F387042

General Info

Members Datasets Scaffolds Average Seq Length
285 218 568 411

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0000170|Ga0495686_0000170_51267_52667
Length 459
Sequence MTDAAADPAGGRFTAFSYRSFTVFFLARVFTTFGAQVLSVAVLWEIYDLTKSAWYTGLVGLVQFVPLFLLVLVTGTAADRFGRRLIMGLSIWVMSACAGAMLAASLLVPAFHPAEAASAEAFFAAHIMLAILVMFGVGRAFLGPASSSLVVSLVPPSVFANAVTWNSSAWQAATIIGPAAGGLLLTVGDPAAADWMRGNGMEAIAGVVEHRGAEVAYTVALVMMAVGGLLIFTLPKPPKGPAKERPTLSNLFEGFRYIWRQKIVLGAISLDLFAVLMGGVVALMPIYADEILHLGPAGVGWLRAAPGIGAVATAGLLAAFPIRDHAGAIMFVCVGLFGAFTVLFGFSTIPLLSIIALILLGAADMVSVVVRETLLQLWTPDDVRGRVNAVNGVFVSASNEMGEFRAGSMARAIGEGAAGAVPAAVIXXFIWAWMFPQLRKARHLNSGVDAAGEAPKAAE

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
43 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
45 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
49 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
70 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
74 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
75 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
76 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
77 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
93 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
94 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
95 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
96 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
97 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
100 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
103 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
106 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
107 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
108 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
109 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
110 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
115 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
116 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
117 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
118 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
119 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
120 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
121 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
122 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
123 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
125 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
141 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
142 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
145 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
146 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
147 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
148 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
151 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
152 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
155 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
156 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
157 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
158 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
159 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
160 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
161 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
162 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
163 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
164 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
165 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
166 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
167 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
168 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
