F386922

General Info

Members Datasets Scaffolds Average Seq Length
285 133 570 278

Family's Representative Sequence

Representative Sequence 3300035724|Ga0373933_0079172|Ga0373933_0079172_167_1090
Length 298
Sequence MKSGGSPKRDGRPPAGRPRGQEQTLRGGSGIAGENRRNCEFQLLRYVPDALRNEYVHIGVILREQGSDKPAEVRFTRDWRRLRCLDPEADTALLEGMESELRRRFQEEPQGRLMRLLEESLSLNVQMTEPKAYLAESLPAGMEELMRLYVEPLRRERIPRLRGRAAIQATMRGEFERAGVWDLLRKQIAARDYTRPGDPLRIDLGYRPNGVIRMFHAVSLEPGVEMAKVLAFSRVEKAALELTAVIEPAAKIGATDEDPERLEMYRFGVETMEEHQIRVLTTSDMGRVADTARRELRV

Samples

Sample ID Description Type Environment
1 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
94 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
123 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.51
Rhizosphere 96.14
Stem 0
Stem Tuber 0
Unclassified 21.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373933_0079172 3300035724 Bacteria 2012
2 rootH1_10239311 3300003323 Unclassified 2321
3 Ga0070658_10018244 3300005327 Bacteria 5616
4 Ga0070658_10025849 3300005327 Bacteria 4708
5 Ga0070683_100009070 3300005329 Bacteria 8488
6 Ga0070683_100015285 3300005329 Bacteria 6739
7 Ga0070683_100039768 3300005329 Bacteria 4320
8 Ga0070683_100173941 3300005329 Bacteria 2044
9 Ga0070670_100184295 3300005331 Bacteria 1812
10 Ga0068869_100002576 3300005334 Bacteria 10949
11 Ga0070666_10066254 3300005335 Bacteria 2450
12 Ga0070682_100117432 3300005337 Bacteria 1781
13 Ga0068868_100000969 3300005338 Bacteria 19517
14 Ga0068868_100078152 3300005338 Bacteria 2648
15 Ga0070660_100156193 3300005339 Unclassified 1836
16 Ga0070660_100201951 3300005339 Unclassified 1612
17 Ga0070661_100007332 3300005344 Bacteria 7609
18 Ga0070661_100163782 3300005344 Unclassified 1685
19 Ga0070661_100295677 3300005344 Bacteria 1259
20 Ga0070671_100001442 3300005355 Bacteria 17755
21 Ga0070671_100019563 3300005355 Bacteria 5513
22 Ga0070667_100017377 3300005367 Bacteria 5961
23 Ga0070714_100044629 3300005435 Bacteria 3753
24 Ga0070663_100106777 3300005455 Bacteria 2098
25 Ga0070663_100193147 3300005455 Bacteria 1585
26 Ga0070679_100134211 3300005530 Bacteria 2456
27 Ga0070684_100002349 3300005535 Bacteria 13949
28 Ga0070684_100018058 3300005535 Bacteria 5801
29 Ga0070684_100047179 3300005535 Bacteria 3733
30 Ga0068853_100000264 3300005539 Bacteria 36901
31 Ga0068853_100195008 3300005539 Bacteria 1841
32 Ga0068853_100603535 3300005539 Bacteria 1042
33 Ga0070665_100136277 3300005548 Unclassified 2458
34 Ga0070665_100242868 3300005548 Bacteria 1801
35 Ga0068855_100000216 3300005563 Bacteria 73411
36 Ga0068855_100002826 3300005563 Bacteria 21376
37 Ga0068855_100049052 3300005563 Bacteria 4981
38 Ga0068855_100114924 3300005563 Bacteria 3086
39 Ga0068855_100352873 3300005563 Bacteria 1620
40 Ga0070664_100053183 3300005564 Bacteria 3432
41 Ga0068857_100001621 3300005577 Bacteria 18069
42 Ga0068857_100134491 3300005577 Bacteria 2232
