F386940

General Info

Members Datasets Scaffolds Average Seq Length
285 190 570 147

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0709042|Ga0395901_0709042_369_815
Length 148
Sequence MRIAVAADERVGVAEAVLQALRDRGHEVVAAHGALSDAERDDWAWCAEAAARDVAEGRADQGVVCCWTGTGASIAANKVPGIRAALCGDAATADGARRWNDANVLALSLRATSEAELAEILDAWFSAGPSTDAGDTANVAHLAEIERR

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
190 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.16
Nodule 0
Rhizoplane 13.68
Rhizosphere 81.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0709042 3300038443 Bacteria 1003
2 Ga0070683_100258093 3300005329 Bacteria 1658
3 Ga0068869_101458030 3300005334 Bacteria 607
4 Ga0070682_100241124 3300005337 Bacteria 1298
5 Ga0068868_100821809 3300005338 Bacteria 840
6 Ga0070689_100132508 3300005340 Bacteria 1999
7 Ga0070691_10144055 3300005341 Bacteria 1217
8 Ga0070691_10165402 3300005341 Bacteria 1143
9 Ga0070687_100015400 3300005343 Bacteria 3458
10 Ga0070671_100158950 3300005355 Bacteria 1910
11 Ga0070674_100178339 3300005356 Bacteria 1625
12 Ga0070688_100105911 3300005365 Bacteria 1862
13 Ga0070659_100965473 3300005366 Bacteria 747
14 Ga0070711_100033664 3300005439 Bacteria 3413
15 Ga0070705_100076516 3300005440 Bacteria 2041
16 Ga0070700_100338196 3300005441 Bacteria 1112
17 Ga0070694_100175861 3300005444 Bacteria 1580
18 Ga0070694_100792756 3300005444 Bacteria 776
19 Ga0070708_101635867 3300005445 Bacteria 599
20 Ga0070663_100263455 3300005455 Bacteria 1368
21 Ga0070663_100641943 3300005455 Bacteria 897
22 Ga0070678_100047506 3300005456 Bacteria 3084
23 Ga0070662_100902511 3300005457 Bacteria 754
24 Ga0070681_10918599 3300005458 Bacteria 794
25 Ga0068867_101709879 3300005459 Bacteria 590
26 Ga0070698_100352726 3300005471 Bacteria 1403
27 Ga0070679_101517878 3300005530 Bacteria 617
28 Ga0070684_100090932 3300005535 Bacteria 2715
29 Ga0070684_100201901 3300005535 Bacteria 1811
30 Ga0070693_100649794 3300005547 Bacteria 767
31 Ga0070704_100042400 3300005549 Bacteria 3148
32 Ga0070704_101306701 3300005549 Bacteria 664
33 Ga0070664_101337051 3300005564 Bacteria 677
34 Ga0068857_100067190 3300005577 Bacteria 3191
35 Ga0068854_100159235 3300005578 Bacteria 1747
36 Ga0070702_100030159 3300005615 Bacteria 2954
37 Ga0068859_101130815 3300005617 Bacteria 862
38 Ga0068864_100165621 3300005618 Bacteria 2012
39 Ga0068866_10438632 3300005718 Bacteria 851
40 Ga0068861_100059804 3300005719 Bacteria 2919
41 Ga0068863_100562456 3300005841 Bacteria 1127
42 Ga0068863_101399825 3300005841 Bacteria 707
43 Ga0068858_100332171 3300005842 Bacteria 1454
44 Ga0068860_100698157 3300005843 Bacteria 1024
45 Ga0068862_101394775 3300005844 Bacteria 704
46 Ga0068862_101458054 3300005844 Bacteria 689
47 Ga0081540_1001536 3300005983 Bacteria 19829
48 Ga0081539_10008201 3300005985 Bacteria 9199