169 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
170 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
171 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
172 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
173 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
174 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
175 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
176 2643221558 Rhizobium sp. Root149 Isolate Unclassified
177 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
178 2643221719 Rhizobium sp. Root274 Isolate Unclassified
179 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
180 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
181 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
182 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
183 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
184 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
185 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
186 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
187 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
188 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
189 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
190 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
191 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
192 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
193 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
194 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
195 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
196 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
197 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
198 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
199 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
200 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
201 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
202 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
203 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
204 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
205 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
206 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
207 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
208 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
209 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
210 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
211 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
212 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
213 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
214 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
215 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
216 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
217 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
218 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.19
Metatranscriptomes 0
Isolates 22.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.95
Nodule 8.07
Rhizoplane 2.81
Rhizosphere 49.47
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0000170 3300047472 Bacteria 123336
2 JGI24740J21852_10000013 3300001979 Bacteria 62177
3 JGI25162J39368_1000712 3300002737 Bacteria 23117
4 JGI25162J39368_1000879 3300002737 Bacteria 19691
5 JGI25162J39368_1001349 3300002737 Bacteria 13618
6 JGI25159J45721_1000630 3300002987 Bacteria 15627
7 JGI25165J46597_1000825 3300003214 Bacteria 23204
8 JGI25165J46597_1001035 3300003214 Bacteria 18162
9 JGI25153J46596_10023493 3300003215 Bacteria 2245
10 rootH1_10255604 3300003323 Bacteria 3823
11 JGI25160J50197_1000235 3300003354 Bacteria 43030
12 JGI25161J50226_1000175 3300003374 Bacteria 43039
13 Ga0055536_1009413 3300003781 Bacteria 4039