43 Ga0068856_100001136 3300005614 Bacteria 27971
44 Ga0068856_100002530 3300005614 Bacteria 18841
45 Ga0068856_100016234 3300005614 Bacteria 7204
46 Ga0068856_100431457 3300005614 Bacteria 1338
47 Ga0068852_100000042 3300005616 Bacteria 91949
48 Ga0068852_100000046 3300005616 Bacteria 87937
49 Ga0068852_100003508 3300005616 Bacteria 10967
50 Ga0068852_100172213 3300005616 Bacteria 2030
51 Ga0068852_100253724 3300005616 Bacteria 1686
52 Ga0068859_100047822 3300005617 Bacteria 4298
53 Ga0068859_100312743 3300005617 Bacteria 1664
54 Ga0068864_100001867 3300005618 Bacteria 17293
55 Ga0068851_10000417 3300005834 Bacteria 19079
56 Ga0068851_10049282 3300005834 Unclassified 2136
57 Ga0068851_10129653 3300005834 Unclassified 1363
58 Ga0068863_100012154 3300005841 Bacteria 8316
59 Ga0068858_100190558 3300005842 Bacteria 1937
60 Ga0068860_100000752 3300005843 Bacteria 36823
61 Ga0081540_1020461 3300005983 Bacteria 3978
62 Ga0070717_10666880 3300006028 Bacteria 944
63 Ga0097621_100006478 3300006237 Bacteria 8315
64 Ga0097621_100130315 3300006237 Unclassified 2140
65 Ga0068871_100001110 3300006358 Bacteria 18057
66 Ga0068871_100187297 3300006358 Unclassified 1781
67 Ga0075436_100061221 3300006914 Unclassified 2600
68 Ga0075436_100075394 3300006914 Bacteria 2336
69 Ga0097620_100047822 3300006931 Bacteria 4298
70 Ga0097620_100312777 3300006931 Bacteria 1664
71 Ga0105240_10000065 3300009093 Bacteria 213992
72 Ga0105240_10001829 3300009093 Bacteria 35656
73 Ga0105240_10003478 3300009093 Bacteria 24431
74 Ga0105240_10004557 3300009093 Bacteria 21033
75 Ga0105240_10004719 3300009093 Bacteria 20569
76 Ga0105240_10094073 3300009093 Unclassified 3657
77 Ga0105240_10119834 3300009093 Unclassified 3169
78 Ga0105245_10031427 3300009098 Bacteria 4699
79 Ga0105245_10188330 3300009098 Bacteria 1975
80 Ga0105247_10001468 3300009101 Bacteria 16988
81 Ga0105247_10060891 3300009101 Unclassified 2340
82 Ga0105241_10000278 3300009174 Bacteria 38174
83 Ga0105241_10120369 3300009174 Bacteria 2113
84 Ga0105241_10153569 3300009174 Unclassified 1886
85 Ga0105248_10062069 3300009177 Unclassified 4197
86 Ga0105248_10324769 3300009177 Bacteria 1733
87 Ga0105248_10378559 3300009177 Unclassified 1594
88 Ga0105237_10002432 3300009545 Bacteria 23119
89 Ga0105237_10109958 3300009545 Unclassified 2748
90 Ga0105237_10150388 3300009545 Bacteria 2324
91 Ga0105237_10163790 3300009545 Unclassified 2222
92 Ga0105238_10000530 3300009551 Bacteria 39934
93 Ga0105238_10000634 3300009551 Bacteria 37020
94 Ga0105238_10009229 3300009551 Bacteria 9871
95 Ga0105238_10039293 3300009551 Bacteria 4798
96 Ga0105238_10084029 3300009551 Unclassified 3172
97 Ga0105238_10120761 3300009551 Unclassified 2600
98 Ga0105239_10001165 3300010375 Bacteria 36151
99 Ga0105239_10003808 3300010375 Bacteria 18348
100 Ga0105239_10068057 3300010375 Bacteria 3913
101 Ga0105239_10242234 3300010375 Unclassified 2024
102 Ga0105239_10309384 3300010375 Bacteria 1780
