F386866

General Info

Members Datasets Scaffolds Average Seq Length
285 209 254 266

Family's Representative Sequence

Representative Sequence 3300026095|Ga0207676_10391587|Ga0207676_103915872
Length 299
Sequence MNDTTIARPVNEAQTAKAEPMREDGLHPGGQIADHSEGRETVIRIRKLRNQFGSQVVHKNLDLDVFRGEVVGLVGGSGTGKSVLMRTIIGLNPAKKGSIAVFGTETMGLHGRALDDLQRRWGVLFQDGALFSGLTVAENIAVALREHAGLPDDVLHDIAALKIALVGLPPDAAHKKPAELSGGMKKRAGLARALALDPELLFLDEPTAGLDPIGASQFDELVRTLQKNLGLTVLMVTHDLDSLNAICDRIAVLLDKRIVAGTMEELLVYDHPWVKAYFHGPRGRAAIKDEGAEAAGHPT

Samples

Sample ID Description Type Environment
1 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
2 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
3 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
4 2643221733 Bosea sp. Root381 Isolate Unclassified
5 2643221734 Bosea sp. Root670 Isolate Unclassified
6 2643221736 Bosea sp. Root483D1 Isolate Unclassified
7 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
8 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
9 2734482264 Dyella sp. AD052 Isolate Unclassified
10 2818991467 Bosea vestrisii 3192 Isolate Unclassified
11 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
12 2841760612 Bosea sp. Tri-49 Isolate Nodule
13 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
14 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
15 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
16 2844104063 Bosea sp. Tri-39 Isolate Nodule
17 2851182111 Bosea sp. Tri-44 Isolate Nodule
18 2851246043 Bosea sp. Tri-54 Isolate Nodule
19 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
20 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
21 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
22 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
23 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
24 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
25 2919085039 Luteibacter sp. 1214 Isolate Unclassified
26 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
27 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
28 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
29 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
30 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
31 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
76 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
119 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
125 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
126 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
127 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
139 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
140 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
141 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
142 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
152 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
153 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
154 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
171 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
176 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
201 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
202 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
203 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
204 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
205 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
206 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
207 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
208 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
209 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.12
Metatranscriptomes 0
Isolates 10.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.88
Nodule 2.81
Rhizoplane 4.56
Rhizosphere 68.07
Stem 0
Stem Tuber 0
Unclassified 13.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10000892 3300002075 Bacteria 8559
2 JGI25159J45721_1008252 3300002987 Bacteria 2883
