F387186

General Info

Members Datasets Scaffolds Average Seq Length
286 162 552 320

Family's Representative Sequence

Representative Sequence 3300002987|JGI25159J45721_1003978|JGI25159J45721_10039782
Length 323
Sequence MYEIKGHHHISMVTKNANENNHFYKNVLGLRRVKMTVNQDDPSMYHLFYGDKTGSPGTELSFFEIPLVGKTYRGTNAITRIGLLVPSEDSLHYWKARFEKFGVKHSEITTYANRTALKFEDAEGLRLVLLVSNGEKVEHWETWEKSEVPAEHQIQGMGSVEMTVRRLDKMASTLTEMFGYTEVSRSEEEAIFQSIKGEAFGEIVVKYLDGPTEKPGRGSIHHLAIRVKNDAELAYWEEQVKLRGFHSSGIIDRFYFKSLYFRESNGILFEIATDGPGFMGDEPYETLGEKLSLPPFLEPKREEIEKLVRPIDTVRSTKEFIKE

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
11 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
12 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
13 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
14 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
15 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
16 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
17 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
18 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
19 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
22 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
23 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
25 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
34 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
35 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
36 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
37 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
38 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
39 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
40 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
41 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
42 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
43 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
44 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
45 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
46 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
47 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
48 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
49 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
50 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
51 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
52 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
53 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
54 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
55 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
56 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
57 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
58 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
59 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
60 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
61 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
62 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
63 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
84 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
85 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
86 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
87 2643221729 Bacillus sp. Root11 Isolate Unclassified
88 2643221730 Bacillus sp. Root131 Isolate Unclassified
89 2643221731 Bacillus sp. Root147 Isolate Unclassified
90 2643221732 Bacillus sp. Root239 Isolate Unclassified
91 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
92 2684622632 Bacillus cereus 905 Isolate Unclassified
93 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
94 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
95 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
96 2738541295 Bacillus sp. OK085 Isolate Unclassified
97 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
98 2738541358 Bacillus sp. OV752 Isolate Unclassified
99 2738543006 Bacillus sp. OK077 Isolate Unclassified
100 2738543010 Bacillus sp. YR335 Isolate Unclassified
101 2738543017 Bacillus sp. OV186 Isolate Unclassified
102 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
103 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
104 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
105 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