103 Ga0105246_10127362 3300011119 Bacteria 1896
104 Ga0157373_10290672 3300013100 Unclassified 1159
105 Ga0157373_10352740 3300013100 Unclassified 1050
106 Ga0157373_10394991 3300013100 Unclassified 990
107 Ga0157371_10218351 3300013102 Bacteria 1369
108 Ga0157370_10000009 3300013104 Bacteria 231270
109 Ga0157369_10000022 3300013105 Bacteria 233081
110 Ga0157369_10000794 3300013105 Bacteria 40368
111 Ga0157369_10001128 3300013105 Bacteria 33404
112 Ga0157369_10035206 3300013105 Bacteria 5491
113 Ga0157369_10055460 3300013105 Unclassified 4278
114 Ga0157369_10082109 3300013105 Bacteria 3449
115 Ga0157369_10116976 3300013105 Bacteria 2830
116 Ga0157369_10125853 3300013105 Bacteria 2717
117 Ga0157374_10004084 3300013296 Bacteria 12255
118 Ga0157374_10007308 3300013296 Bacteria 9417
119 Ga0157374_10285560 3300013296 Bacteria 1630
120 Ga0157374_10286135 3300013296 Bacteria 1628
121 Ga0157378_10005531 3300013297 Bacteria 11065
122 Ga0157378_10044007 3300013297 Unclassified 3963
123 Ga0163162_10004126 3300013306 Bacteria 13944
124 Ga0157372_10000192 3300013307 Bacteria 67358
125 Ga0157372_10005792 3300013307 Bacteria 13158
126 Ga0157372_10038369 3300013307 Bacteria 5286
127 Ga0157372_10060937 3300013307 Bacteria 4223
128 Ga0157372_10099749 3300013307 Unclassified 3313
129 Ga0157372_10110683 3300013307 Unclassified 3146
130 Ga0157372_10135702 3300013307 Unclassified 2833
131 Ga0157372_10228918 3300013307 Bacteria 2155
132 Ga0157372_10689861 3300013307 Bacteria 1189
133 Ga0157375_10059676 3300013308 Bacteria 3780
134 Ga0157375_10106039 3300013308 Unclassified 2902
135 Ga0157375_10336010 3300013308 Bacteria 1676
136 Ga0163163_10009609 3300014325 Bacteria 8643
137 Ga0182008_10016877 3300014497 Unclassified 3788
138 Ga0182008_10167501 3300014497 Unclassified 1108
139 Ga0157379_10001698 3300014968 Bacteria 18216
140 Ga0157379_10100725 3300014968 Unclassified 2593
141 Ga0157376_10168670 3300014969 Bacteria 1991
142 Ga0157376_10420751 3300014969 Bacteria 1296
143 Ga0213872_10006755 3300021361 Bacteria 5713
144 Ga0213872_10009022 3300021361 Bacteria 4794
145 Ga0213872_10045590 3300021361 Bacteria 1995
146 Ga0207656_10049063 3300025321 Bacteria 1819
147 Ga0207710_10002527 3300025900 Bacteria 8459
148 Ga0207710_10177350 3300025900 Bacteria 1044
149 Ga0207647_10133044 3300025904 Bacteria 1461
150 Ga0207705_10032363 3300025909 Bacteria 3737
151 Ga0207705_10034218 3300025909 Unclassified 3633
152 Ga0207654_10001279 3300025911 Bacteria 13388
153 Ga0207654_10002087 3300025911 Bacteria 10237
154 Ga0207707_10166418 3300025912 Unclassified 1927
155 Ga0207707_10193393 3300025912 Unclassified 1774
156 Ga0207695_10000052 3300025913 Bacteria 398089
157 Ga0207695_10000174 3300025913 Bacteria 189006
158 Ga0207695_10000332 3300025913 Bacteria 112161
159 Ga0207695_10001747 3300025913 Bacteria 34511
160 Ga0207695_10024562 3300025913 Bacteria 6774
