037179 Ga0207707_100371793 131
142 3300025913 Ga0207695_10007902 Ga0207695_1000790215 131
143 3300025913 Ga0207695_10015236 Ga0207695_100152369 131
144 3300025913 Ga0207695_10198730 Ga0207695_101987302 131
145 3300025913 Ga0207695_10876572 Ga0207695_108765722 131
146 3300025914 Ga0207671_10156151 Ga0207671_101561512 131
147 3300025917 Ga0207660_10049661 Ga0207660_100496612 131
148 3300025919 Ga0207657_10119968 Ga0207657_101199684 131
149 3300025919 Ga0207657_10130747 Ga0207657_101307473 131
150 3300025919 Ga0207657_10314686 Ga0207657_103146862 131
151 3300025921 Ga0207652_10042546 Ga0207652_100425463 131
152 3300025924 Ga0207694_10201311 Ga0207694_102013113 131
153 3300025931 Ga0207644_10011082 Ga0207644_100110827 131
154 3300025931 Ga0207644_10877155 Ga0207644_108771552 131
155 3300025932 Ga0207690_10000943 Ga0207690_1000094311 131
156 3300025933 Ga0207706_10000844 Ga0207706_1000084431 131
157 3300025933 Ga0207706_10045275 Ga0207706_100452753 131
158 3300025934 Ga0207686_10071663 Ga0207686_100716632 131
159 3300025935 Ga0207709_10058161 Ga0207709_100581612 131
160 3300025938 Ga0207704_10000062 Ga0207704_1000006249 131
161 3300025942 Ga0207689_10684136 Ga0207689_106841362 131
162 3300025944 Ga0207661_10041014 Ga0207661_100410146 131
163 3300025949 Ga0207667_10744395 Ga0207667_107443952 131
164 3300025960 Ga0207651_10013233 Ga0207651_100132334 131
165 3300026023 Ga0207677_10054475 Ga0207677_100544754 131
166 3300026023 Ga0207677_10088954 Ga0207677_100889543 131
167 3300026041 Ga0207639_10196050 Ga0207639_101960502 131
168 3300026041 Ga0207639_10207436 Ga0207639_102074362 131
169 3300026041 Ga0207639_10336385 Ga0207639_103363852 131
170 3300026078 Ga0207702_10181201 Ga0207702_101812013 131
171 3300026078 Ga0207702_11256018 Ga0207702_112560181 131
172 3300026089 Ga0207648_10000294 Ga0207648_1000029410 131
173 3300026116 Ga0207674_10603612 Ga0207674_106036122 131
174 3300026116 Ga0207674_11435330 Ga0207674_114353301 131
175 3300026121 Ga0207683_10014312 Ga0207683_100143127 131
176 3300026142 Ga0207698_10447463 Ga0207698_104474633 131
177 3300028379 Ga0268266_10000108 Ga0268266_1000010899 131
178 3300028381 Ga0268264_11264342 Ga0268264_112643422 131
179 3300028786 Ga0307517_10013924 Ga0307517_1001392410 131
180 3300028794 Ga0307515_10104435 Ga0307515_101044355 131
181 3300028794 Ga0307515_10884040 Ga0307515_108840401 131
182 3300028800 Ga0265338_10098101 Ga0265338_100981012 131
183 3300031911 Ga0307412_12116726 Ga0307412_121167261 131
184 3300032004 Ga0307414_10330909 Ga0307414_103309092 131
185 3300033180 Ga0307510_10007852 Ga0307510_100078527 131
186 3300037312 Ga0395899_0000912 Ga0395899_0000912_2581_2976 131
187 3300037418 Ga0395900_0000585 Ga0395900_0000585_28868_29263 131
188 3300037418 Ga0395900_0000626 Ga0395900_0000626_26643_27038 131
189 3300037418 Ga0395900_0346046 Ga0395900_0346046_975_1370 131
190 3300037471 Ga0395905_0002809 Ga0395905_0002809_1888_2283 131
191 3300038443 Ga0395901_0001558 Ga0395901_0001558_2875_3270 131
192 3300041460 Ga0451802_1214773 Ga0451802_1214773_133_528 131
193 3300041486 Ga0451807_0459631 Ga0451807_0459631_63_458 131
194 3300046471 Ga0495650_0000003 Ga0495650_0000003_191666_192061 131
195 3300046471 Ga0495650_0117240 Ga0495650_0117240_209_604 131
196 3300046492 Ga0495585_0000136 Ga0495585_0000136_2697_3092 131
197 3300046506 Ga0495583_0059342 Ga0495583_0059342_536_931 131
198 3300046507 Ga0495606_0000002 Ga0495606_0000002_526547_526942 131
199 3300046512 Ga0495610_0005035 Ga0495610_0005035_3619_4014 131