106 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
107 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
108 2818991441 Niallia circulans 3243 Isolate Rhizosphere
109 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
110 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
111 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
112 2842682962 Bacillus sp. R-72492 Isolate Unclassified
113 2842882022 Bacillus sp. R-71893 Isolate Unclassified
114 2849139964 Bacillus sp. R-71875 Isolate Unclassified
115 2857581216 Bacillus sp. R-71922 Isolate Unclassified
116 2857586860 Bacillus sp. R-71935 Isolate Unclassified
117 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
118 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
119 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
120 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
121 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
122 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
123 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
124 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
125 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
126 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
127 2919720352 Priestia megaterium 4340 Isolate Unclassified
128 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
129 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
130 2929004312 Priestia megaterium 1104 Isolate Unclassified
131 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
132 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
133 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
134 2938917290 Bacillus sp. CR71 Isolate Unclassified
135 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
136 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
137 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
138 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
139 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
140 2965761152 Bacillus sp. COPE52 Isolate Unclassified
141 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
142 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
143 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
144 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
145 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
146 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
147 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
148 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
149 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
150 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
151 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
152 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
153 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
154 8022792930 Bacillus sp. Xin Isolate Rhizosphere
155 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
156 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
157 8023438354 Bacillus sp. BH2 Isolate Unclassified
158 8023444577 Bacillus sp. BH32 Isolate Unclassified
159 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
160 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
161 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
162 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 45.8
Metatranscriptomes 12.94
Isolates 41.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.88
Nodule 0.35
Rhizoplane 5.24
Rhizosphere 44.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1003978 3300002987 Bacteria 5035
2 JGI25151J46595_10001195 3300003187 Bacteria 18595
3 JGI25151J46595_10001642 3300003187 Bacteria 14719
4 JGI25151J46595_10001894 3300003187 Bacteria 13315
5 JGI25151J46595_10003298 3300003187 Bacteria 8962
6 JGI25151J46595_10009086 3300003187 Bacteria 4734
7 JGI25151J46595_10037609 3300003187 Bacteria 1813
8 JGI25151J46595_10038194 3300003187 Bacteria 1790
9 JGI25151J46595_10045457 3300003187 Bacteria 1549
10 JGI25151J46595_10056950 3300003187 Bacteria 1278
11 rootL2_10152230 3300003322 Bacteria 3539
12 Ga0006562J51391_1024778 3300003578 Bacteria 1028
13 Ga0055538_1000203 3300003751 Bacteria 35444
14 Ga0055538_1000204 3300003751 Bacteria 35433
15 Ga0055532_1000052 3300003758 Bacteria 164911
16 Ga0055536_1022651 3300003781 Bacteria 1868