161 Ga0207695_10053441 3300025913 Bacteria 4225
162 Ga0207695_10241784 3300025913 Bacteria 1706
163 Ga0207671_10000783 3300025914 Bacteria 40292
164 Ga0207671_10000867 3300025914 Bacteria 38284
165 Ga0207671_10308119 3300025914 Unclassified 1251
166 Ga0207649_10246795 3300025920 Bacteria 1284
167 Ga0207694_10000043 3300025924 Bacteria 171251
168 Ga0207694_10000362 3300025924 Bacteria 42697
169 Ga0207694_10008726 3300025924 Bacteria 7650
170 Ga0207694_10549486 3300025924 Bacteria 969
171 Ga0207650_10157811 3300025925 Bacteria 1795
172 Ga0207687_10006651 3300025927 Bacteria 7625
173 Ga0207687_10212044 3300025927 Bacteria 1520
174 Ga0207644_10066485 3300025931 Bacteria 2625
175 Ga0207644_10070878 3300025931 Bacteria 2548
176 Ga0207711_10022155 3300025941 Bacteria 5311
177 Ga0207711_10047634 3300025941 Unclassified 3666
178 Ga0207711_10139997 3300025941 Unclassified 2176
179 Ga0207689_10008489 3300025942 Bacteria 8951
180 Ga0207661_10024442 3300025944 Bacteria 4580
181 Ga0207661_10025255 3300025944 Bacteria 4514
182 Ga0207661_10244506 3300025944 Unclassified 1593
183 Ga0207679_10039962 3300025945 Bacteria 3354
184 Ga0207679_10290603 3300025945 Unclassified 1405
185 Ga0207667_10000878 3300025949 Bacteria 38401
186 Ga0207667_10007819 3300025949 Bacteria 12777
187 Ga0207667_10037863 3300025949 Bacteria 5154
188 Ga0207667_10122509 3300025949 Bacteria 2679
189 Ga0207667_10123867 3300025949 Unclassified 2663
190 Ga0207640_10239226 3300025981 Unclassified 1402
191 Ga0207658_10021420 3300025986 Unclassified 4487
192 Ga0207677_10003382 3300026023 Bacteria 8444
193 Ga0207677_10154888 3300026023 Bacteria 1773
194 Ga0207703_10196631 3300026035 Bacteria 1789
195 Ga0207639_10000270 3300026041 Bacteria 37095
196 Ga0207639_10058238 3300026041 Bacteria 2971
197 Ga0207639_10198894 3300026041 Unclassified 1717
198 Ga0207678_10047401 3300026067 Bacteria 3716
199 Ga0207702_10025860 3300026078 Bacteria 4872
200 Ga0207702_10080474 3300026078 Bacteria 2826
201 Ga0207641_10003667 3300026088 Bacteria 13526
202 Ga0207641_10161136 3300026088 Unclassified 2040
203 Ga0207676_10004144 3300026095 Bacteria 10238
204 Ga0207674_10003928 3300026116 Bacteria 18098
205 Ga0207674_10160760 3300026116 Bacteria 2201
206 Ga0207674_10180785 3300026116 Bacteria 2061
207 Ga0207698_10000007 3300026142 Bacteria 289457
208 Ga0207698_10000055 3300026142 Bacteria 82550
209 Ga0207698_10291028 3300026142 Bacteria 1516
210 Ga0268266_10105256 3300028379 Unclassified 2492
211 Ga0268264_10007418 3300028381 Bacteria 9157
212 Ga0265336_10001188 3300028666 Bacteria 12380
213 Ga0265338_10002934 3300028800 Bacteria 24743
214 Ga0265338_10006350 3300028800 Bacteria 15101
215 Ga0265338_10021993 3300028800 Bacteria 6626
216 Ga0265330_10045888 3300031235 Unclassified 1926
217 Ga0265328_10003877 3300031239 Bacteria 6578
218 Ga0265325_10129148 3300031241 Bacteria 1211
219 Ga0265340_10047295 3300031247 Unclassified 2095