14 Ga0055540_1008906 3300003792 Bacteria 3544
15 Ga0055531_10005569 3300003794 Bacteria 7345
16 Ga0058692_1002165 3300003856 Bacteria 6711
17 Ga0058692_1008355 3300003856 Bacteria 2674
18 Ga0055543_1000226 3300004625 Bacteria 44983
19 Ga0065165_1002250 3300005262 Bacteria 17103
20 Ga0065165_1005353 3300005262 Bacteria 7282
21 Ga0070670_100000183 3300005331 Bacteria 57446
22 Ga0070668_100007052 3300005347 Bacteria 8328
23 Ga0070668_100189819 3300005347 Bacteria 1682
24 Ga0070669_100045964 3300005353 Bacteria 3183
25 Ga0070669_100145293 3300005353 Bacteria 1832
26 Ga0070675_100008231 3300005354 Bacteria 8090
27 Ga0070667_100048857 3300005367 Bacteria 3562
28 Ga0070667_100127698 3300005367 Bacteria 2217
29 Ga0070667_100175705 3300005367 Bacteria 1892
30 Ga0070665_100013812 3300005548 Bacteria 8124
31 Ga0068851_10018591 3300005834 Bacteria 3349
32 Ga0068851_10050469 3300005834 Bacteria 2112
33 Ga0068860_100414440 3300005843 Bacteria 1334
34 Ga0075365_10006666 3300006038 Bacteria 6380
35 Ga0075368_10000370 3300006042 Bacteria 13204
36 Ga0075364_10020214 3300006051 Bacteria 4187
37 Ga0075364_10108004 3300006051 Bacteria 1856
38 Ga0075369_10005003 3300006186 Bacteria 4933
39 Ga0075370_10095411 3300006353 Bacteria 1718
40 Ga0079104_1000195 3300006946 Bacteria 85244
41 Ga0105240_10000013 3300009093 Bacteria 483458
42 Ga0111539_10000224 3300009094 Bacteria 67805
43 Ga0111539_10319454 3300009094 Bacteria 1807
44 Ga0105243_10002616 3300009148 Bacteria 14997
45 Ga0105241_10140029 3300009174 Bacteria 1969
46 Ga0105242_10198950 3300009176 Bacteria 1779
47 Ga0105237_10002248 3300009545 Bacteria 24031
48 Ga0105239_10000820 3300010375 Bacteria 44190
49 Ga0105239_10488484 3300010375 Bacteria 1399
50 Ga0157371_10000108 3300013102 Bacteria 126288
51 Ga0157370_10000720 3300013104 Bacteria 41451
52 Ga0157369_10007099 3300013105 Bacteria 12916
53 Ga0182008_10004588 3300014497 Bacteria 8043
54 Ga0209563_105144 3300025230 Bacteria 2406
55 Ga0209437_100057 3300025233 Bacteria 362922
56 Ga0209437_100107 3300025233 Bacteria 218656
57 Ga0209677_100199 3300025253 Bacteria 48030
58 Ga0209233_1000072 3300025261 Bacteria 363074
59 Ga0209233_1000134 3300025261 Bacteria 202535
60 Ga0209233_1000331 3300025261 Bacteria 48397
61 Ga0209130_1000132 3300025284 Bacteria 119765
62 Ga0209676_1001884 3300025292 Bacteria 17124
63 Ga0209564_1014648 3300025295 Bacteria 3243
64 Ga0209758_1000570 3300025297 Bacteria 57866
65 Ga0209758_1012885 3300025297 Bacteria 4626
66 Ga0209050_1003271 3300025298 Bacteria 12167
67 Ga0207426_1000246 3300025302 Bacteria 119765
68 Ga0209051_1001505 3300025303 Bacteria 19474
69 Ga0209257_1000989 3300025304 Bacteria 38561
70 Ga0207688_10050651 3300025901 Bacteria 2325
71 Ga0207645_10065807 3300025907 Bacteria 2317
72 Ga0207654_10025519 3300025911 Bacteria 3188
73 Ga0207695_10000044 3300025913 Bacteria 440819
74 Ga0207671_10000226 3300025914 Bacteria 84886
75 Ga0207652_10041027 3300025921 Bacteria 3932
76 Ga0207681_10078575 3300025923 Bacteria 2322
77 Ga0207650_10000151 3300025925 Bacteria 83229
78 Ga0207659_10003449 3300025926 Bacteria 9476
79 Ga0207686_10126416 3300025934 Bacteria 1748
80 Ga0207668_10005108 3300025972 Bacteria 7723
81 Ga0207668_10076809 3300025972 Bacteria 2406
82 Ga0207658_10041656 3300025986 Bacteria 3327
83 Ga0207658_10063019 3300025986 Bacteria 2777
84 Ga0207678_10064161 3300026067 Bacteria 3156
85 Ga0207702_10109800 3300026078 Bacteria 2450
86 Ga0207648_10131480 3300026089 Bacteria 2203
87 Ga0207675_100125945 3300026118 Bacteria 2426
88 Ga0209281_1000028 3300027111 Bacteria 440027
89 Ga0209371_1001349 3300027312 Bacteria 17013
90 Ga0209371_1001563 3300027312 Bacteria 15068
91 Ga0207428_10133895 3300027907 Bacteria 1895