17 Ga0055536_1031791 3300003781 Bacteria 1376
18 Ga0055528_1012809 3300003790 Bacteria 3229
19 Ga0070679_100151154 3300005530 Bacteria 2298
20 Ga0105251_10020331 3300009011 Bacteria 3490
21 Ga0105251_10042303 3300009011 Bacteria 2213
22 Ga0105244_10014611 3300009036 Bacteria 4536
23 Ga0105244_10046487 3300009036 Bacteria 2229
24 Ga0105244_10074716 3300009036 Bacteria 1685
25 Ga0105250_10008952 3300009092 Bacteria 4236
26 Ga0105250_10010292 3300009092 Bacteria 3900
27 Ga0105250_10020573 3300009092 Bacteria 2666
28 Ga0105247_10209531 3300009101 Bacteria 1314
29 Ga0114129_10963062 3300009147 Bacteria 1077
30 Ga0105242_10281289 3300009176 Bacteria 1511
31 Ga0105246_10170763 3300011119 Bacteria 1665
32 Ga0157371_10046857 3300013102 Bacteria 3073
33 Ga0157371_10094412 3300013102 Bacteria 2120
34 Ga0157372_10780527 3300013307 Bacteria 1110
35 Ga0157372_10908242 3300013307 Bacteria 1022
36 Ga0209784_100067 3300025224 Bacteria 153334
37 Ga0209784_100182 3300025224 Bacteria 50922
38 Ga0209784_100198 3300025224 Bacteria 43159
39 Ga0209147_100028 3300025229 Bacteria 383994
40 Ga0209147_101332 3300025229 Bacteria 9412
41 Ga0209147_104513 3300025229 Bacteria 2300
42 Ga0209130_1000170 3300025284 Bacteria 94517
43 Ga0209130_1000381 3300025284 Bacteria 49461
44 Ga0209130_1005361 3300025284 Bacteria 4477
45 Ga0209675_1012640 3300025291 Bacteria 2704
46 Ga0209676_1000754 3300025292 Bacteria 43820
47 Ga0209676_1000922 3300025292 Bacteria 36340
48 Ga0209676_1003554 3300025292 Bacteria 9430
49 Ga0209676_1012223 3300025292 Bacteria 3395
50 Ga0209676_1017007 3300025292 Bacteria 2594
51 Ga0209025_1000095 3300025294 Bacteria 240057
52 Ga0209025_1000209 3300025294 Bacteria 140401
53 Ga0209025_1000642 3300025294 Bacteria 61658
54 Ga0209025_1001311 3300025294 Bacteria 33888
55 Ga0209025_1002319 3300025294 Bacteria 20582
56 Ga0209025_1002402 3300025294 Bacteria 19979
57 Ga0209025_1002452 3300025294 Bacteria 19601
58 Ga0209025_1006667 3300025294 Bacteria 8871
59 Ga0209025_1006874 3300025294 Bacteria 8682
60 Ga0209025_1007484 3300025294 Bacteria 8121
61 Ga0209025_1007499 3300025294 Bacteria 8108
62 Ga0209025_1009898 3300025294 Bacteria 6556
63 Ga0209025_1018063 3300025294 Bacteria 4030
64 Ga0209025_1020753 3300025294 Bacteria 3571
65 Ga0209025_1030381 3300025294 Bacteria 2587
66 Ga0209025_1034907 3300025294 Bacteria 2284
67 Ga0209025_1039860 3300025294 Bacteria 2042
68 Ga0209025_1055026 3300025294 Bacteria 1542
69 Ga0209025_1065581 3300025294 Bacteria 1325
70 Ga0207696_1001951 3300025711 Bacteria 10482
71 Ga0207696_1002628 3300025711 Bacteria 8696
72 Ga0207696_1004799 3300025711 Bacteria 5745
73 Ga0207655_1018772 3300025728 Bacteria 3649
74 Ga0207713_1016793 3300025735 Bacteria 3702
75 Ga0207705_10268140 3300025909 Bacteria 1305
76 Ga0207707_10036276 3300025912 Bacteria 4312
77 Ga0207657_10076708 3300025919 Bacteria 2819
78 Ga0207652_10136480 3300025921 Bacteria 2191
79 Ga0207674_10195674 3300026116 Bacteria 1971
80 Ga0237817_10063 3300030083 Bacteria 36749
81 Ga0237817_10811 3300030083 Bacteria 2306
82 Ga0237817_11672 3300030083 Bacteria 1045
83 Ga0307408_100104828 3300031548 Bacteria 2161
84 Ga0307408_100169392 3300031548 Bacteria 1742
85 Ga0307416_100206437 3300032002 Bacteria 1869
86 Ga0307414_10020419 3300032004 Bacteria 4129
87 Ga0307414_10093262 3300032004 Bacteria 2244
88 Ga0307414_10097642 3300032004 Bacteria 2201
89 Ga0307414_10378764 3300032004 Bacteria 1223
90 Ga0237819_00052 3300038705 Bacteria 40279
91 Ga0237819_00333 3300038705 Bacteria 17230
92 Ga0237819_00902 3300038705 Bacteria 9218
93 Ga0466967_0025068 3300045976 Bacteria 4912
94 Ga0495603_0087105 3300046455 Bacteria 1827
95 Ga0495584_0142986 3300046491 Bacteria 1215
96 Ga0495585_0235969 3300046492 Bacteria 917
97 Ga0495654_0110642 3300046530 Bacteria 1254
98 Ga0496100_0013533 3300048903 Bacteria 4709
99 Ga0496101_0003167 3300048904 Bacteria 10190
100 Ga0496102_0051424 3300048905 Bacteria 3753
101 Ga0496102_0073785 3300048905 Bacteria 3136
102 Ga0496104_0000433 3300048907 Bacteria 36262
103 Ga0496105_0004472 3300048908 Bacteria 10525
104 Ga0496106_0066777 3300048909 Bacteria 2740
105 Ga0496107_0004261 3300048910 Bacteria 9674
106 Ga0496108_0003553 3300048911 Bacteria 12508
107 Ga0496109_0002054 3300048912 Bacteria 16697