220 Ga0265340_10069829 3300031247 Bacteria 1667
221 Ga0265339_10000012 3300031249 Bacteria 203469
222 Ga0265339_10002669 3300031249 Bacteria 12698
223 Ga0265339_10013326 3300031249 Bacteria 4986
224 Ga0265339_10017107 3300031249 Bacteria 4301
225 Ga0265339_10096495 3300031249 Unclassified 1543
226 Ga0265316_10003043 3300031344 Bacteria 17118
227 Ga0265316_10026937 3300031344 Bacteria 4771
228 Ga0265316_10029115 3300031344 Bacteria 4546
229 Ga0265316_10032685 3300031344 Bacteria 4244
230 Ga0265316_10153400 3300031344 Bacteria 1725
231 Ga0265316_10156476 3300031344 Bacteria 1705
232 Ga0265316_10232521 3300031344 Bacteria 1357
233 Ga0307408_100320494 3300031548 Bacteria 1305
234 Ga0265314_10000139 3300031711 Bacteria 108861
235 Ga0265314_10005834 3300031711 Bacteria 11026
236 Ga0265314_10020798 3300031711 Bacteria 5060
237 Ga0265314_10030474 3300031711 Unclassified 3992
238 Ga0265342_10001091 3300031712 Bacteria 26110
239 Ga0265342_10081787 3300031712 Bacteria 1864
240 Ga0265342_10104216 3300031712 Bacteria 1612
241 Ga0307410_10100837 3300031852 Bacteria 2069
242 Ga0307412_10389506 3300031911 Bacteria 1131
243 Ga0307409_100320584 3300031995 Bacteria 1450
244 Ga0307416_100022055 3300032002 Bacteria 4587
245 Ga0307411_10016640 3300032005 Bacteria 4166
246 Ga0373943_0247487 3300035170 Bacteria 1000
247 Ga0373946_0185591 3300035171 Bacteria 989
248 Ga0373947_0026169 3300035725 Bacteria 3407
249 Ga0373937_0050671 3300036401 Bacteria 3803
250 Ga0395898_0500025 3300037466 Bacteria 1156
251 Ga0395905_0007130 3300037471 Bacteria 11173
252 Ga0395905_0013588 3300037471 Bacteria 7800
253 Ga0395905_0863547 3300037471 Bacteria 808
254 Ga0436360_1032925 3300039438 Unclassified 1233
255 Ga0436360_1216769 3300039438 Bacteria 7254
256 Ga0436361_0209176 3300039447 Bacteria 17603
257 Ga0436361_0218374 3300039447 Bacteria 14565
258 Ga0436361_0354935 3300039447 Bacteria 2408
259 Ga0436361_0359247 3300039447 Bacteria 1503
260 Ga0451577_0000054 3300042876 Bacteria 278798
261 Ga0453683_0035197 3300044673 Bacteria 3156
262 Ga0453683_0356318 3300044673 Unclassified 940
263 Ga0466961_0169223 3300044693 Bacteria 1359
264 Ga0466961_0236186 3300044693 Unclassified 1124
265 Ga0466963_0007135 3300044694 Bacteria 6659
266 Ga0453684_0000289 3300044712 Bacteria 215476
267 Ga0451576_0003702 3300045051 Bacteria 20675
268 Ga0466967_0000784 3300045976 Bacteria 16536
269 Ga0495659_0006177 3300046664 Unclassified 3786
270 Ga0495623_0131256 3300046679 Bacteria 1500
271 Ga0495669_0002713 3300046684 Bacteria 7255
272 Ga0495669_0049078 3300046684 Unclassified 1889
273 Ga0495602_0468105 3300048088 Bacteria 886
274 Ga0496100_0528853 3300048903 Unclassified 911
275 Ga0496102_0585100 3300048905 Unclassified 1039
276 Ga0496104_0021070 3300048907 Bacteria 5980
277 Ga0496105_0256192 3300048908 Bacteria 1416
278 Ga0496105_0312545 3300048908 Unclassified 1261
279 Ga0496107_0138740 3300048910 Bacteria 1797