92 Ga0268266_10002167 3300028379 Bacteria 21541
93 Ga0268266_10048033 3300028379 Bacteria 3658
94 Ga0307515_10000434 3300028794 Bacteria 100265
95 Ga0307515_10027966 3300028794 Bacteria 9606
96 Ga0268256_1004513 3300030500 Bacteria 5757
97 Ga0265328_10033359 3300031239 Bacteria 1910
98 Ga0265340_10004673 3300031247 Bacteria 7620
99 Ga0265340_10005049 3300031247 Bacteria 7343
100 Ga0265339_10051659 3300031249 Bacteria 2242
101 Ga0265339_10057971 3300031249 Bacteria 2093
102 Ga0265316_10013721 3300031344 Bacteria 7182
103 Ga0307513_10030299 3300031456 Bacteria 6147
104 Ga0307408_100123139 3300031548 Bacteria 2012
105 Ga0265313_10001117 3300031595 Bacteria 25638
106 Ga0265313_10022532 3300031595 Bacteria 3414
107 Ga0265313_10030976 3300031595 Bacteria 2747
108 Ga0265313_10060318 3300031595 Bacteria 1779
109 Ga0265342_10006677 3300031712 Bacteria 8554
110 Ga0307412_10030678 3300031911 Bacteria 3388
111 Ga0307411_10185314 3300032005 Bacteria 1584
112 Ga0373927_0000135 3300035695 Bacteria 56787
113 Ga0373947_0058510 3300035725 Unclassified 2336
114 Ga0395900_0034923 3300037418 Bacteria 5180
115 Ga0395905_0001126 3300037471 Bacteria 33477
116 Ga0395905_0001760 3300037471 Bacteria 25237
117 Ga0466970_0013038 3300044765 Bacteria 4259
118 Ga0466957_0028365 3300044842 Bacteria 3333
119 Ga0466958_0116649 3300045836 Bacteria 1669
120 Ga0495627_034595 3300046453 Bacteria 1578
121 Ga0495638_0004212 3300046460 Bacteria 10949
122 Ga0495607_0058374 3300046501 Bacteria 2206
123 Ga0495606_0002374 3300046507 Bacteria 22109
124 Ga0495606_0017264 3300046507 Bacteria 5465
125 Ga0495610_0036363 3300046512 Bacteria 2517
126 Ga0495632_0038801 3300046519 Bacteria 2409
127 Ga0495643_0004293 3300046522 Bacteria 10044
128 Ga0495643_0065048 3300046522 Bacteria 1926
129 Ga0495663_0031670 3300046525 Bacteria 1572
130 Ga0495663_0037870 3300046525 Bacteria 1456
131 Ga0495654_0000308 3300046530 Bacteria 42986
132 Ga0495587_0042372 3300046536 Bacteria 2715
133 Ga0495597_0026461 3300046542 Bacteria 2665
134 Ga0495622_0029850 3300046557 Bacteria 2547
135 Ga0495625_0110140 3300046660 Bacteria 1883
136 Ga0495588_0000643 3300046674 Bacteria 16231
137 Ga0495588_0088626 3300046674 Bacteria 1620
138 Ga0495657_0061271 3300046675 Bacteria 2489
139 Ga0495670_0054050 3300046691 Bacteria 2011
140 Ga0495649_0028708 3300046694 Bacteria 3083
141 Ga0495604_0006234 3300047317 Bacteria 9461
142 Ga0495686_0002454 3300047472 Bacteria 17478
143 Ga0495686_0020483 3300047472 Bacteria 4409
144 Ga0495686_0125156 3300047472 Bacteria 1529
145 Ga0495686_0137369 3300047472 Bacteria 1445
146 Ga0496100_0012500 3300048903 Bacteria 4870
147 Ga0496102_0055407 3300048905 Bacteria 3616
148 Ga0496103_0017929 3300048906 Bacteria 4242
149 Ga0496111_0013316 3300048914 Bacteria 5593
150 Ga0496116_0007780 3300048919 Bacteria 9425
151 Ga0496116_0018079 3300048919 Bacteria 5448
152 Ga0496117_0000031 3300048920 Bacteria 381048
153 Ga0496117_0084546 3300048920 Bacteria 2070
154 Ga0496118_0001884 3300048921 Bacteria 29940
155 Ga0496118_0075819 3300048921 Bacteria 2396
156 Ga0496119_0006784 3300048922 Bacteria 10496
157 Ga0496119_0008507 3300048922 Bacteria 8999
158 Ga0496119_0020075 3300048922 Bacteria 4888
159 Ga0496120_0001817 3300048923 Bacteria 23874
160 Ga0496120_0006387 3300048923 Bacteria 9061
161 Ga0496120_0077370 3300048923 Bacteria 1811
162 Ga0496121_0005856 3300048924 Bacteria 15572
163 Ga0496121_0009335 3300048924 Bacteria 11309
164 Ga0496121_0011577 3300048924 Bacteria 9767
165 Ga0496121_0023654 3300048924 Bacteria 5907
166 Ga0496121_0171163 3300048924 Bacteria 1577
167 Ga0496122_0000023 3300048925 Bacteria 381035
168 Ga0496122_0000074 3300048925 Bacteria 219900
169 Ga0496122_0014239 3300048925 Bacteria 7706