200 3300046513 Ga0495616_0005731 Ga0495616_0005731_2706_3101 131
201 3300046519 Ga0495632_0055794 Ga0495632_0055794_275_670 131
202 3300046523 Ga0495644_0040886 Ga0495644_0040886_229_630 131
203 3300046616 Ga0495668_0091089 Ga0495668_0091089_902_1297 131
204 3300046660 Ga0495625_0000005 Ga0495625_0000005_308682_309077 131
205 3300046660 Ga0495625_0479191 Ga0495625_0479191_283_678 131
206 3300046665 Ga0495661_0000244 Ga0495661_0000244_41257_41655 131
207 3300046665 Ga0495661_0022796 Ga0495661_0022796_3017_3412 131
208 3300046691 Ga0495670_0243873 Ga0495670_0243873_456_857 131
209 3300046692 Ga0495671_0644701 Ga0495671_0644701_94_489 131
210 3300046694 Ga0495649_0000003 Ga0495649_0000003_308670_309065 131
211 3300047323 Ga0495683_0113264 Ga0495683_0113264_852_1247 131
212 3300047443 Ga0495687_000544 Ga0495687_000544_25350_25745 131
213 3300047443 Ga0495687_003544 Ga0495687_003544_8131_8526 131
214 3300047472 Ga0495686_0015810 Ga0495686_0015810_3167_3562 131
215 3300047472 Ga0495686_0082950 Ga0495686_0082950_839_1234 131
216 3300047472 Ga0495686_0105630 Ga0495686_0105630_1134_1529 131
217 3300049758 Ga0501241_130684 Ga0501241_130684_50_445 131
218 3300050493 nmdc:mga0k408_121631_c1 nmdc:mga0k408_121631_c1_212_607 131
219 3300050493 nmdc:mga0k408_469311_c1 nmdc:mga0k408_469311_c1_256_651 131
220 3300053109 Ga0500569_090926 Ga0500569_090926_49_444 131
221 3300053122 Ga0500608_001289 Ga0500608_001289_8323_8718 131
222 3300053125 Ga0500618_048544 Ga0500618_048544_314_709 131
223 2162886007 SwRhRL2b_contig_475676 SwRhRL2b_0167.00008660 132
224 3300002773 JGI25152J39213_1000476 JGI25152J39213_100047615 132
225 3300003781 Ga0055536_1000049 Ga0055536_100004972 132
226 3300003791 Ga0055530_10049206 Ga0055530_100492062 132
227 3300005288 Ga0065714_10002298 Ga0065714_1000229822 132
228 3300005288 Ga0065714_10002621 Ga0065714_1000262111 132
229 3300005288 Ga0065714_10004463 Ga0065714_100044633 132
230 3300005288 Ga0065714_10006411 Ga0065714_100064112 132
231 3300005288 Ga0065714_10087017 Ga0065714_100870172 132
232 3300005288 Ga0065714_10160415 Ga0065714_101604152 132
233 3300005289 Ga0065704_10000205 Ga0065704_100002058 132
234 3300005289 Ga0065704_10001103 Ga0065704_100011033 132
235 3300005289 Ga0065704_10452199 Ga0065704_104521991 132
236 3300009545 Ga0105237_10004270 Ga0105237_100042703 132
237 3300013100 Ga0157373_10006545 Ga0157373_100065453 132
238 3300013100 Ga0157373_10010113 Ga0157373_100101138 132
239 3300013100 Ga0157373_10053576 Ga0157373_100535762 132
240 3300013102 Ga0157371_10010487 Ga0157371_100104876 132
241 3300013102 Ga0157371_10010623 Ga0157371_100106234 132
242 3300013104 Ga0157370_10004633 Ga0157370_100046336 132
243 3300013104 Ga0157370_10026887 Ga0157370_100268871 132
244 3300013104 Ga0157370_10064496 Ga0157370_100644962 132
245 3300013104 Ga0157370_10150455 Ga0157370_101504552 132
246 3300013104 Ga0157370_10192127 Ga0157370_101921274 132
247 3300013104 Ga0157370_10399386 Ga0157370_103993862 132
248 3300013104 Ga0157370_10435137 Ga0157370_104351372 132
249 3300013105 Ga0157369_10111482 Ga0157369_101114824 132
250 3300013306 Ga0163162_10020734 Ga0163162_100207345 132
251 3300013306 Ga0163162_11520051 Ga0163162_115200512 132
252 3300014497 Ga0182008_10000069 Ga0182008_1000006954 132
253 3300014497 Ga0182008_10000247 Ga0182008_100002476 132
254 3300014497 Ga0182008_10011758 Ga0182008_100117581 132
255 3300014497 Ga0182008_10017588 Ga0182008_100175885 132
256 3300014497 Ga0182008_10036578 Ga0182008_100365782 132
257 3300014497 Ga0182008_10424206 Ga0182008_104242062 132