49 Ga0075365_10000105 3300006038 Bacteria 24752
50 Ga0075363_100287084 3300006048 Bacteria 953
51 Ga0075364_10010885 3300006051 Bacteria 5512
52 Ga0075364_10041171 3300006051 Bacteria 2999
53 Ga0070716_100195669 3300006173 Bacteria 1339
54 Ga0070712_100000004 3300006175 Bacteria 215464
55 Ga0070712_100039511 3300006175 Bacteria 3229
56 Ga0070712_100227127 3300006175 Bacteria 1481
57 Ga0097621_101138670 3300006237 Bacteria 733
58 Ga0075430_100183673 3300006846 Bacteria 1739
59 Ga0075431_100002880 3300006847 Bacteria 16650
60 Ga0075431_100482672 3300006847 Bacteria 1232
61 Ga0075431_101017242 3300006847 Bacteria 795
62 Ga0075433_10100722 3300006852 Bacteria 2558
63 Ga0075433_11293306 3300006852 Bacteria 632
64 Ga0075434_100018761 3300006871 Bacteria 6687
65 Ga0075434_100385211 3300006871 Bacteria 1423
66 Ga0068865_100053121 3300006881 Bacteria 2811
67 Ga0068865_100523522 3300006881 Bacteria 992
68 Ga0068865_100937162 3300006881 Bacteria 755
69 Ga0097620_101130896 3300006931 Bacteria 862
70 Ga0075435_100051666 3300007076 Bacteria 3311
71 Ga0105240_12020641 3300009093 Bacteria 599
72 Ga0111539_10016378 3300009094 Bacteria 9192
73 Ga0111539_10404250 3300009094 Bacteria 1590
74 Ga0105245_10085240 3300009098 Bacteria 2896
75 Ga0105245_10182922 3300009098 Bacteria 2004
76 Ga0105247_10075005 3300009101 Bacteria 2122
77 Ga0105247_10321810 3300009101 Bacteria 1079
78 Ga0114129_10060792 3300009147 Bacteria 5281
79 Ga0114129_10175490 3300009147 Bacteria 2919
80 Ga0114129_11035391 3300009147 Bacteria 1031
81 Ga0105243_10020963 3300009148 Bacteria 4959
82 Ga0105243_10045766 3300009148 Bacteria 3440
83 Ga0105243_12067952 3300009148 Bacteria 605
84 Ga0105248_10365618 3300009177 Bacteria 1624
85 Ga0105248_10688644 3300009177 Bacteria 1153
86 Ga0105249_10244904 3300009553 Bacteria 1774
87 Ga0105249_10420690 3300009553 Bacteria 1370
88 Ga0105249_11200344 3300009553 Bacteria 830
89 Ga0157318_1013462 3300012482 Bacteria 645
90 Ga0157369_11030020 3300013105 Bacteria 842
91 Ga0157378_10288497 3300013297 Bacteria 1584
92 Ga0157372_11077442 3300013307 Bacteria 930
93 Ga0157375_10267487 3300013308 Bacteria 1871
94 Ga0163163_10407633 3300014325 Bacteria 1418
95 Ga0157380_12825007 3300014326 Bacteria 552
96 Ga0182008_10391695 3300014497 Bacteria 744
97 Ga0157377_10006347 3300014745 Bacteria 5632
98 Ga0157379_10389464 3300014968 Bacteria 1280
99 Ga0207710_10173715 3300025900 Bacteria 1054
100 Ga0207710_10551070 3300025900 Bacteria 601
101 Ga0207688_10048695 3300025901 Bacteria 2368
102 Ga0207688_10121341 3300025901 Bacteria 1526
103 Ga0207688_10472768 3300025901 Bacteria 783
104 Ga0207643_10174750 3300025908 Bacteria 1298
105 Ga0207654_10462669 3300025911 Bacteria 891
106 Ga0207693_10000105 3300025915 Bacteria 75790
107 Ga0207693_10001174 3300025915 Bacteria 23373