170 Ga0496122_0032934 3300048925 Bacteria 4272
171 Ga0496123_0000027 3300048926 Bacteria 306773
172 Ga0496123_0000062 3300048926 Bacteria 219882
173 Ga0496123_0025979 3300048926 Bacteria 4400
174 Ga0496123_0041113 3300048926 Bacteria 3209
175 Ga0496124_0000130 3300048927 Bacteria 156467
176 Ga0496124_0015456 3300048927 Bacteria 7315
177 Ga0496124_0039884 3300048927 Bacteria 4066
178 Ga0496124_0050758 3300048927 Bacteria 3532
179 Ga0496124_0170907 3300048927 Bacteria 1683
180 Ga0496125_0029644 3300048928 Bacteria 4913
181 Ga0496125_0039838 3300048928 Bacteria 4039
182 Ga0496126_0024257 3300048929 Bacteria 5857
183 Ga0496126_0059477 3300048929 Bacteria 3441
184 Ga0501032_0003651 3300049569 Bacteria 11711
185 Ga0501033_0132432 3300049570 Bacteria 1806
186 Ga0501034_0185095 3300049571 Bacteria 2047
187 Ga0501037_0164650 3300049573 Bacteria 1579
188 Ga0501038_0138213 3300049574 Bacteria 1995
189 Ga0501042_0193538 3300049578 Bacteria 1467
190 Ga0501067_0000088 3300049583 Bacteria 53212
191 Ga0501070_0257703 3300049586 Bacteria 1426
192 Ga0501072_0224782 3300049588 Bacteria 1496
193 Ga0501073_0000181 3300049589 Bacteria 41171
194 Ga0501077_0010270 3300049593 Bacteria 5829
195 Ga0501080_0008074 3300049742 Bacteria 9540
196 Ga0501080_0325636 3300049742 Bacteria 1390
197 Ga0501083_0105954 3300049744 Bacteria 1851
198 Ga0501280_002312 3300049776 Bacteria 3218
199 Ga0501044_0002549 3300049823 Bacteria 20755
200 nmdc:mga00v17_3198_c2 3300050491 Bacteria 4822
201 nmdc:mga00v17_81778_c1 3300050491 Bacteria 2018
202 nmdc:mga0yw44_10615_c1 3300050492 Bacteria 4715
203 nmdc:mga0yw44_3796_c1 3300050492 Bacteria 6780
204 nmdc:mga0k408_41507_c1 3300050493 Bacteria 2649
205 nmdc:mga08y16_211440_c1 3300050511 Bacteria 2009
206 nmdc:mga08y16_32177_c1 3300050511 Bacteria 5515
207 Ga0500595_016503 3300053119 Bacteria 2749
208 Ga0500608_009686 3300053122 Bacteria 4101
209 Ga0500618_001516 3300053125 Bacteria 10229
210 Ga0500618_015010 3300053125 Bacteria 1965
211 Ga0500658_0000112 3300053134 Bacteria 38407
212 Ga0500573_0001302 3300053140 Bacteria 11807
213 Ga0500573_0009891 3300053140 Bacteria 5312
214 Ga0500616_0001952 3300053153 Bacteria 18397
215 Ga0500622_0001156 3300053156 Bacteria 21912
216 Ga0500622_0030436 3300053156 Bacteria 2834
217 Ga0500624_000401 3300053157 Bacteria 13438
218 Ga0500634_0055080 3300053161 Bacteria 2129
219 Ga0501082_0162580 3300060353 Bacteria 1940
220 2510841534 2510461069 Bacteria 5505000
221 2511133827 2510917022 Bacteria 6504556
222 2511174012 2510917026 Bacteria 7046020
223 2524458418 2524023209 Bacteria 6679728
224 2561467063 2558860983 Bacteria 4133860
225 2585271616 2582581307 Bacteria 6597605
226 2585280679 2582581308 Bacteria 7413247
227 2585326464 2582581315 Bacteria 7318924
228 2585334197 2582581316 Bacteria 7774528
229 2585531613 2585427527 Bacteria 7273426
230 2585551440 2585427530 Bacteria 7383882
231 2585563144 2585427531 Bacteria 6992870
232 2585902805 2585427608 Bacteria 6544331
233 2585907363 2585427609 Bacteria 6667127
234 2585997728 2585427633 Bacteria 6413184
235 2586002314 2585427634 Bacteria 6455027
236 2587982643 2585428125 Bacteria 6662905
237 2599720283 2599185236 Bacteria 6875203
238 2600373282 2600254933 Bacteria 4750527
239 2616306776 2615840626 Bacteria 7921970
240 2616557626 2615840698 Bacteria 7319877
241 2617383295 2617270742 Bacteria 6808054
242 2643813707 2643221558 Bacteria 5460675
243 2644299927 2643221653 Bacteria 4569637
244 2644658154 2643221719 Bacteria 4568197
245 2671113520 2667528174 Bacteria 6435400
246 2778173706 2775507266 Bacteria 7392367
247 2819244710 2818991272 Bacteria 4622173
248 2819560918 2818991439 Bacteria 6907412
249 2819611196 2818991448 Bacteria 6772224
250 2819638870 2818991453 Bacteria 7181617