3 JGI25151J46595_10000022 3300003187 Bacteria 223477
4 JGI25151J46595_10000135 3300003187 Bacteria 98528
5 rootH1_10008205 3300003323 Bacteria 18737
6 rootH1_10150416 3300003323 Bacteria 2332
7 Ga0055526_1000123 3300003771 Bacteria 68503
8 Ga0055526_1000154 3300003771 Bacteria 60968
9 Ga0055524_1000023 3300003775 Bacteria 221408
10 Ga0065165_1000362 3300005262 Bacteria 74503
11 Ga0065165_1000903 3300005262 Bacteria 38298
12 Ga0065165_1002575 3300005262 Bacteria 14961
13 Ga0070666_10000661 3300005335 Bacteria 20806
14 Ga0070661_100042742 3300005344 Bacteria 3308
15 Ga0070668_100003408 3300005347 Bacteria 11738
16 Ga0070669_100172223 3300005353 Bacteria 1688
17 Ga0070671_100085252 3300005355 Bacteria 2642
18 Ga0070671_100110025 3300005355 Bacteria 2314
19 Ga0070667_100005763 3300005367 Bacteria 10342
20 Ga0070714_100118054 3300005435 Bacteria 2357
21 Ga0070713_100168370 3300005436 Bacteria 1961
22 Ga0070665_100068001 3300005548 Bacteria 3572
23 Ga0070665_100175006 3300005548 Bacteria 2147
24 Ga0068855_100022192 3300005563 Bacteria 7607
25 Ga0068863_100024668 3300005841 Bacteria 5734
26 Ga0068858_100049755 3300005842 Bacteria 3880
27 Ga0068860_100031848 3300005843 Bacteria 5069
28 Ga0068860_100182475 3300005843 Bacteria 2028
29 Ga0068862_100035962 3300005844 Bacteria 4196
30 Ga0081538_10001948 3300005981 Bacteria 20673
31 Ga0075365_10140050 3300006038 Bacteria 1679
32 Ga0075369_10026705 3300006186 Bacteria 2408
33 Ga0075366_10218248 3300006195 Bacteria 1162
34 Ga0068871_100017172 3300006358 Bacteria 5470
35 Ga0099795_10000010 3300007788 Bacteria 79907
36 Ga0099795_10033343 3300007788 Bacteria 1788
37 Ga0105240_10006702 3300009093 Bacteria 16874
38 Ga0105245_10002282 3300009098 Bacteria 17348
39 Ga0105247_10005495 3300009101 Bacteria 7983
40 Ga0105242_10126048 3300009176 Bacteria 2204
41 Ga0105248_10001336 3300009177 Bacteria 27459
42 Ga0105248_10005441 3300009177 Bacteria 13999
43 Ga0099796_10000014 3300010159 Bacteria 53741
44 Ga0099796_10043203 3300010159 Bacteria 1534
45 Ga0105239_10047970 3300010375 Bacteria 4681
46 Ga0157370_10000308 3300013104 Bacteria 61300
47 Ga0157369_10006818 3300013105 Bacteria 13175
48 Ga0171462_1026 3300013250 Bacteria 114045
49 Ga0157378_10016001 3300013297 Bacteria 6570
50 Ga0163162_10021419 3300013306 Bacteria 6366
51 Ga0157375_10035593 3300013308 Bacteria 4754
52 Ga0163163_10006394 3300014325 Bacteria 10293
53 Ga0182008_10002697 3300014497 Bacteria 11019
54 Ga0182008_10061830 3300014497 Bacteria 1846
55 Ga0157376_10004136 3300014969 Bacteria 10054
56 Ga0182006_1000034 3300015261 Bacteria 232484
57 Ga0182007_10002843 3300015262 Bacteria 8422
58 Ga0182005_1000064 3300015265 Bacteria 95976
59 Ga0182005_1002321 3300015265 Bacteria 6917
60 Ga0182005_1002499 3300015265 Bacteria 6531
61 Ga0182005_1007421 3300015265 Bacteria 3290
62 Ga0182005_1019959 3300015265 Bacteria 1845
63 Ga0163161_10042691 3300017792 Bacteria 3263
64 Ga0213874_10001907 3300021377 Bacteria 4388
65 Ga0224572_1002243 3300024225 Bacteria 3084
66 Ga0209673_1014578 3300025273 Bacteria 3034
67 Ga0209130_1000226 3300025284 Bacteria 73970
68 Ga0209675_1000618 3300025291 Bacteria 25388
69 Ga0209676_1057079 3300025292 Bacteria 991
70 Ga0209025_1000016 3300025294 Bacteria 770739
71 Ga0209025_1000696 3300025294 Bacteria 57362
72 Ga0209564_1000075 3300025295 Bacteria 285760
73 Ga0209564_1000076 3300025295 Bacteria 283602
74 Ga0209256_1000083 3300025299 Bacteria 221460
75 Ga0209256_1001241 3300025299 Bacteria 28284
76 Ga0209256_1005866 3300025299 Bacteria 6809
77 Ga0207680_10016461 3300025903 Bacteria 3883
78 Ga0207707_10598311 3300025912 Bacteria 934
79 Ga0207695_10006876 3300025913 Bacteria 14641
80 Ga0207671_10137384 3300025914 Bacteria 1880
81 Ga0207649_10062147 3300025920 Bacteria 2353
82 Ga0207652_10042829 3300025921 Bacteria 3855
83 Ga0207687_10028053 3300025927 Bacteria 3781
84 Ga0207644_10083284 3300025931 Bacteria 2368
85 Ga0207644_10183569 3300025931 Bacteria 1641