108 Ga0207693_10244300 3300025915 Bacteria 1409
109 Ga0207662_10013329 3300025918 Bacteria 4597
110 Ga0207652_10621610 3300025921 Bacteria 968
111 Ga0207650_11046178 3300025925 Bacteria 695
112 Ga0207687_10314935 3300025927 Bacteria 1265
113 Ga0207644_10628373 3300025931 Bacteria 893
114 Ga0207644_11450858 3300025931 Bacteria 576
115 Ga0207706_10281630 3300025933 Bacteria 1450
116 Ga0207709_10201005 3300025935 Bacteria 1423
117 Ga0207704_10211747 3300025938 Bacteria 1427
118 Ga0207704_10500881 3300025938 Bacteria 979
119 Ga0207665_10414130 3300025939 Bacteria 1028
120 Ga0207711_10330048 3300025941 Bacteria 1411
121 Ga0207661_11647858 3300025944 Bacteria 586
122 Ga0207679_10222007 3300025945 Bacteria 1590
123 Ga0207679_10921222 3300025945 Bacteria 800
124 Ga0207712_10709724 3300025961 Bacteria 878
125 Ga0207712_10994437 3300025961 Bacteria 744
126 Ga0207668_10269634 3300025972 Bacteria 1391
127 Ga0207640_10096731 3300025981 Bacteria 2059
128 Ga0207677_10064869 3300026023 Bacteria 2545
129 Ga0207677_11295653 3300026023 Bacteria 669
130 Ga0207639_10503037 3300026041 Bacteria 1107
131 Ga0207678_10273241 3300026067 Bacteria 1450
132 Ga0207678_10506976 3300026067 Bacteria 1052
133 Ga0207708_10046281 3300026075 Bacteria 3313
134 Ga0207708_10066339 3300026075 Bacteria 2759
135 Ga0207702_11506741 3300026078 Bacteria 666
136 Ga0207702_11639531 3300026078 Bacteria 636
137 Ga0207641_10371416 3300026088 Bacteria 1368
138 Ga0207676_10631374 3300026095 Bacteria 1032
139 Ga0207674_10074804 3300026116 Bacteria 3398
140 Ga0207675_100046425 3300026118 Bacteria 4058
141 Ga0207675_101847645 3300026118 Bacteria 623
142 Ga0207698_11556331 3300026142 Bacteria 676
143 Ga0207428_10271268 3300027907 Bacteria 1261
144 Ga0268265_10394256 3300028380 Bacteria 1278
145 Ga0268264_10943200 3300028381 Bacteria 868
146 Ga0307513_10102761 3300031456 Bacteria 2876
147 Ga0307405_10072021 3300031731 Bacteria 2226
148 Ga0307406_10753498 3300031901 Bacteria 818
149 Ga0307406_11228398 3300031901 Bacteria 652
150 Ga0307412_10184096 3300031911 Bacteria 1574
151 Ga0307409_100367882 3300031995 Bacteria 1362
152 Ga0307416_100002079 3300032002 Bacteria 11294
153 Ga0307416_100840061 3300032002 Bacteria 1016
154 Ga0307507_10304883 3300033179 Bacteria 972
155 Ga0373931_0306892 3300035691 Bacteria 982
156 Ga0373935_0646472 3300035692 Bacteria 776
157 Ga0395899_0032830 3300037312 Bacteria 3901
158 Ga0395900_0037457 3300037418 Bacteria 5000
159 Ga0395900_0317963 3300037418 Bacteria 1538
160 Ga0395900_0659547 3300037418 Bacteria 982
161 Ga0395900_0899406 3300037418 Bacteria 809
162 Ga0395898_0003610 3300037466 Bacteria 17228
163 Ga0395898_0033468 3300037466 Bacteria 5129
164 Ga0395898_0135929 3300037466 Bacteria 2354
165 Ga0395898_0240614 3300037466 Bacteria 1726