108 Ga0496110_0000067 3300048913 Bacteria 52165
109 Ga0496110_0009811 3300048913 Bacteria 7755
110 Ga0496112_0007623 3300048915 Bacteria 9621
111 Ga0496113_0046280 3300048916 Bacteria 3229
112 Ga0496116_0080838 3300048919 Bacteria 2017
113 Ga0496117_0149289 3300048920 Bacteria 1386
114 Ga0496118_0124111 3300048921 Bacteria 1676
115 Ga0496119_0020182 3300048922 Bacteria 4869
116 Ga0496120_0049028 3300048923 Bacteria 2426
117 Ga0496122_0033683 3300048925 Bacteria 4207
118 Ga0496125_0093332 3300048928 Bacteria 2246
119 Ga0496126_0007793 3300048929 Bacteria 11675
120 Ga0501341_00930 3300049131 Bacteria 1367
121 Ga0501343_001000 3300049132 Bacteria 1834
122 Ga0501305_004303 3300049161 Bacteria 1668
123 Ga0501305_008098 3300049161 Bacteria 1352
124 Ga0501305_008665 3300049161 Bacteria 1321
125 Ga0501305_010319 3300049161 Bacteria 1245
126 Ga0501305_015339 3300049161 Bacteria 1081
127 Ga0501312_002417 3300049528 Bacteria 2014
128 Ga0501312_007731 3300049528 Bacteria 1378
129 Ga0501312_008848 3300049528 Bacteria 1316
130 Ga0501312_010797 3300049528 Bacteria 1229
131 Ga0501312_016073 3300049528 Bacteria 1067
132 Ga0501313_002643 3300049529 Bacteria 1715
133 Ga0501313_003854 3300049529 Bacteria 1514
134 Ga0501313_005346 3300049529 Bacteria 1353
135 Ga0501313_007985 3300049529 Bacteria 1172
136 Ga0501314_004947 3300049530 Bacteria 1121
137 Ga0501315_002886 3300049531 Bacteria 1671
138 Ga0501315_003026 3300049531 Bacteria 1648
139 Ga0501315_012161 3300049531 Bacteria 1061
140 Ga0501316_000719 3300049532 Bacteria 2480
141 Ga0501316_002062 3300049532 Bacteria 1816
142 Ga0501316_005566 3300049532 Bacteria 1310
143 Ga0501320_004240 3300049536 Bacteria 1255
144 Ga0501320_005179 3300049536 Bacteria 1178
145 Ga0501321_005661 3300049537 Bacteria 1244
146 Ga0501322_002657 3300049538 Bacteria 1112
147 Ga0501326_00778 3300049542 Bacteria 1351
148 Ga0501328_00654 3300049544 Bacteria 1213
149 Ga0501330_002601 3300049546 Bacteria 1031
150 Ga0501333_000487 3300049549 Bacteria 1836
151 Ga0501333_001610 3300049549 Bacteria 1246
152 Ga0501334_00526 3300049550 Bacteria 1784
153 Ga0501334_02732 3300049550 Bacteria 1060
154 Ga0501337_000242 3300049553 Bacteria 2436
155 Ga0501338_01115 3300049554 Bacteria 1378
156 Ga0501033_0112861 3300049570 Bacteria 1977
157 Ga0501034_0394836 3300049571 Bacteria 1307
158 Ga0501070_0161964 3300049586 Bacteria 1844
159 2512637385 2512564013 Bacteria 6286191
160 2553392854 2551306519 Bacteria 5465154
161 2553392855 2551306519 Bacteria 5465154
162 2595090575 2593339131 Bacteria 5116855
163 2644703368 2643221729 Bacteria 6621700
164 2644703369 2643221729 Bacteria 6621700
165 2644713435 2643221730 Bacteria 6523787
166 2644713436 2643221730 Bacteria 6523787
167 2644717998 2643221731 Bacteria 5623886
168 2644724895 2643221732 Bacteria 5756404
169 2672335535 2671180330 Bacteria 5521719
170 2685148944 2684622632 Bacteria 5380049
171 2685148945 2684622632 Bacteria 5380049
172 2698324220 2695420987 Bacteria 6152737
173 2698324221 2695420987 Bacteria 6152737
174 2705992985 2703719227 Bacteria 5631989
175 2705992986 2703719227 Bacteria 5631989
176 2705993793 2703719227 Bacteria 5631989
177 2721504348 2718218445 Bacteria 5113413
178 2721504349 2718218445 Bacteria 5113413
179 2738813455 2738541295 Bacteria 5730091
180 2738816921 2738541295 Bacteria 5730091
181 2738839566 2738541299 Bacteria 4020721
182 2739156710 2738541358 Bacteria 5932299
183 2739156711 2738541358 Bacteria 5932299
184 2739159126 2738541358 Bacteria 5932299
185 2739210311 2738543006 Bacteria 5904091
186 2739210312 2738543006 Bacteria 5904091
187 2739211786 2738543006 Bacteria 5904091
188 2739231701 2738543010 Bacteria 5583595
189 2739231931 2738543010 Bacteria 5583595
190 2739269786 2738543017 Bacteria 4271950
191 2757567326 2757320391 Bacteria 4746095
192 2777761819 2775507177 Bacteria 4384303
193 2777837686 2775507192 Bacteria 4622234
194 2791214139 2788500588 Bacteria 4584915
195 2791215500 2788500588 Bacteria 4584915
196 2808868699 2808606364 Bacteria 4465927
197 2808870100 2808606364 Bacteria 4465927
198 2816865086 2816332186 Bacteria 5331395
199 2819567037 2818991441 Bacteria 5062707
200 2819585266 2818991443 Bacteria 6598732
201 2819585267 2818991443 Bacteria 6598732
202 2819626267 2818991451 Bacteria 4697364