86 Ga0207644_10398812 3300025931 Bacteria 1124
87 Ga0207704_10022237 3300025938 Bacteria 3393
88 Ga0207711_10012042 3300025941 Bacteria 7191
89 Ga0207667_10047884 3300025949 Bacteria 4522
90 Ga0207668_10000621 3300025972 Bacteria 22074
91 Ga0207658_10005002 3300025986 Bacteria 9133
92 Ga0207676_10391587 3300026095 Bacteria 1296
93 Ga0207698_10804999 3300026142 Bacteria 942
94 Ga0268266_10109237 3300028379 Bacteria 2449
95 Ga0268265_10019735 3300028380 Bacteria 4692
96 Ga0268264_10496909 3300028381 Bacteria 1189
97 Ga0265338_10301744 3300028800 Bacteria 1164
98 Ga0265338_10304908 3300028800 Bacteria 1157
99 Ga0265328_10000012 3300031239 Bacteria 157661
100 Ga0265328_10000056 3300031239 Bacteria 68271
101 Ga0265328_10002278 3300031239 Bacteria 8641
102 Ga0265328_10006881 3300031239 Bacteria 4777
103 Ga0265328_10007305 3300031239 Bacteria 4613
104 Ga0265325_10039160 3300031241 Bacteria 2497
105 Ga0265339_10000158 3300031249 Bacteria 56155
106 Ga0265339_10083996 3300031249 Bacteria 1679
107 Ga0265331_10000128 3300031250 Bacteria 99243
108 Ga0265331_10002846 3300031250 Bacteria 11455
109 Ga0265331_10031202 3300031250 Bacteria 2649
110 Ga0265331_10067682 3300031250 Bacteria 1675
111 Ga0265327_10003967 3300031251 Bacteria 13510
112 Ga0265316_10032546 3300031344 Bacteria 4254
113 Ga0265316_10092674 3300031344 Bacteria 2303
114 Ga0265313_10000426 3300031595 Bacteria 45023
115 Ga0307406_10080331 3300031901 Bacteria 2165
116 Ga0307412_10015240 3300031911 Bacteria 4551
117 Ga0373954_0023578 3300035118 Bacteria 2800
118 Ga0373935_0244873 3300035692 Bacteria 1253
119 Ga0373947_0052993 3300035725 Bacteria 2445
120 Ga0373937_0193369 3300036401 Bacteria 1912
121 Ga0373925_0084502 3300037068 Bacteria 2419
122 Ga0395905_0000123 3300037471 Bacteria 127888
123 Ga0400489_33096 3300039093 Bacteria 1704
124 Ga0237816_01322 3300039145 Bacteria 2004
125 Ga0436365_0061733 3300039437 Bacteria 1406
126 Ga0436360_0409267 3300039438 Bacteria 2927
127 Ga0436361_0872634 3300039447 Bacteria 1648
128 Ga0436363_0299925 3300039450 Bacteria 5867
129 Ga0439436_0000045 3300041404 Bacteria 37076
130 Ga0439465_0000412 3300041413 Bacteria 12478
131 Ga0451837_1093985 3300041494 Bacteria 1134
132 Ga0466982_0000029 3300044672 Bacteria 60348
133 Ga0466957_0023121 3300044842 Bacteria 3672
134 Ga0451576_0009684 3300045051 Bacteria 11147
135 Ga0495617_000122 3300046452 Bacteria 51915
136 Ga0495617_002391 3300046452 Bacteria 7478
137 Ga0495638_0000237 3300046460 Bacteria 75347
138 Ga0495638_0067824 3300046460 Bacteria 2189
139 Ga0495650_0010096 3300046471 Bacteria 5301
140 Ga0495580_0194521 3300046472 Bacteria 1398
141 Ga0495584_0012758 3300046491 Bacteria 4288
142 Ga0495585_0000180 3300046492 Bacteria 67101
143 Ga0495585_0006632 3300046492 Bacteria 7153
144 Ga0495607_0000008 3300046501 Bacteria 265274
145 Ga0495607_0000042 3300046501 Bacteria 130434
146 Ga0495607_0042496 3300046501 Bacteria 2693
147 Ga0495606_0002419 3300046507 Bacteria 21753
148 Ga0495606_0064547 3300046507 Bacteria 2329
149 Ga0495610_0004683 3300046512 Bacteria 10004
150 Ga0495610_0012639 3300046512 Bacteria 5066
151 Ga0495616_0000003 3300046513 Bacteria 290178
152 Ga0495616_0039984 3300046513 Bacteria 2398
153 Ga0495620_0000182 3300046515 Bacteria 48877
154 Ga0495631_0000061 3300046518 Bacteria 67503
155 Ga0495631_0000380 3300046518 Bacteria 30582
156 Ga0495632_0000008 3300046519 Bacteria 294056
157 Ga0495632_0000241 3300046519 Bacteria 54558
158 Ga0495632_0042235 3300046519 Bacteria 2286
159 Ga0495648_0020744 3300046524 Bacteria 4572
160 Ga0495668_0004268 3300046616 Bacteria 10260
161 Ga0495611_0000004 3300046648 Bacteria 308149
162 Ga0495611_0000023 3300046648 Bacteria 120553
163 Ga0495625_0000024 3300046660 Bacteria 271126
164 Ga0495661_0003139 3300046665 Bacteria 12372
165 Ga0495670_0000198 3300046691 Bacteria 26974
166 Ga0495670_0000251 3300046691 Bacteria 24927
167 Ga0495670_0010005 3300046691 Bacteria 4664