166 Ga0395898_0449420 3300037466 Bacteria 1227
167 Ga0395898_0849030 3300037466 Bacteria 852
168 Ga0395905_0046192 3300037471 Bacteria 4083
169 Ga0395905_0434998 3300037471 Bacteria 1209
170 Ga0395901_0039546 3300038443 Bacteria 4880
171 Ga0395901_0067916 3300038443 Bacteria 3714
172 Ga0395901_0194605 3300038443 Bacteria 2126
173 Ga0395901_0681546 3300038443 Bacteria 1028
174 Ga0395901_1411951 3300038443 Bacteria 654
175 Ga0436365_0642475 3300039437 Bacteria 923
176 Ga0436363_0367379 3300039450 Bacteria 913
177 Ga0451853_1497791 3300041512 Bacteria 595
178 Ga0466965_0536511 3300044683 Bacteria 659
179 Ga0466960_0157015 3300044901 Bacteria 1219
180 Ga0466967_0696409 3300045976 Bacteria 1006
181 Ga0495641_0049769 3300046461 Bacteria 1917
182 Ga0495651_0001124 3300046462 Bacteria 20699
183 Ga0495580_0830984 3300046472 Bacteria 597
184 Ga0495584_0214309 3300046491 Bacteria 979
185 Ga0495585_0237310 3300046492 Bacteria 914
186 Ga0495607_0141413 3300046501 Bacteria 1241
187 Ga0495628_0018532 3300046516 Bacteria 5763
188 Ga0495652_0004135 3300046529 Bacteria 14001
189 Ga0495661_0550010 3300046665 Bacteria 546
190 Ga0495600_0003666 3300046809 Bacteria 9069
191 Ga0495581_0407729 3300047315 Bacteria 793
192 Ga0495581_0754703 3300047315 Bacteria 560
193 Ga0495676_0038792 3300047321 Bacteria 3953
194 Ga0496101_0185469 3300048904 Bacteria 1604
195 Ga0496101_0402095 3300048904 Bacteria 1078
196 Ga0496102_0159342 3300048905 Bacteria 2122
197 Ga0496102_0227084 3300048905 Bacteria 1760
198 Ga0496103_0001299 3300048906 Bacteria 17003
199 Ga0496103_0380767 3300048906 Bacteria 907
200 Ga0496104_0046089 3300048907 Bacteria 4103
201 Ga0496104_0246654 3300048907 Bacteria 1699
202 Ga0496105_0014438 3300048908 Bacteria 6287
203 Ga0496106_0002675 3300048909 Bacteria 13255
204 Ga0496106_0035977 3300048909 Bacteria 3703
205 Ga0496106_0083893 3300048909 Bacteria 2451
206 Ga0496106_0145625 3300048909 Bacteria 1866
207 Ga0496107_0006242 3300048910 Bacteria 8193
208 Ga0496107_0214864 3300048910 Bacteria 1430
209 Ga0496107_0226046 3300048910 Bacteria 1392
210 Ga0496107_0228983 3300048910 Bacteria 1383
211 Ga0496108_0010881 3300048911 Bacteria 7387
212 Ga0496108_0047375 3300048911 Bacteria 3593
213 Ga0496108_0391488 3300048911 Bacteria 1214
214 Ga0496109_0178458 3300048912 Bacteria 1994
215 Ga0496109_0179987 3300048912 Bacteria 1985
216 Ga0496109_0932164 3300048912 Bacteria 806
217 Ga0496109_1640779 3300048912 Bacteria 577
218 Ga0496110_0025326 3300048913 Bacteria 5069
219 Ga0496110_0087620 3300048913 Bacteria 2780
220 Ga0496110_0210141 3300048913 Bacteria 1769
221 Ga0496110_0620910 3300048913 Bacteria 979
222 Ga0496111_0018671 3300048914 Bacteria 4806
223 Ga0496111_0051971 3300048914 Bacteria 2959
224 Ga0496111_0089135 3300048914 Bacteria 2259
225 Ga0496112_0169785 3300048915 Bacteria 2147