251 2819687058 2818991461 Bacteria 7026071
252 2821128671 2821123053 Bacteria 7836056
253 2837651309 2837651117 Bacteria 3772164
254 2838030888 2838029111 Bacteria 6603031
255 2838741688 2838736955 Bacteria 5760694
256 2841845478 2841840854 Bacteria 5761912
257 2842145181 2842140634 Bacteria 5759631
258 2842300326 2842298080 Bacteria 6123127
259 2842361157 2842357229 Bacteria 6485165
260 2842477620 2842475841 Bacteria 6603183
261 2842487942 2842482326 Bacteria 7212537
262 2842504507 2842502639 Bacteria 6604161
263 2842511754 2842509118 Bacteria 6850950
264 2852391650 2852387548 Bacteria 8025568
265 2854897077 2854896431 Bacteria 5869725
266 2854917224 2854916844 Bacteria 5725939
267 2857534176 2857531043 Bacteria 6754041
268 2891051160 2891048133 Bacteria 4447501
269 2919175840 2919171160 Bacteria 6499771
270 2919411022 2919408235 Bacteria 6149349
271 2978969895 2978969890 Bacteria 5400756
272 2989780032 2989776772 Bacteria 4843317
273 2995394768 2995392953 Bacteria 4539380
274 3005421668 3005416602 Bacteria 7064308
275 8005249175 8005246636 Bacteria 4933972
276 8005319628 8005314921 Bacteria 7072929
277 8005490250 8005484373 Bacteria 6297373
278 8005646906 8005645114 Bacteria 6950293
279 8005688033 8005682033 Bacteria 6726518
280 8018155026 8018150411 Bacteria 5549903
281 8024490803 8024486573 Bacteria 6540512
282 8046768074 8046767195 Bacteria 7547379
283 8056878270 8056875544 Bacteria 4355797
284 8057581567 8057575449 Bacteria 7367519
285 Ga0495686_0000170
286 JGI24740J21852_10000013
287 JGI25162J39368_1000712
288 JGI25162J39368_1000879
289 JGI25162J39368_1001349
290 JGI25159J45721_1000630
291 JGI25165J46597_1000825
292 JGI25165J46597_1001035
293 JGI25153J46596_10023493
294 rootH1_10255604
295 JGI25160J50197_1000235
296 JGI25161J50226_1000175
297 Ga0055536_1009413
298 Ga0055540_1008906
299 Ga0055531_10005569
300 Ga0058692_1002165
301 Ga0058692_1008355
302 Ga0055543_1000226
303 Ga0065165_1002250
304 Ga0065165_1005353
305 Ga0070670_100000183
306 Ga0070668_100007052
307 Ga0070668_100189819
308 Ga0070669_100045964
309 Ga0070669_100145293
310 Ga0070675_100008231
311 Ga0070667_100048857
312 Ga0070667_100127698
313 Ga0070667_100175705
314 Ga0070665_100013812
315 Ga0068851_10018591
316 Ga0068851_10050469
317 Ga0068860_100414440
318 Ga0075365_10006666
319 Ga0075368_10000370
320 Ga0075364_10020214
321 Ga0075364_10108004
322 Ga0075369_10005003
323 Ga0075370_10095411
324 Ga0079104_1000195
325 Ga0105240_10000013
326 Ga0111539_10000224
327 Ga0111539_10319454
328 Ga0105243_10002616
329 Ga0105241_10140029
330 Ga0105242_10198950
331 Ga0105237_10002248
332 Ga0105239_10000820
333 Ga0105239_10488484
334 Ga0157371_10000108
335 Ga0157370_10000720
336 Ga0157369_10007099
337 Ga0182008_10004588
338 Ga0209563_105144
339 Ga0209437_100057
340 Ga0209437_100107
341 Ga0209677_100199
342 Ga0209233_1000072
343 Ga0209233_1000134
344 Ga0209233_1000331
345 Ga0209130_1000132
346 Ga0209676_1001884
347 Ga0209564_1014648
348 Ga0209758_1000570
349 Ga0209758_1012885
350 Ga0209050_1003271
351 Ga0207426_1000246
352 Ga0209051_1001505
353 Ga0209257_1000989
354 Ga0207688_10050651
355 Ga0207645_10065807
356 Ga0207654_10025519
357 Ga0207695_10000044
358 Ga0207671_10000226
359 Ga0207652_10041027
360 Ga0207681_10078575
361 Ga0207650_10000151
362 Ga0207659_10003449
363 Ga0207686_10126416
364 Ga0207668_10005108
365 Ga0207668_10076809
366 Ga0207658_10041656
367 Ga0207658_10063019
368 Ga0207678_10064161
369 Ga0207702_10109800
370 Ga0207648_10131480
371 Ga0207675_100125945
372 Ga0209281_1000028
373 Ga0209371_1001349
374 Ga0209371_1001563
375 Ga0207428_10133895
376 Ga0268266_10002167
377 Ga0268266_10048033
378 Ga0307515_10000434
379 Ga0307515_10027966
380 Ga0268256_1004513
381 Ga0265328_10033359