280 Ga0496107_0486443 3300048910 Unclassified 916
281 Ga0496109_0185974 3300048912 Unclassified 1952
282 Ga0496115_0015984 3300048918 Bacteria 5706
283 Ga0496115_0189557 3300048918 Unclassified 1699
284 nmdc:mga08x19_49949_c1 3300050514 Bacteria 2683
285 nmdc:mga08x19_8338_c1 3300050514 Bacteria 6167
286 Ga0373933_0079172
287 rootH1_10239311
288 Ga0070658_10018244
289 Ga0070658_10025849
290 Ga0070683_100009070
291 Ga0070683_100015285
292 Ga0070683_100039768
293 Ga0070683_100173941
294 Ga0070670_100184295
295 Ga0068869_100002576
296 Ga0070666_10066254
297 Ga0070682_100117432
298 Ga0068868_100000969
299 Ga0068868_100078152
300 Ga0070660_100156193
301 Ga0070660_100201951
302 Ga0070661_100007332
303 Ga0070661_100163782
304 Ga0070661_100295677
305 Ga0070671_100001442
306 Ga0070671_100019563
307 Ga0070667_100017377
308 Ga0070714_100044629
309 Ga0070663_100106777
310 Ga0070663_100193147
311 Ga0070679_100134211
312 Ga0070684_100002349
313 Ga0070684_100018058
314 Ga0070684_100047179
315 Ga0068853_100000264
316 Ga0068853_100195008
317 Ga0068853_100603535
318 Ga0070665_100136277
319 Ga0070665_100242868
320 Ga0068855_100000216
321 Ga0068855_100002826
322 Ga0068855_100049052
323 Ga0068855_100114924
324 Ga0068855_100352873
325 Ga0070664_100053183
326 Ga0068857_100001621
327 Ga0068857_100134491
328 Ga0068856_100001136
329 Ga0068856_100002530
330 Ga0068856_100016234
331 Ga0068856_100431457
332 Ga0068852_100000042
333 Ga0068852_100000046
334 Ga0068852_100003508
335 Ga0068852_100172213
336 Ga0068852_100253724
337 Ga0068859_100047822
338 Ga0068859_100312743
339 Ga0068864_100001867
340 Ga0068851_10000417
341 Ga0068851_10049282
342 Ga0068851_10129653
343 Ga0068863_100012154
344 Ga0068858_100190558
345 Ga0068860_100000752
346 Ga0081540_1020461
347 Ga0070717_10666880
348 Ga0097621_100006478
349 Ga0097621_100130315
350 Ga0068871_100001110
351 Ga0068871_100187297
352 Ga0075436_100061221
353 Ga0075436_100075394
354 Ga0097620_100047822
355 Ga0097620_100312777
356 Ga0105240_10000065
357 Ga0105240_10001829
358 Ga0105240_10003478
359 Ga0105240_10004557
360 Ga0105240_10004719
361 Ga0105240_10094073
362 Ga0105240_10119834
363 Ga0105245_10031427
364 Ga0105245_10188330
365 Ga0105247_10001468
366 Ga0105247_10060891
367 Ga0105241_10000278
368 Ga0105241_10120369
369 Ga0105241_10153569
370 Ga0105248_10062069
371 Ga0105248_10324769
372 Ga0105248_10378559
373 Ga0105237_10002432
374 Ga0105237_10109958
375 Ga0105237_10150388
376 Ga0105237_10163790
377 Ga0105238_10000530
378 Ga0105238_10000634
379 Ga0105238_10009229
380 Ga0105238_10039293
381 Ga0105238_10084029
382 Ga0105238_10120761
383 Ga0105239_10001165
384 Ga0105239_10003808
385 Ga0105239_10068057
386 Ga0105239_10242234
387 Ga0105239_10309384
388 Ga0105246_10127362
389 Ga0157373_10290672
390 Ga0157373_10352740
391 Ga0157373_10394991
392 Ga0157371_10218351
393 Ga0157370_10000009
394 Ga0157369_10000022