226 Ga0496112_0606402 3300048915 Bacteria 1026
227 Ga0496113_0054062 3300048916 Bacteria 3004
228 Ga0496114_0015069 3300048917 Bacteria 6216
229 Ga0496114_0302242 3300048917 Bacteria 1413
230 Ga0496115_0010891 3300048918 Bacteria 6808
231 Ga0496115_0213379 3300048918 Bacteria 1594
232 Ga0496115_1314890 3300048918 Bacteria 538
233 Ga0501032_0052685 3300049569 Bacteria 2742
234 Ga0501036_0043989 3300049572 Bacteria 3782
235 Ga0501036_0587333 3300049572 Bacteria 925
236 Ga0501038_0025870 3300049574 Bacteria 5228
237 Ga0501038_0236700 3300049574 Bacteria 1451
238 Ga0501039_0093216 3300049575 Bacteria 2347
239 Ga0501039_0307832 3300049575 Bacteria 1245
240 Ga0501040_0066019 3300049576 Bacteria 2493
241 Ga0501041_0102478 3300049577 Bacteria 1772
242 Ga0501042_0252597 3300049578 Bacteria 1272
243 Ga0501043_0026634 3300049579 Bacteria 4537
244 Ga0501046_0004734 3300049580 Bacteria 12277
245 Ga0501046_0077667 3300049580 Bacteria 2570
246 Ga0501047_0795353 3300049581 Bacteria 761
247 Ga0501048_0217956 3300049582 Bacteria 1353
248 Ga0501067_0574749 3300049583 Bacteria 632
249 Ga0501071_0038134 3300049587 Bacteria 3433
250 Ga0501071_0396751 3300049587 Bacteria 1053
251 Ga0501072_0004500 3300049588 Bacteria 10595
252 Ga0501073_0155534 3300049589 Bacteria 1585
253 Ga0501074_0096865 3300049590 Bacteria 2112
254 Ga0501075_0022969 3300049591 Bacteria 4562
255 Ga0501076_0009675 3300049592 Bacteria 7121
256 Ga0501077_0407432 3300049593 Bacteria 869
257 Ga0501079_0030595 3300049741 Bacteria 4137
258 Ga0501081_0022478 3300049743 Bacteria 4221
259 Ga0501035_0231628 3300049822 Bacteria 1574
260 Ga0501035_0377204 3300049822 Bacteria 1183
261 Ga0501044_0142806 3300049823 Bacteria 2381
262 Ga0501045_0041993 3300049824 Bacteria 3328
263 Ga0501045_1092924 3300049824 Bacteria 583
264 nmdc:mga03n38_382394_c1 3300050490 Bacteria 772
265 nmdc:mga00v17_40277_c1 3300050491 Bacteria 2802
266 nmdc:mga00v17_426720_c1 3300050491 Bacteria 861
267 nmdc:mga0yw44_168603_c1 3300050492 Bacteria 1437
268 nmdc:mga0yw44_2574_c1 3300050492 Bacteria 7794
269 nmdc:mga05p37_104349_c1 3300050507 Bacteria 3487
270 nmdc:mga05p37_1704081_c1 3300050507 Bacteria 614
271 nmdc:mga05p37_330461_c1 3300050507 Bacteria 1801
272 nmdc:mga09592_231496_c1 3300050508 Bacteria 1601
273 nmdc:mga0qj67_187097_c1 3300050509 Bacteria 1682
274 nmdc:mga06r32_77915_c1 3300050510 Bacteria 3221
275 nmdc:mga0n895_393422_c1 3300050512 Bacteria 1402
276 nmdc:mga0n895_413733_c1 3300050512 Bacteria 1363
277 nmdc:mga0n895_676161_c1 3300050512 Bacteria 1029
278 nmdc:mga0rr50_147606_c1 3300050513 Bacteria 1897
279 nmdc:mga0a205_42496_c1 3300050515 Bacteria 4380
280 Ga0495655_0200422 3300053083 Bacteria 652
281 Ga0501084_0042348 3300054114 Bacteria 3809
282 Ga0501082_0007153 3300060353 Bacteria 9619