203 2819629016 2818991451 Bacteria 4697364
204 2819707158 2818991465 Bacteria 5388835
205 2842683954 2842682962 Bacteria 5589973
206 2842882531 2842882022 Bacteria 6158489
207 2849144406 2849139964 Bacteria 5613304
208 2857581684 2857581216 Bacteria 5522813
209 2857582004 2857581216 Bacteria 5522813
210 2857589504 2857586860 Bacteria 4354574
211 2857607880 2857604169 Bacteria 5111450
212 2857613636 2857609550 Bacteria 3753890
213 2904526804 2904524088 Bacteria 5887454
214 2904608083 2904606771 Bacteria 4684500
215 2904611008 2904606771 Bacteria 4684500
216 2907206977 2907202186 Bacteria 6632024
217 2915598204 2915597211 Bacteria 6475886
218 2916976374 2916971899 Bacteria 4250608
219 2919144605 2919143609 Bacteria 6219228
220 2919419237 2919414237 Bacteria 5429133
221 2919519795 2919517244 Bacteria 5858162
222 2919720933 2919720352 Bacteria 5986006
223 2928095319 2928093941 Bacteria 5965005
224 2928510517 2928510474 Bacteria 4815308
225 2929008600 2929004312 Bacteria 5678476
226 2929189750 2929183550 Bacteria 6377511
227 2929234209 2929233124 Bacteria 5948380
228 2929234210 2929233124 Bacteria 5948380
229 2936344814 2936340661 Bacteria 5139038
230 2938918388 2938917290 Bacteria 5914775
231 2938918389 2938917290 Bacteria 5914775
232 2939597485 2939593269 Bacteria 4798695
233 2939597634 2939593269 Bacteria 4798695
234 2947427743 2947426588 Bacteria 5357194
235 2947427744 2947426588 Bacteria 5357194
236 2960324977 2960319331 Bacteria 5502575
237 2960377478 2960375949 Bacteria 5361395
238 2964379811 2964375228 Bacteria 4909004
239 2964379812 2964375228 Bacteria 4909004
240 2965762254 2965761152 Bacteria 5806513
241 2965762255 2965761152 Bacteria 5806513
242 2965763127 2965761152 Bacteria 5806513
243 2977257245 2977254563 Bacteria 4828420
244 2979084671 2979083700 Bacteria 5894929
245 2979084672 2979083700 Bacteria 5894929
246 2990278159 2990275345 Bacteria 4887158
247 3001271941 3001267043 Bacteria 4823521
248 3001276021 3001272096 Bacteria 4729684
249 3001896579 3001892409 Bacteria 6328293
250 3006829392 3006826541 Bacteria 4678913
251 3006971846 3006969106 Bacteria 4739423
252 3006973182 3006969106 Bacteria 4739423
253 3006975130 3006973921 Bacteria 4423788
254 3006979857 3006978542 Bacteria 5328100
255 3006980919 3006978542 Bacteria 5328100
256 3006986967 3006984091 Bacteria 4207523
257 3006986968 3006984091 Bacteria 4207523
258 3006993124 3006988479 Bacteria 4767936
259 3006993133 3006988479 Bacteria 4767936
260 8022622168 8022621104 Bacteria 5241040
261 8022622169 8022621104 Bacteria 5241040
262 8022797249 8022792930 Bacteria 5693794
263 8022897260 8022893055 Bacteria 5300455
264 8022917828 8022914991 Bacteria 5584517
265 8023443456 8023438354 Bacteria 5779374
266 8023443457 8023438354 Bacteria 5779374
267 8023449247 8023444577 Bacteria 5661597
268 8023449248 8023444577 Bacteria 5661597
269 8054283213 8054280661 Bacteria 4232245
270 8055535061 8055531788 Bacteria 5249694
271 8055536681 8055531788 Bacteria 5249694
272 8057474194 8057473075 Bacteria 5892720
273 8057475464 8057473075 Bacteria 5892720
274 8057478375 8057473075 Bacteria 5892720
275 8057633313 8057632132 Bacteria 4726859
276 8057633436 8057632132 Bacteria 4726859
277 JGI25159J45721_1003978
278 JGI25151J46595_10001195
279 JGI25151J46595_10001642
280 JGI25151J46595_10001894
281 JGI25151J46595_10003298
282 JGI25151J46595_10009086
283 JGI25151J46595_10037609
284 JGI25151J46595_10038194
285 JGI25151J46595_10045457
286 JGI25151J46595_10056950
287 rootL2_10152230
288 Ga0006562J51391_1024778
289 Ga0055538_1000203
290 Ga0055538_1000204
291 Ga0055532_1000052
292 Ga0055536_1022651
293 Ga0055536_1031791
294 Ga0055528_1012809
295 Ga0070679_100151154
296 Ga0105251_10020331
297 Ga0105251_10042303
298 Ga0105244_10014611
299 Ga0105244_10046487
300 Ga0105244_10074716
301 Ga0105250_10008952
302 Ga0105250_10010292
303 Ga0105250_10020573
304 Ga0105247_10209531
305 Ga0114129_10963062
306 Ga0105242_10281289
307 Ga0105246_10170763
308 Ga0157371_10046857
309 Ga0157371_10094412
310 Ga0157372_10780527
311 Ga0157372_10908242
312 Ga0209784_100067
313 Ga0209784_100182
314 Ga0209784_100198
315 Ga0209147_100028
316 Ga0209147_101332
317 Ga0209147_104513
318 Ga0209130_1000170
319 Ga0209130_1000381
320 Ga0209130_1005361