395 Ga0157369_10000794
396 Ga0157369_10001128
397 Ga0157369_10035206
398 Ga0157369_10055460
399 Ga0157369_10082109
400 Ga0157369_10116976
401 Ga0157369_10125853
402 Ga0157374_10004084
403 Ga0157374_10007308
404 Ga0157374_10285560
405 Ga0157374_10286135
406 Ga0157378_10005531
407 Ga0157378_10044007
408 Ga0163162_10004126
409 Ga0157372_10000192
410 Ga0157372_10005792
411 Ga0157372_10038369
412 Ga0157372_10060937
413 Ga0157372_10099749
414 Ga0157372_10110683
415 Ga0157372_10135702
416 Ga0157372_10228918
417 Ga0157372_10689861
418 Ga0157375_10059676
419 Ga0157375_10106039
420 Ga0157375_10336010
421 Ga0163163_10009609
422 Ga0182008_10016877
423 Ga0182008_10167501
424 Ga0157379_10001698
425 Ga0157379_10100725
426 Ga0157376_10168670
427 Ga0157376_10420751
428 Ga0213872_10006755
429 Ga0213872_10009022
430 Ga0213872_10045590
431 Ga0207656_10049063
432 Ga0207710_10002527
433 Ga0207710_10177350
434 Ga0207647_10133044
435 Ga0207705_10032363
436 Ga0207705_10034218
437 Ga0207654_10001279
438 Ga0207654_10002087
439 Ga0207707_10166418
440 Ga0207707_10193393
441 Ga0207695_10000052
442 Ga0207695_10000174
443 Ga0207695_10000332
444 Ga0207695_10001747
445 Ga0207695_10024562
446 Ga0207695_10053441
447 Ga0207695_10241784
448 Ga0207671_10000783
449 Ga0207671_10000867
450 Ga0207671_10308119
451 Ga0207649_10246795
452 Ga0207694_10000043
453 Ga0207694_10000362
454 Ga0207694_10008726
455 Ga0207694_10549486
456 Ga0207650_10157811
457 Ga0207687_10006651
458 Ga0207687_10212044
459 Ga0207644_10066485
460 Ga0207644_10070878
461 Ga0207711_10022155
462 Ga0207711_10047634
463 Ga0207711_10139997
464 Ga0207689_10008489
465 Ga0207661_10024442
466 Ga0207661_10025255
467 Ga0207661_10244506
468 Ga0207679_10039962
469 Ga0207679_10290603
470 Ga0207667_10000878
471 Ga0207667_10007819
472 Ga0207667_10037863
473 Ga0207667_10122509
474 Ga0207667_10123867
475 Ga0207640_10239226
476 Ga0207658_10021420
477 Ga0207677_10003382
478 Ga0207677_10154888
479 Ga0207703_10196631
480 Ga0207639_10000270
481 Ga0207639_10058238
482 Ga0207639_10198894
483 Ga0207678_10047401
484 Ga0207702_10025860
485 Ga0207702_10080474
486 Ga0207641_10003667
487 Ga0207641_10161136
488 Ga0207676_10004144
489 Ga0207674_10003928
490 Ga0207674_10160760
491 Ga0207674_10180785
492 Ga0207698_10000007
493 Ga0207698_10000055
494 Ga0207698_10291028
495 Ga0268266_10105256
496 Ga0268264_10007418
497 Ga0265336_10001188
498 Ga0265338_10002934
499 Ga0265338_10006350
500 Ga0265338_10021993
501 Ga0265330_10045888
502 Ga0265328_10003877
503 Ga0265325_10129148
504 Ga0265340_10047295
505 Ga0265340_10069829
506 Ga0265339_10000012
507 Ga0265339_10002669
508 Ga0265339_10013326
509 Ga0265339_10017107
510 Ga0265339_10096495
511 Ga0265316_10003043
512 Ga0265316_10026937
513 Ga0265316_10029115
514 Ga0265316_10032685
515 Ga0265316_10153400
516 Ga0265316_10156476
517 Ga0265316_10232521
518 Ga0307408_100320494
519 Ga0265314_10000139
520 Ga0265314_10005834