168 Ga0495671_0004625 3300046692 Bacteria 8164
169 Ga0495671_0137041 3300046692 Bacteria 1193
170 Ga0495649_0034557 3300046694 Bacteria 2781
171 Ga0495589_0000397 3300046794 Bacteria 32812
172 Ga0495660_0000321 3300046810 Bacteria 42518
173 Ga0495660_0003612 3300046810 Bacteria 9533
174 Ga0495679_000011 3300047446 Bacteria 324498
175 Ga0495673_0000036 3300047469 Bacteria 311035
176 Ga0495673_0000101 3300047469 Bacteria 173409
177 Ga0495673_0013842 3300047469 Bacteria 4215
178 Ga0495686_0000033 3300047472 Bacteria 342031
179 Ga0495686_0000608 3300047472 Bacteria 49564
180 Ga0495686_0015596 3300047472 Bacteria 5182
181 Ga0495686_0016024 3300047472 Bacteria 5094
182 Ga0496100_0045848 3300048903 Bacteria 2807
183 Ga0496101_0003334 3300048904 Bacteria 9998
184 Ga0496102_0283629 3300048905 Bacteria 1561
185 Ga0496104_0001058 3300048907 Bacteria 23466
186 Ga0496105_0005699 3300048908 Bacteria 9481
187 Ga0496106_0008007 3300048909 Bacteria 7809
188 Ga0496108_0005165 3300048911 Bacteria 10557
189 Ga0496108_0060480 3300048911 Bacteria 3187
190 Ga0496109_0005865 3300048912 Bacteria 10300
191 Ga0496110_0001822 3300048913 Bacteria 15712
192 Ga0496111_0163006 3300048914 Bacteria 1656
193 Ga0496114_0175391 3300048917 Bacteria 1870
194 Ga0496117_0004161 3300048920 Bacteria 16172
195 Ga0496117_0150014 3300048920 Bacteria 1381
196 Ga0496118_0000253 3300048921 Bacteria 94328
197 Ga0496118_0000590 3300048921 Bacteria 60077
198 Ga0496121_0000741 3300048924 Bacteria 60127
199 Ga0496121_0009919 3300048924 Bacteria 10841
200 Ga0496121_0100279 3300048924 Bacteria 2235
201 Ga0496122_0018342 3300048925 Bacteria 6475
202 Ga0496122_0130850 3300048925 Bacteria 1595
203 Ga0496123_0005472 3300048926 Bacteria 12780
204 Ga0496123_0009083 3300048926 Bacteria 9003
205 Ga0496124_0000313 3300048927 Bacteria 89891
206 Ga0496124_0000314 3300048927 Bacteria 89797
207 Ga0496124_0304987 3300048927 Bacteria 1148
208 Ga0496125_0147883 3300048928 Bacteria 1620
209 Ga0496126_0083930 3300048929 Bacteria 2811
210 Ga0495678_000649 3300049459 Bacteria 32006
211 Ga0495682_0018629 3300049460 Bacteria 2614
212 Ga0501031_0270848 3300049568 Bacteria 1102
213 Ga0501033_0022193 3300049570 Bacteria 4789
214 Ga0501033_0066074 3300049570 Bacteria 2660
215 Ga0501033_0208809 3300049570 Bacteria 1393
216 Ga0501034_0024267 3300049571 Bacteria 6167
217 Ga0501034_0045835 3300049571 Bacteria 4417
218 Ga0501034_0053964 3300049571 Bacteria 4046
219 Ga0501036_0028319 3300049572 Bacteria 4734
220 Ga0501037_0017860 3300049573 Bacteria 5222
221 Ga0501037_0021894 3300049573 Bacteria 4732
222 Ga0501038_0012930 3300049574 Bacteria 7614
223 Ga0501038_0033789 3300049574 Bacteria 4501
224 Ga0501039_0005627 3300049575 Bacteria 9486
225 Ga0501039_0117776 3300049575 Bacteria 2080
226 Ga0501043_0016674 3300049579 Bacteria 5756
227 Ga0501046_0395745 3300049580 Bacteria 998
228 Ga0501047_0120463 3300049581 Bacteria 2506
229 Ga0501047_0137331 3300049581 Bacteria 2325
230 Ga0501047_0139764 3300049581 Bacteria 2301
231 Ga0501067_0166199 3300049583 Bacteria 1229
232 Ga0501068_0065472 3300049584 Bacteria 2212
233 Ga0501069_0028220 3300049585 Bacteria 3077
234 Ga0501069_0054634 3300049585 Bacteria 2224
235 Ga0501070_0059260 3300049586 Bacteria 3174
236 Ga0501070_0122892 3300049586 Bacteria 2145
237 Ga0501073_0011304 3300049589 Bacteria 6532
238 Ga0501074_0038964 3300049590 Bacteria 3442
239 Ga0501080_0024946 3300049742 Bacteria 5545
240 Ga0501035_0303610 3300049822 Bacteria 1344
241 Ga0501044_0006448 3300049823 Bacteria 12959
242 Ga0501044_0022322 3300049823 Bacteria 6745
243 Ga0501044_0074060 3300049823 Bacteria 3460
244 Ga0501044_0282568 3300049823 Bacteria 1593
245 nmdc:mga03683_3179_c1 3300050489 Bacteria 5242
246 nmdc:mga06z11_45150_c1 3300050494 Bacteria 2226
247 nmdc:mga08y16_36592_c1 3300050511 Bacteria 5155
248 nmdc:mga08x19_385_c1 3300050514 Bacteria 31031
249 nmdc:mga0sz30_174928_c1 3300050516 Bacteria 952
250 Ga0500643_000012 3300053087 Bacteria 369839