283 Ga0530510_0227605 3300061734 Bacteria 1387
284 Ga0530510_0496647 3300061734 Bacteria 925
285 2791916548 2791354901 Bacteria 8322202
286 Ga0395901_0709042
287 Ga0070683_100258093
288 Ga0068869_101458030
289 Ga0070682_100241124
290 Ga0068868_100821809
291 Ga0070689_100132508
292 Ga0070691_10144055
293 Ga0070691_10165402
294 Ga0070687_100015400
295 Ga0070671_100158950
296 Ga0070674_100178339
297 Ga0070688_100105911
298 Ga0070659_100965473
299 Ga0070711_100033664
300 Ga0070705_100076516
301 Ga0070700_100338196
302 Ga0070694_100175861
303 Ga0070694_100792756
304 Ga0070708_101635867
305 Ga0070663_100263455
306 Ga0070663_100641943
307 Ga0070678_100047506
308 Ga0070662_100902511
309 Ga0070681_10918599
310 Ga0068867_101709879
311 Ga0070698_100352726
312 Ga0070679_101517878
313 Ga0070684_100090932
314 Ga0070684_100201901
315 Ga0070693_100649794
316 Ga0070704_100042400
317 Ga0070704_101306701
318 Ga0070664_101337051
319 Ga0068857_100067190
320 Ga0068854_100159235
321 Ga0070702_100030159
322 Ga0068859_101130815
323 Ga0068864_100165621
324 Ga0068866_10438632
325 Ga0068861_100059804
326 Ga0068863_100562456
327 Ga0068863_101399825
328 Ga0068858_100332171
329 Ga0068860_100698157
330 Ga0068862_101394775
331 Ga0068862_101458054
332 Ga0081540_1001536
333 Ga0081539_10008201
334 Ga0075365_10000105
335 Ga0075363_100287084
336 Ga0075364_10010885
337 Ga0075364_10041171
338 Ga0070716_100195669
339 Ga0070712_100000004
340 Ga0070712_100039511
341 Ga0070712_100227127
342 Ga0097621_101138670
343 Ga0075430_100183673
344 Ga0075431_100002880
345 Ga0075431_100482672
346 Ga0075431_101017242
347 Ga0075433_10100722
348 Ga0075433_11293306
349 Ga0075434_100018761
350 Ga0075434_100385211
351 Ga0068865_100053121
352 Ga0068865_100523522
353 Ga0068865_100937162
354 Ga0097620_101130896
355 Ga0075435_100051666
356 Ga0105240_12020641
357 Ga0111539_10016378
358 Ga0111539_10404250
359 Ga0105245_10085240
360 Ga0105245_10182922
361 Ga0105247_10075005
362 Ga0105247_10321810
363 Ga0114129_10060792
364 Ga0114129_10175490
365 Ga0114129_11035391
366 Ga0105243_10020963
367 Ga0105243_10045766
368 Ga0105243_12067952
369 Ga0105248_10365618
370 Ga0105248_10688644
371 Ga0105249_10244904
372 Ga0105249_10420690
373 Ga0105249_11200344
374 Ga0157318_1013462
375 Ga0157369_11030020
376 Ga0157378_10288497
377 Ga0157372_11077442
378 Ga0157375_10267487
379 Ga0163163_10407633
380 Ga0157380_12825007
381 Ga0182008_10391695
382 Ga0157377_10006347
383 Ga0157379_10389464
384 Ga0207710_10173715
385 Ga0207710_10551070
386 Ga0207688_10048695
387 Ga0207688_10121341
388 Ga0207688_10472768
389 Ga0207643_10174750
390 Ga0207654_10462669
391 Ga0207693_10000105
392 Ga0207693_10001174
393 Ga0207693_10244300
394 Ga0207662_10013329
395 Ga0207652_10621610
396 Ga0207650_11046178
397 Ga0207687_10314935
398 Ga0207644_10628373