521 Ga0265314_10020798
522 Ga0265314_10030474
523 Ga0265342_10001091
524 Ga0265342_10081787
525 Ga0265342_10104216
526 Ga0307410_10100837
527 Ga0307412_10389506
528 Ga0307409_100320584
529 Ga0307416_100022055
530 Ga0307411_10016640
531 Ga0373943_0247487
532 Ga0373946_0185591
533 Ga0373947_0026169
534 Ga0373937_0050671
535 Ga0395898_0500025
536 Ga0395905_0007130
537 Ga0395905_0013588
538 Ga0395905_0863547
539 Ga0436360_1032925
540 Ga0436360_1216769
541 Ga0436361_0209176
542 Ga0436361_0218374
543 Ga0436361_0354935
544 Ga0436361_0359247
545 Ga0451577_0000054
546 Ga0453683_0035197
547 Ga0453683_0356318
548 Ga0466961_0169223
549 Ga0466961_0236186
550 Ga0466963_0007135
551 Ga0453684_0000289
552 Ga0451576_0003702
553 Ga0466967_0000784
554 Ga0495659_0006177
555 Ga0495623_0131256
556 Ga0495669_0002713
557 Ga0495669_0049078
558 Ga0495602_0468105
559 Ga0496100_0528853
560 Ga0496102_0585100
561 Ga0496104_0021070
562 Ga0496105_0256192
563 Ga0496105_0312545
564 Ga0496107_0138740
565 Ga0496107_0486443
566 Ga0496109_0185974
567 Ga0496115_0015984
568 Ga0496115_0189557
569 nmdc:mga08x19_49949_c1
570 nmdc:mga08x19_8338_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11236

DUF3037

Protein of unknown function (DUF3037)

41

150

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vmi-assembly1.cif.gz_AC structure of the human mitochondrial ribosome-ef-g1 complex (classiii) 0.68 175 232
7ut5-assembly2.cif.gz_B acinetobacter baumannii dihydroorotate dehydrogenase bound with inhibitor dsm186 0.6445 190 261
6hxj-assembly1.cif.gz_B structure of atp citrate lyase from chlorobium limicola in complex with citrate and coenzyme a. 0.6275 188 280
5tzn-assembly1.cif.gz_F structure of the viral immunoevasin m12 (smith) bound to the natural killer cell receptor nkr-p1b (b6) 0.6251 7 55
7jj0-assembly2.cif.gz_C gtp-specific succinyl-coa synthetase complexed with mg-gmppcp 0.611 190 281
ID Description Score Start End Superfamily
af_Q2FXA8_166_254_3.40.50.10130 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6884 181 267 3.40.50.10130
5j1pA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Arenavirus RNA polymerase 0.6634 175 230 3.30.70.2640
af_Q9P7P2_5_174_3.30.900.10 Alpha Beta;2-Layer Sandwich;Cell Cycle, Spindle Assembly Checkpoint Protein; Chain A;HORMA domain 0.6281 9 53 3.30.900.10
af_Q9NU22_5379_5545_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.6258 199 265 3.40.50.410
af_Q8MPQ7_139_316_2.40.160.120 Mainly Beta;Beta Barrel;Porin; 0.6104 10 50 2.40.160.120
ID Description Score Start End GO Terms
AF-A0A2V9BZN2-F1-model_v4 Uncharacterized protein 0.8591 160 279
AF-A0A2V9VXY7-F1-model_v4 DUF3037 domain-containing protein 0.8506 1 112
AF-A0A2V9BZN2-F1-model_v4 Uncharacterized protein 0.8301 160 279
AF-A0A2V9VXY7-F1-model_v4 DUF3037 domain-containing protein 0.8092 1 112
AF-A0A2V9BZZ4-F1-model_v4 DUF3037 domain-containing protein 0.7754 1 109

Map