382 Ga0265340_10004673
383 Ga0265340_10005049
384 Ga0265339_10051659
385 Ga0265339_10057971
386 Ga0265316_10013721
387 Ga0307513_10030299
388 Ga0307408_100123139
389 Ga0265313_10001117
390 Ga0265313_10022532
391 Ga0265313_10030976
392 Ga0265313_10060318
393 Ga0265342_10006677
394 Ga0307412_10030678
395 Ga0307411_10185314
396 Ga0373927_0000135
397 Ga0373947_0058510
398 Ga0395900_0034923
399 Ga0395905_0001126
400 Ga0395905_0001760
401 Ga0466970_0013038
402 Ga0466957_0028365
403 Ga0466958_0116649
404 Ga0495627_034595
405 Ga0495638_0004212
406 Ga0495607_0058374
407 Ga0495606_0002374
408 Ga0495606_0017264
409 Ga0495610_0036363
410 Ga0495632_0038801
411 Ga0495643_0004293
412 Ga0495643_0065048
413 Ga0495663_0031670
414 Ga0495663_0037870
415 Ga0495654_0000308
416 Ga0495587_0042372
417 Ga0495597_0026461
418 Ga0495622_0029850
419 Ga0495625_0110140
420 Ga0495588_0000643
421 Ga0495588_0088626
422 Ga0495657_0061271
423 Ga0495670_0054050
424 Ga0495649_0028708
425 Ga0495604_0006234
426 Ga0495686_0002454
427 Ga0495686_0020483
428 Ga0495686_0125156
429 Ga0495686_0137369
430 Ga0496100_0012500
431 Ga0496102_0055407
432 Ga0496103_0017929
433 Ga0496111_0013316
434 Ga0496116_0007780
435 Ga0496116_0018079
436 Ga0496117_0000031
437 Ga0496117_0084546
438 Ga0496118_0001884
439 Ga0496118_0075819
440 Ga0496119_0006784
441 Ga0496119_0008507
442 Ga0496119_0020075
443 Ga0496120_0001817
444 Ga0496120_0006387
445 Ga0496120_0077370
446 Ga0496121_0005856
447 Ga0496121_0009335
448 Ga0496121_0011577
449 Ga0496121_0023654
450 Ga0496121_0171163
451 Ga0496122_0000023
452 Ga0496122_0000074
453 Ga0496122_0014239
454 Ga0496122_0032934
455 Ga0496123_0000027
456 Ga0496123_0000062
457 Ga0496123_0025979
458 Ga0496123_0041113
459 Ga0496124_0000130
460 Ga0496124_0015456
461 Ga0496124_0039884
462 Ga0496124_0050758
463 Ga0496124_0170907
464 Ga0496125_0029644
465 Ga0496125_0039838
466 Ga0496126_0024257
467 Ga0496126_0059477
468 Ga0501032_0003651
469 Ga0501033_0132432
470 Ga0501034_0185095
471 Ga0501037_0164650
472 Ga0501038_0138213
473 Ga0501042_0193538
474 Ga0501067_0000088
475 Ga0501070_0257703
476 Ga0501072_0224782
477 Ga0501073_0000181
478 Ga0501077_0010270
479 Ga0501080_0008074
480 Ga0501080_0325636
481 Ga0501083_0105954
482 Ga0501280_002312
483 Ga0501044_0002549
484 nmdc:mga00v17_3198_c2
485 nmdc:mga00v17_81778_c1
486 nmdc:mga0yw44_10615_c1
487 nmdc:mga0yw44_3796_c1
488 nmdc:mga0k408_41507_c1
489 nmdc:mga08y16_211440_c1
490 nmdc:mga08y16_32177_c1
491 Ga0500595_016503
492 Ga0500608_009686
493 Ga0500618_001516
494 Ga0500618_015010
495 Ga0500658_0000112
496 Ga0500573_0001302
497 Ga0500573_0009891
498 Ga0500616_0001952
499 Ga0500622_0001156
500 Ga0500622_0030436
501 Ga0500624_000401
502 Ga0500634_0055080
503 Ga0501082_0162580
504 2510841534
505 2511133827
506 2511174012
507 2524458418
508 2561467063
509 2585271616
510 2585280679
511 2585326464
512 2585334197
513 2585531613
514 2585551440
515 2585563144
516 2585902805
517 2585907363
518 2585997728
519 2586002314
520 2587982643
521 2599720283
522 2600373282
523 2616306776
524 2616557626
525 2617383295
526 2643813707
527 2644299927
528 2644658154
529 2671113520
530 2778173706
531 2819244710
532 2819560918
533 2819611196
534 2819638870
535 2819687058
536 2821128671
537 2837651309
538 2838030888
539 2838741688
540 2841845478
541 2842145181
542 2842300326
543 2842361157
544 2842477620
545 2842487942
546 2842504507
547 2842511754
548 2852391650
549 2854897077
550 2854917224
551 2857534176
552 2891051160
553 2919175840
554 2919411022
555 2978969895
556 2989780032
557 2995394768
558 3005421668
559 8005249175
560 8005319628
561 8005490250
562 8005646906
563 8005688033
564 8018155026
565 8024490803
566 8046768074
567 8056878270
568 8057581567