399 Ga0207644_11450858
400 Ga0207706_10281630
401 Ga0207709_10201005
402 Ga0207704_10211747
403 Ga0207704_10500881
404 Ga0207665_10414130
405 Ga0207711_10330048
406 Ga0207661_11647858
407 Ga0207679_10222007
408 Ga0207679_10921222
409 Ga0207712_10709724
410 Ga0207712_10994437
411 Ga0207668_10269634
412 Ga0207640_10096731
413 Ga0207677_10064869
414 Ga0207677_11295653
415 Ga0207639_10503037
416 Ga0207678_10273241
417 Ga0207678_10506976
418 Ga0207708_10046281
419 Ga0207708_10066339
420 Ga0207702_11506741
421 Ga0207702_11639531
422 Ga0207641_10371416
423 Ga0207676_10631374
424 Ga0207674_10074804
425 Ga0207675_100046425
426 Ga0207675_101847645
427 Ga0207698_11556331
428 Ga0207428_10271268
429 Ga0268265_10394256
430 Ga0268264_10943200
431 Ga0307513_10102761
432 Ga0307405_10072021
433 Ga0307406_10753498
434 Ga0307406_11228398
435 Ga0307412_10184096
436 Ga0307409_100367882
437 Ga0307416_100002079
438 Ga0307416_100840061
439 Ga0307507_10304883
440 Ga0373931_0306892
441 Ga0373935_0646472
442 Ga0395899_0032830
443 Ga0395900_0037457
444 Ga0395900_0317963
445 Ga0395900_0659547
446 Ga0395900_0899406
447 Ga0395898_0003610
448 Ga0395898_0033468
449 Ga0395898_0135929
450 Ga0395898_0240614
451 Ga0395898_0449420
452 Ga0395898_0849030
453 Ga0395905_0046192
454 Ga0395905_0434998
455 Ga0395901_0039546
456 Ga0395901_0067916
457 Ga0395901_0194605
458 Ga0395901_0681546
459 Ga0395901_1411951
460 Ga0436365_0642475
461 Ga0436363_0367379
462 Ga0451853_1497791
463 Ga0466965_0536511
464 Ga0466960_0157015
465 Ga0466967_0696409
466 Ga0495641_0049769
467 Ga0495651_0001124
468 Ga0495580_0830984
469 Ga0495584_0214309
470 Ga0495585_0237310
471 Ga0495607_0141413
472 Ga0495628_0018532
473 Ga0495652_0004135
474 Ga0495661_0550010
475 Ga0495600_0003666
476 Ga0495581_0407729
477 Ga0495581_0754703
478 Ga0495676_0038792
479 Ga0496101_0185469
480 Ga0496101_0402095
481 Ga0496102_0159342
482 Ga0496102_0227084
483 Ga0496103_0001299
484 Ga0496103_0380767
485 Ga0496104_0046089
486 Ga0496104_0246654
487 Ga0496105_0014438
488 Ga0496106_0002675
489 Ga0496106_0035977
490 Ga0496106_0083893
491 Ga0496106_0145625
492 Ga0496107_0006242
493 Ga0496107_0214864
494 Ga0496107_0226046
495 Ga0496107_0228983
496 Ga0496108_0010881
497 Ga0496108_0047375
498 Ga0496108_0391488
499 Ga0496109_0178458
500 Ga0496109_0179987
501 Ga0496109_0932164
502 Ga0496109_1640779
503 Ga0496110_0025326
504 Ga0496110_0087620
505 Ga0496110_0210141
506 Ga0496110_0620910
507 Ga0496111_0018671
508 Ga0496111_0051971
509 Ga0496111_0089135
510 Ga0496112_0169785
511 Ga0496112_0606402
512 Ga0496113_0054062
513 Ga0496114_0015069
514 Ga0496114_0302242
515 Ga0496115_0010891
516 Ga0496115_0213379
517 Ga0496115_1314890
518 Ga0501032_0052685
519 Ga0501036_0043989
520 Ga0501036_0587333
521 Ga0501038_0025870
522 Ga0501038_0236700
523 Ga0501039_0093216