251 Ga0500555_000600 3300053103 Bacteria 14033
252 Ga0500658_0008931 3300053134 Bacteria 3700
253 Ga0500622_0001200 3300053156 Bacteria 21324
254 Ga0500633_0001923 3300053160 Bacteria 4104

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0150014 Ga0496117_0150014_11_709 229
2 3300007788 Ga0099795_10033343 Ga0099795_100333432 241
3 3300049581 Ga0501047_0139764 Ga0501047_0139764_103_861 245
4 3300005355 Ga0070671_100085252 Ga0070671_1000852522 247
5 3300007788 Ga0099795_10000010 Ga0099795_1000001031 247
6 3300010159 Ga0099796_10000014 Ga0099796_1000001416 247
7 3300013297 Ga0157378_10016001 Ga0157378_100160015 247
8 3300025931 Ga0207644_10183569 Ga0207644_101835692 247
9 3300035118 Ga0373954_0023578 Ga0373954_0023578_865_1653 247
10 3300036401 Ga0373937_0193369 Ga0373937_0193369_962_1726 247
11 3300005435 Ga0070714_100118054 Ga0070714_1001180542 248
12 3300005563 Ga0068855_100022192 Ga0068855_1000221926 248
13 3300009093 Ga0105240_10006702 Ga0105240_100067027 248
14 3300013105 Ga0157369_10006818 Ga0157369_100068184 248
15 3300025913 Ga0207695_10006876 Ga0207695_100068769 248
16 3300025914 Ga0207671_10137384 Ga0207671_101373842 248
17 3300025949 Ga0207667_10047884 Ga0207667_100478842 248
18 3300026142 Ga0207698_10804999 Ga0207698_108049992 248
19 iso_pu_bacteria 2841760612 2841763268 248
20 iso_pu_bacteria 2844104063 2844108862 248
21 iso_pu_bacteria 2851246043 2851250969 248
22 3300049580 Ga0501046_0395745 Ga0501046_0395745_53_802 249
23 3300053156 Ga0500622_0001200 Ga0500622_0001200_16997_17770 249
24 3300005335 Ga0070666_10000661 Ga0070666_100006614 250
25 3300005367 Ga0070667_100005763 Ga0070667_1000057634 250
26 3300005548 Ga0070665_100068001 Ga0070665_1000680013 250
27 3300005841 Ga0068863_100024668 Ga0068863_1000246682 250
28 3300005842 Ga0068858_100049755 Ga0068858_1000497553 250
29 3300005843 Ga0068860_100031848 Ga0068860_1000318483 250
30 3300006358 Ga0068871_100017172 Ga0068871_1000171723 250
31 3300009098 Ga0105245_10002282 Ga0105245_1000228213 250
32 3300009176 Ga0105242_10126048 Ga0105242_101260481 250
33 3300009177 Ga0105248_10001336 Ga0105248_100013369 250
34 3300013306 Ga0163162_10021419 Ga0163162_100214194 250
35 3300013308 Ga0157375_10035593 Ga0157375_100355933 250
36 3300014325 Ga0163163_10006394 Ga0163163_100063947 250
37 3300014969 Ga0157376_10004136 Ga0157376_100041363 250
38 3300025903 Ga0207680_10016461 Ga0207680_100164614 250
39 3300025927 Ga0207687_10028053 Ga0207687_100280534 250
40 3300025931 Ga0207644_10398812 Ga0207644_103988122 250
41 3300025938 Ga0207704_10022237 Ga0207704_100222374 250
42 3300025986 Ga0207658_10005002 Ga0207658_100050022 250
43 3300048907 Ga0496104_0001058 Ga0496104_0001058_21390_22163 250
44 3300048908 Ga0496105_0005699 Ga0496105_0005699_388_1161 250
45 3300048911 Ga0496108_0005165 Ga0496108_0005165_9686_10459 250
46 3300048912 Ga0496109_0005865 Ga0496109_0005865_2495_3268 250
47 3300048913 Ga0496110_0001822 Ga0496110_0001822_7288_8061 250
48 3300048917 Ga0496114_0175391 Ga0496114_0175391_120_893 250
49 3300049581 Ga0501047_0137331 Ga0501047_0137331_1260_2069 251
50 3300003323 rootH1_10008205 rootH1_1000820512 252
51 3300005436 Ga0070713_100168370 Ga0070713_1001683701 252
52 3300037471 Ga0395905_0000123 Ga0395905_0000123_56957_57754 252
53 3300039093 Ga0400489_33096 Ga0400489_33096_359_1171 252
54 iso_pu_bacteria 2854681122 2854683495 252
55 3300006195 Ga0075366_10218248 Ga0075366_102182482 253
56 3300024225 Ga0224572_1002243 Ga0224572_10022432 253
57 3300031241 Ga0265325_10039160 Ga0265325_100391603 253
58 3300031249 Ga0265339_10000158 Ga0265339_1000015827 253
59 3300031249 Ga0265339_10083996 Ga0265339_100839962 253
60 3300031250 Ga0265331_10031202 Ga0265331_100312023 253
61 3300031595 Ga0265313_10000426 Ga0265313_1000042643 253
62 3300045051 Ga0451576_0009684 Ga0451576_0009684_4679_5488 253
63 3300049568 Ga0501031_0270848 Ga0501031_0270848_61_870 253
64 3300049570 Ga0501033_0022193 Ga0501033_0022193_1709_2518 253