321 Ga0209675_1012640
322 Ga0209676_1000754
323 Ga0209676_1000922
324 Ga0209676_1003554
325 Ga0209676_1012223
326 Ga0209676_1017007
327 Ga0209025_1000095
328 Ga0209025_1000209
329 Ga0209025_1000642
330 Ga0209025_1001311
331 Ga0209025_1002319
332 Ga0209025_1002402
333 Ga0209025_1002452
334 Ga0209025_1006667
335 Ga0209025_1006874
336 Ga0209025_1007484
337 Ga0209025_1007499
338 Ga0209025_1009898
339 Ga0209025_1018063
340 Ga0209025_1020753
341 Ga0209025_1030381
342 Ga0209025_1034907
343 Ga0209025_1039860
344 Ga0209025_1055026
345 Ga0209025_1065581
346 Ga0207696_1001951
347 Ga0207696_1002628
348 Ga0207696_1004799
349 Ga0207655_1018772
350 Ga0207713_1016793
351 Ga0207705_10268140
352 Ga0207707_10036276
353 Ga0207657_10076708
354 Ga0207652_10136480
355 Ga0207674_10195674
356 Ga0237817_10063
357 Ga0237817_10811
358 Ga0237817_11672
359 Ga0307408_100104828
360 Ga0307408_100169392
361 Ga0307416_100206437
362 Ga0307414_10020419
363 Ga0307414_10093262
364 Ga0307414_10097642
365 Ga0307414_10378764
366 Ga0237819_00052
367 Ga0237819_00333
368 Ga0237819_00902
369 Ga0466967_0025068
370 Ga0495603_0087105
371 Ga0495584_0142986
372 Ga0495585_0235969
373 Ga0495654_0110642
374 Ga0496100_0013533
375 Ga0496101_0003167
376 Ga0496102_0051424
377 Ga0496102_0073785
378 Ga0496104_0000433
379 Ga0496105_0004472
380 Ga0496106_0066777
381 Ga0496107_0004261
382 Ga0496108_0003553
383 Ga0496109_0002054
384 Ga0496110_0000067
385 Ga0496110_0009811
386 Ga0496112_0007623
387 Ga0496113_0046280
388 Ga0496116_0080838
389 Ga0496117_0149289
390 Ga0496118_0124111
391 Ga0496119_0020182
392 Ga0496120_0049028
393 Ga0496122_0033683
394 Ga0496125_0093332
395 Ga0496126_0007793
396 Ga0501341_00930
397 Ga0501343_001000
398 Ga0501305_004303
399 Ga0501305_008098
400 Ga0501305_008665
401 Ga0501305_010319
402 Ga0501305_015339
403 Ga0501312_002417
404 Ga0501312_007731
405 Ga0501312_008848
406 Ga0501312_010797
407 Ga0501312_016073
408 Ga0501313_002643
409 Ga0501313_003854
410 Ga0501313_005346
411 Ga0501313_007985
412 Ga0501314_004947
413 Ga0501315_002886
414 Ga0501315_003026
415 Ga0501315_012161
416 Ga0501316_000719
417 Ga0501316_002062
418 Ga0501316_005566
419 Ga0501320_004240
420 Ga0501320_005179
421 Ga0501321_005661
422 Ga0501322_002657
423 Ga0501326_00778
424 Ga0501328_00654
425 Ga0501330_002601
426 Ga0501333_000487
427 Ga0501333_001610
428 Ga0501334_00526
429 Ga0501334_02732
430 Ga0501337_000242
431 Ga0501338_01115
432 Ga0501033_0112861
433 Ga0501034_0394836
434 Ga0501070_0161964
435 2512637385
436 2553392854
437 2553392855
438 2595090575
439 2644703368
440 2644703369
441 2644713435
442 2644713436
443 2644717998
444 2644724895
445 2672335535
446 2685148944
447 2685148945
448 2698324220
449 2698324221
450 2705992985
451 2705992986
452 2705993793
453 2721504348
454 2721504349
455 2738813455
456 2738816921
457 2738839566
458 2739156710
459 2739156711
460 2739159126
461 2739210311
462 2739210312
463 2739211786
464 2739231701
465 2739231931
466 2739269786
467 2757567326
468 2777761819
469 2777837686
470 2791214139
471 2791215500
472 2808868699
473 2808870100
474 2816865086
475 2819567037
476 2819585266
477 2819585267
478 2819626267
479 2819629016
480 2819707158
481 2842683954
482 2842882531
483 2849144406
484 2857581684
485 2857582004
486 2857589504
487 2857607880
488 2857613636
489 2904526804
490 2904608083
491 2904611008
492 2907206977
493 2915598204
494 2916976374
495 2919144605
496 2919419237
497 2919519795
498 2919720933
499 2928095319
500 2928510517
501 2929008600
502 2929189750
503 2929234209
504 2929234210
505 2936344814
506 2938918388
507 2938918389
508 2939597485
509 2939597634
510 2947427743
511 2947427744
512 2960324977
513 2960377478
514 2964379811
515 2964379812
516 2965762254
517 2965762255
518 2965763127
519 2977257245
520 2979084671
521 2979084672
522 2990278159
523 3001271941
524 3001276021
525 3001896579
526 3006829392
527 3006971846
528 3006973182
529 3006975130
530 3006979857
531 3006980919
532 3006986967
533 3006986968
534 3006993124
535 3006993133
536 8022622168
537 8022622169
538 8022797249
539 8022897260
540 8022917828
541 8023443456
542 8023443457
543 8023449247
544 8023449248
545 8054283213
546 8055535061
547 8055536681
548 8057474194
549 8057475464
550 8057478375
551 8057633313
552 8057633436