258 3300015261 Ga0182006_1000210 Ga0182006_100021046 132
259 3300015261 Ga0182006_1014724 Ga0182006_10147243 132
260 3300015262 Ga0182007_10032178 Ga0182007_100321782 132
261 3300015262 Ga0182007_10053162 Ga0182007_100531622 132
262 3300017792 Ga0163161_10000572 Ga0163161_1000057212 132
263 3300017792 Ga0163161_10001264 Ga0163161_1000126418 132
264 3300017792 Ga0163161_10534645 Ga0163161_105346451 132
265 3300017792 Ga0163161_10646595 Ga0163161_106465951 132
266 3300025292 Ga0209676_1000001 Ga0209676_100000127 132
267 3300025298 Ga0209050_1000258 Ga0209050_100025872 132
268 3300025914 Ga0207671_10097149 Ga0207671_100971494 132
269 3300028794 Ga0307515_10132717 Ga0307515_101327173 132
270 3300030731 Ga0316177_1174560 Ga0316177_11745602 132
271 3300031456 Ga0307513_10360482 Ga0307513_103604822 132
272 3300031911 Ga0307412_10000004 Ga0307412_10000004364 132
273 3300032004 Ga0307414_10000477 Ga0307414_1000047713 132
274 3300032004 Ga0307414_10007084 Ga0307414_100070841 132
275 3300032004 Ga0307414_10023212 Ga0307414_100232122 132
276 3300032004 Ga0307414_10073531 Ga0307414_100735312 132
277 3300032004 Ga0307414_11952521 Ga0307414_119525211 132
278 3300041462 Ga0451806_135767 Ga0451806_135767_47_445 132
279 3300041486 Ga0451807_0846600 Ga0451807_0846600_26_424 132
280 3300046501 Ga0495607_0399980 Ga0495607_0399980_80_478 132
281 3300046538 Ga0495609_0048802 Ga0495609_0048802_525_923 132
282 3300048918 Ga0496115_0090359 Ga0496115_0090359_1194_1592 132
283 3300048925 Ga0496122_0001629 Ga0496122_0001629_63_461 132
284 3300048926 Ga0496123_0000906 Ga0496123_0000906_45825_46223 132
285 3300048928 Ga0496125_0045231 Ga0496125_0045231_2999_3397 132
286 3300053093 Ga0500651_0000207 Ga0500651_0000207_4005_4403 132

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cnw-assembly1.cif.gz_A three-dimensional structure of the protein xoxi (q81ay6) from bacillus cereus. northeast structural genomics consortium target bcr196. 0.8269 1 130
2qpv-assembly1.cif.gz_A crystal structure of uncharacterized protein atu1531 0.8175 1 131
3cnw-assembly1.cif.gz_A three-dimensional structure of the protein xoxi (q81ay6) from bacillus cereus. northeast structural genomics consortium target bcr196. 0.8104 1 130
3f08-assembly1.cif.gz_A crystal structure of the putative uncharacterized protein q6hg14 from bacilllus thuringiensis. northeast structural genomics consortium target bur153. 0.8037 2 130
7wa9-assembly1.cif.gz_A crystal structure of msmeg_5634 from mycobacterium smegmatis 0.7994 1 132
ID Description Score Start End Superfamily
af_O53961_7_149_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8204 4 130 3.30.530.20
af_I6X666_8_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8109 2 131 3.30.530.20
af_P9WJ05_1_142_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7988 1 130 3.30.530.20
af_B6SQM0_1_154_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7973 2 130 3.30.530.20
af_P9WLU7_2_142_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7949 2 130 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A316H8B0-F1-model_v4 Polyketide cyclase/dehydrase/lipid transport protein 0.9944 1 132
AF-A0A316H8B0-F1-model_v4 Polyketide cyclase/dehydrase/lipid transport protein 0.9795 1 132
AF-A0A6A2F399-F1-model_v4 SRPBCC family protein 0.9745 1 130
AF-A0A3D1H2F2-F1-model_v4 SRPBCC family protein 0.9651 1 130
AF-A0A3C0QYK3-F1-model_v4 Orotate phosphoribosyltransferase 0.9629 1 132 GO:0016757

Feature Viewer

pLDDT pTM Quality
96.3 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map