65 3300049570 Ga0501033_0066074 Ga0501033_0066074_1247_2056 253
66 3300049571 Ga0501034_0045835 Ga0501034_0045835_2316_3125 253
67 3300049571 Ga0501034_0053964 Ga0501034_0053964_2200_3009 253
68 3300049572 Ga0501036_0028319 Ga0501036_0028319_1681_2490 253
69 3300049573 Ga0501037_0017860 Ga0501037_0017860_2353_3162 253
70 3300049573 Ga0501037_0021894 Ga0501037_0021894_2072_2881 253
71 3300049574 Ga0501038_0012930 Ga0501038_0012930_4655_5464 253
72 3300049574 Ga0501038_0033789 Ga0501038_0033789_1890_2699 253
73 3300049575 Ga0501039_0005627 Ga0501039_0005627_2048_2857 253
74 3300049575 Ga0501039_0117776 Ga0501039_0117776_231_1040 253
75 3300049579 Ga0501043_0016674 Ga0501043_0016674_4478_5287 253
76 3300049581 Ga0501047_0120463 Ga0501047_0120463_1639_2448 253
77 3300049583 Ga0501067_0166199 Ga0501067_0166199_330_1139 253
78 3300049584 Ga0501068_0065472 Ga0501068_0065472_144_953 253
79 3300049585 Ga0501069_0028220 Ga0501069_0028220_1475_2284 253
80 3300049585 Ga0501069_0054634 Ga0501069_0054634_261_1028 253
81 3300049586 Ga0501070_0059260 Ga0501070_0059260_2084_2893 253
82 3300049586 Ga0501070_0122892 Ga0501070_0122892_51_860 253
83 3300049589 Ga0501073_0011304 Ga0501073_0011304_3622_4431 253
84 3300049590 Ga0501074_0038964 Ga0501074_0038964_320_1129 253
85 3300049742 Ga0501080_0024946 Ga0501080_0024946_2754_3563 253
86 3300049822 Ga0501035_0303610 Ga0501035_0303610_98_907 253
87 3300049823 Ga0501044_0022322 Ga0501044_0022322_1693_2502 253
88 3300049823 Ga0501044_0074060 Ga0501044_0074060_1682_2491 253
89 3300050489 nmdc:mga03683_3179_c1 nmdc:mga03683_3179_c1_1050_1910 253
90 iso_pu_bacteria 2713897090 2715498548 253
91 3300005347 Ga0070668_100003408 Ga0070668_1000034085 254
92 3300005353 Ga0070669_100172223 Ga0070669_1001722232 254
93 3300005355 Ga0070671_100110025 Ga0070671_1001100253 254
94 3300005548 Ga0070665_100175006 Ga0070665_1001750063 254
95 3300005843 Ga0068860_100182475 Ga0068860_1001824752 254
96 3300005844 Ga0068862_100035962 Ga0068862_1000359622 254
97 3300009177 Ga0105248_10005441 Ga0105248_1000544111 254
98 3300021377 Ga0213874_10001907 Ga0213874_100019074 254
99 3300025931 Ga0207644_10083284 Ga0207644_100832843 254
100 3300025941 Ga0207711_10012042 Ga0207711_100120424 254
101 3300025972 Ga0207668_10000621 Ga0207668_100006214 254
102 3300028379 Ga0268266_10109237 Ga0268266_101092373 254
103 3300028380 Ga0268265_10019735 Ga0268265_100197352 254
104 3300028381 Ga0268264_10496909 Ga0268264_104969092 254
105 3300028800 Ga0265338_10301744 Ga0265338_103017441 254
106 3300028800 Ga0265338_10304908 Ga0265338_103049081 254
107 3300031251 Ga0265327_10003967 Ga0265327_100039679 254
108 3300031344 Ga0265316_10092674 Ga0265316_100926742 254
109 3300039450 Ga0436363_0299925 Ga0436363_0299925_428_1210 254
110 3300048920 Ga0496117_0004161 Ga0496117_0004161_2338_3126 254
111 3300048921 Ga0496118_0000253 Ga0496118_0000253_3577_4365 254
112 iso_pu_bacteria 2841911363 2841917196 254
113 iso_pu_bacteria 2841917233 2841922817 254
114 iso_pu_bacteria 8054563764 8054564827 254
115 3300015265 Ga0182005_1007421 Ga0182005_10074212 255
116 3300031239 Ga0265328_10002278 Ga0265328_100022782 255
117 3300050514 nmdc:mga08x19_385_c1 nmdc:mga08x19_385_c1_14053_14829 255
118 3300053134 Ga0500658_0008931 Ga0500658_0008931_1596_2432 255
119 iso_pu_bacteria 2837651117 2837653595 255
120 iso_pu_bacteria 2915650412 2915653936 255
121 iso_pu_bacteria 2939669807 2939670989 255
122 3300002987 JGI25159J45721_1008252 JGI25159J45721_10082522 256
123 3300005262 Ga0065165_1000362 Ga0065165_100036232 256
124 3300006038 Ga0075365_10140050 Ga0075365_101400502 256
125 3300006186 Ga0075369_10026705 Ga0075369_100267052 256
126 3300010159 Ga0099796_10043203 Ga0099796_100432032 256
127 3300025284 Ga0209130_1000226 Ga0209130_100022639 256
128 3300039437 Ga0436365_0061733 Ga0436365_0061733_332_1108 256
129 3300039438 Ga0436360_0409267 Ga0436360_0409267_389_1180 256