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

156

271

0.96

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

6

129

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zsw-assembly1.cif.gz_A crystal structure of bacillus cereus metallo protein from glyoxalase family 0.9836 1 312
1zsw-assembly1.cif.gz_A crystal structure of bacillus cereus metallo protein from glyoxalase family 0.9475 1 312
3oaj-assembly1.cif.gz_A crystal structure of putative dioxygenase from bacillus subtilis subsp. subtilis str. 168 0.916 1 314
3oaj-assembly1.cif.gz_A crystal structure of putative dioxygenase from bacillus subtilis subsp. subtilis str. 168 0.9075 1 314
4huz-assembly1.cif.gz_A-2 2,6-dichloro-p-hydroquinone 1,2-dioxygenase 0.8805 1 306
ID Description Score Start End Superfamily
1zswA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9875 66 215 3.10.180.10
1zswA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.981 66 215 3.10.180.10
af_Q2G137_30_308_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9638 31 311 3.10.180.10
1zswA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9619 1 312 3.10.180.10
af_Q2G137_30_308_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9604 31 311 3.10.180.10
ID Description Score Start End GO Terms
AF-R8QIL8-F1-model_v4 Glyoxalase 0.9868 1 276
AF-A0A4U3AYD4-F1-model_v4 deleted 0.9854 1 235
AF-A0A243K7I3-F1-model_v4 deleted 0.9843 1 312
AF-A0A4U3AYD4-F1-model_v4 deleted 0.9812 1 235
AF-C2Z476-F1-model_v4 deleted 0.9805 104 312

Map