524 Ga0501039_0307832
525 Ga0501040_0066019
526 Ga0501041_0102478
527 Ga0501042_0252597
528 Ga0501043_0026634
529 Ga0501046_0004734
530 Ga0501046_0077667
531 Ga0501047_0795353
532 Ga0501048_0217956
533 Ga0501067_0574749
534 Ga0501071_0038134
535 Ga0501071_0396751
536 Ga0501072_0004500
537 Ga0501073_0155534
538 Ga0501074_0096865
539 Ga0501075_0022969
540 Ga0501076_0009675
541 Ga0501077_0407432
542 Ga0501079_0030595
543 Ga0501081_0022478
544 Ga0501035_0231628
545 Ga0501035_0377204
546 Ga0501044_0142806
547 Ga0501045_0041993
548 Ga0501045_1092924
549 nmdc:mga03n38_382394_c1
550 nmdc:mga00v17_40277_c1
551 nmdc:mga00v17_426720_c1
552 nmdc:mga0yw44_168603_c1
553 nmdc:mga0yw44_2574_c1
554 nmdc:mga05p37_104349_c1
555 nmdc:mga05p37_1704081_c1
556 nmdc:mga05p37_330461_c1
557 nmdc:mga09592_231496_c1
558 nmdc:mga0qj67_187097_c1
559 nmdc:mga06r32_77915_c1
560 nmdc:mga0n895_393422_c1
561 nmdc:mga0n895_413733_c1
562 nmdc:mga0n895_676161_c1
563 nmdc:mga0rr50_147606_c1
564 nmdc:mga0a205_42496_c1
565 Ga0495655_0200422
566 Ga0501084_0042348
567 Ga0501082_0007153
568 Ga0530510_0227605
569 Ga0530510_0496647
570 2791916548

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

3

142

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lfk-assembly1.cif.gz_B crystal structure of d-galactose-6-phosphate isomerase in a substrate-free form 0.9254 1 142
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.9165 2 146
6fxw-assembly1.cif.gz_A structure of leishmania infantum type b ribose 5-phosphate isomerase 0.9159 2 149
1nn4-assembly1.cif.gz_A structural genomics, rpib/alsb 0.9141 2 145
1o1x-assembly1.cif.gz_A crystal structure of a ribose 5-phosphate isomerase rpib (tm1080) from thermotoga maritima at 1.90 a resolution 0.9132 2 142
ID Description Score Start End Superfamily
4lfkB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9254 1 142 3.40.1400.10
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.915 2 146 3.40.1400.10
5ifzB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9108 1 126 3.40.1400.10
1o1xA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9107 2 142 3.40.1400.10
af_P9WKD7_1_162_3.40.1400.10 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.908 1 145 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A7V9LGD1-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 0.9995 1 144 GO:0004751
GO:0009052
GO:0019316
AF-A0A4R7MGP4-F1-model_v4 Ribose 5-phosphate isomerase B 0.9991 1 147 GO:0004751
GO:0009052
GO:0019316
AF-A0A0F9CPN2-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 0.9968 2 129 GO:0004751
GO:0009052
GO:0019316
AF-A0A5P2W7Q6-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 0.9955 1 144 GO:0004751
GO:0009052
GO:0019316
AF-A0A2W6C075-F1-model_v4 Galactose isomerase 0.9951 1 147 GO:0004751
GO:0009052
GO:0019316

Map