130 3300039447 Ga0436361_0872634 Ga0436361_0872634_326_1174 256
131 3300041494 Ga0451837_1093985 Ga0451837_1093985_32_874 256
132 3300046692 Ga0495671_0137041 Ga0495671_0137041_223_1083 256
133 3300048911 Ga0496108_0060480 Ga0496108_0060480_79_1026 256
134 3300048914 Ga0496111_0163006 Ga0496111_0163006_625_1572 256
135 3300050494 nmdc:mga06z11_45150_c1 nmdc:mga06z11_45150_c1_1178_1960 256
136 3300050511 nmdc:mga08y16_36592_c1 nmdc:mga08y16_36592_c1_115_1041 256
137 iso_pu_bacteria 2643221736 2644744519 256
138 iso_pu_bacteria 2842918807 2842920331 256
139 iso_pu_bacteria 2884338543 2884339443 256
140 iso_pu_bacteria 2953994433 2953995623 256
141 iso_pu_bacteria 8002060224 8002060283 256
142 3300025294 Ga0209025_1000696 Ga0209025_100069620 257
143 3300031239 Ga0265328_10000056 Ga0265328_1000005623 257
144 iso_pu_bacteria 2593339239 2595450035 257
145 iso_pu_bacteria 2851182111 2851182514 257
146 iso_pu_bacteria 2919085039 2919086919 257
147 iso_pu_bacteria 8057529695 8057534805 257
148 3300003187 JGI25151J46595_10000022 JGI25151J46595_1000002211 258
149 3300003187 JGI25151J46595_10000135 JGI25151J46595_1000013571 258
150 3300003771 Ga0055526_1000123 Ga0055526_100012322 258
151 3300003771 Ga0055526_1000154 Ga0055526_100015427 258
152 3300003775 Ga0055524_1000023 Ga0055524_100002330 258
153 3300005262 Ga0065165_1000903 Ga0065165_10009037 258
154 3300005981 Ga0081538_10001948 Ga0081538_1000194819 258
155 3300013250 Ga0171462_1026 Ga0171462_102612 258
156 3300025273 Ga0209673_1014578 Ga0209673_10145782 258
157 3300025291 Ga0209675_1000618 Ga0209675_100061812 258
158 3300025292 Ga0209676_1057079 Ga0209676_10570791 258
159 3300025294 Ga0209025_1000016 Ga0209025_1000016555 258
160 3300025295 Ga0209564_1000075 Ga0209564_1000075252 258
161 3300025295 Ga0209564_1000076 Ga0209564_1000076186 258
162 3300025299 Ga0209256_1000083 Ga0209256_1000083186 258
163 3300025299 Ga0209256_1001241 Ga0209256_10012414 258
164 3300031239 Ga0265328_10006881 Ga0265328_100068813 258
165 3300031901 Ga0307406_10080331 Ga0307406_100803312 258
166 3300039145 Ga0237816_01322 Ga0237816_01322_382_1227 258
167 3300048925 Ga0496122_0130850 Ga0496122_0130850_579_1433 258
168 3300048928 Ga0496125_0147883 Ga0496125_0147883_86_916 258
169 3300049570 Ga0501033_0208809 Ga0501033_0208809_236_1090 258
170 3300050516 nmdc:mga0sz30_174928_c1 nmdc:mga0sz30_174928_c1_106_936 258
171 iso_pu_bacteria 2643221733 2644727761 258
172 iso_pu_bacteria 2643221734 2644733562 258
173 iso_pu_bacteria 2818991467 2819717179 258
174 iso_pu_bacteria 2917699015 2917701334 258
175 3300014497 Ga0182008_10061830 Ga0182008_100618301 259
176 3300025912 Ga0207707_10598311 Ga0207707_105983111 259
177 3300025921 Ga0207652_10042829 Ga0207652_100428292 259
178 3300026095 Ga0207676_10391587 Ga0207676_103915872 259
179 3300031250 Ga0265331_10000128 Ga0265331_1000012873 259
180 3300035692 Ga0373935_0244873 Ga0373935_0244873_21_917 259
181 3300035725 Ga0373947_0052993 Ga0373947_0052993_1172_2068 259
182 3300037068 Ga0373925_0084502 Ga0373925_0084502_82_978 259
183 3300046472 Ga0495580_0194521 Ga0495580_0194521_333_1229 259
184 3300046519 Ga0495632_0000008 Ga0495632_0000008_189191_189970 259
185 3300048927 Ga0496124_0304987 Ga0496124_0304987_168_947 259
186 3300002075 JGI24738J21930_10000892 JGI24738J21930_100008924 260
187 3300003323 rootH1_10150416 rootH1_101504163 260
188 3300005262 Ga0065165_1002575 Ga0065165_10025755 260
189 3300005344 Ga0070661_100042742 Ga0070661_1000427423 260
190 3300009101 Ga0105247_10005495 Ga0105247_100054953 260
191 3300010375 Ga0105239_10047970 Ga0105239_100479702 260
192 3300013104 Ga0157370_10000308 Ga0157370_1000030817 260
193 3300014497 Ga0182008_10002697 Ga0182008_100026976 260
194 3300015261 Ga0182006_1000034 Ga0182006_1000034121 260
195 3300015262 Ga0182007_10002843 Ga0182007_100028438 260
196 3300015265 Ga0182005_1000064 Ga0182005_100006416 260
197 3300015265 Ga0182005_1002321 Ga0182005_10023213 260