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05977

MFS_3

Transmembrane secretion effector

194

456

0.83

PF07690

MFS_1

Major Facilitator Superfamily

24

327

0.83

PF05977

MFS_3

Transmembrane secretion effector

10

198

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kkk-assembly3.cif.gz_C crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation (h115a mutant) 0.8395 16 407
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.835 16 399
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8287 16 399
6kkk-assembly3.cif.gz_C crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation (h115a mutant) 0.8276 16 407
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.8174 16 399
ID Description Score Start End Superfamily
af_P24077_14_401_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9527 15 399 1.20.1250.20
af_P24077_14_401_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9432 15 399 1.20.1250.20
af_Q2G2B3_4_390_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9167 11 393 1.20.1250.20
af_Q2G2B3_4_390_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9055 11 393 1.20.1250.20
af_Q2G1R0_3_202_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9049 8 208 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1H1JG38-F1-model_v4 Transmembrane secretion effector 0.9885 11 407 GO:0005886
AF-H0G365-F1-model_v4 Major facilitator superfamily protein 0.9879 9 413 GO:0005886
GO:0022857
AF-A0A436LUG6-F1-model_v4 deleted 0.9869 132 410
AF-J3FEV1-F1-model_v4 Arabinose efflux permease family protein 0.9864 14 411 GO:0005886
GO:0022857
AF-A0A1M5I855-F1-model_v4 Transmembrane secretion effector 0.9863 13 410 GO:0005886

Map