198 3300015265 Ga0182005_1002499 Ga0182005_10024992 260
199 3300015265 Ga0182005_1019959 Ga0182005_10199592 260
200 3300017792 Ga0163161_10042691 Ga0163161_100426914 260
201 3300025299 Ga0209256_1005866 Ga0209256_10058662 260
202 3300025920 Ga0207649_10062147 Ga0207649_100621473 260
203 3300031239 Ga0265328_10000012 Ga0265328_10000012100 260
204 3300031239 Ga0265328_10007305 Ga0265328_100073055 260
205 3300031250 Ga0265331_10002846 Ga0265331_100028465 260
206 3300031250 Ga0265331_10067682 Ga0265331_100676822 260
207 3300031344 Ga0265316_10032546 Ga0265316_100325463 260
208 3300031911 Ga0307412_10015240 Ga0307412_100152402 260
209 3300041404 Ga0439436_0000045 Ga0439436_0000045_19335_20117 260
210 3300041413 Ga0439465_0000412 Ga0439465_0000412_5097_5882 260
211 3300044672 Ga0466982_0000029 Ga0466982_0000029_43305_44087 260
212 3300044842 Ga0466957_0023121 Ga0466957_0023121_2183_2965 260
213 3300046452 Ga0495617_000122 Ga0495617_000122_7297_8103 260
214 3300046452 Ga0495617_002391 Ga0495617_002391_1961_2743 260
215 3300046460 Ga0495638_0000237 Ga0495638_0000237_48914_49696 260
216 3300046460 Ga0495638_0067824 Ga0495638_0067824_864_1670 260
217 3300046471 Ga0495650_0010096 Ga0495650_0010096_1754_2560 260
218 3300046491 Ga0495584_0012758 Ga0495584_0012758_2919_3725 260
219 3300046492 Ga0495585_0000180 Ga0495585_0000180_48919_49725 260
220 3300046492 Ga0495585_0006632 Ga0495585_0006632_3236_4042 260
221 3300046501 Ga0495607_0000008 Ga0495607_0000008_183890_184675 260
222 3300046501 Ga0495607_0000042 Ga0495607_0000042_124195_124977 260
223 3300046501 Ga0495607_0042496 Ga0495607_0042496_574_1359 260
224 3300046507 Ga0495606_0002419 Ga0495606_0002419_16744_17550 260
225 3300046507 Ga0495606_0064547 Ga0495606_0064547_358_1164 260
226 3300046512 Ga0495610_0004683 Ga0495610_0004683_5073_5855 260
227 3300046512 Ga0495610_0012639 Ga0495610_0012639_2260_3066 260
228 3300046513 Ga0495616_0000003 Ga0495616_0000003_258104_258910 260
229 3300046513 Ga0495616_0039984 Ga0495616_0039984_473_1255 260
230 3300046515 Ga0495620_0000182 Ga0495620_0000182_43268_44074 260
231 3300046518 Ga0495631_0000061 Ga0495631_0000061_19458_20264 260
232 3300046518 Ga0495631_0000380 Ga0495631_0000380_16251_17057 260
233 3300046519 Ga0495632_0000241 Ga0495632_0000241_1353_2144 260
234 3300046519 Ga0495632_0042235 Ga0495632_0042235_1338_2144 260
235 3300046524 Ga0495648_0020744 Ga0495648_0020744_448_1254 260
236 3300046616 Ga0495668_0004268 Ga0495668_0004268_2339_3148 260
237 3300046648 Ga0495611_0000004 Ga0495611_0000004_281638_282420 260
238 3300046648 Ga0495611_0000023 Ga0495611_0000023_103469_104275 260
239 3300046660 Ga0495625_0000024 Ga0495625_0000024_244615_245397 260
240 3300046665 Ga0495661_0003139 Ga0495661_0003139_1482_2288 260
241 3300046691 Ga0495670_0000198 Ga0495670_0000198_20117_20899 260
242 3300046691 Ga0495670_0000251 Ga0495670_0000251_11097_11879 260
243 3300046691 Ga0495670_0010005 Ga0495670_0010005_554_1360 260
244 3300046692 Ga0495671_0004625 Ga0495671_0004625_6820_7602 260
245 3300046694 Ga0495649_0034557 Ga0495649_0034557_1911_2693 260
246 3300046794 Ga0495589_0000397 Ga0495589_0000397_6300_7082 260
247 3300046810 Ga0495660_0000321 Ga0495660_0000321_4982_5764 260
248 3300046810 Ga0495660_0003612 Ga0495660_0003612_3848_4654 260
249 3300047446 Ga0495679_000011 Ga0495679_000011_25652_26434 260
250 3300047469 Ga0495673_0000036 Ga0495673_0000036_308906_309712 260
251 3300047469 Ga0495673_0000101 Ga0495673_0000101_162980_163786 260
252 3300047469 Ga0495673_0013842 Ga0495673_0013842_1144_1926 260
253 3300047472 Ga0495686_0000033 Ga0495686_0000033_82816_83598 260
254 3300047472 Ga0495686_0000608 Ga0495686_0000608_3506_4288 260
255 3300047472 Ga0495686_0015596 Ga0495686_0015596_1647_2453 260
256 3300047472 Ga0495686_0016024 Ga0495686_0016024_1435_2241 260
257 3300048903 Ga0496100_0045848 Ga0496100_0045848_1547_2332 260
258 3300048904 Ga0496101_0003334 Ga0496101_0003334_8583_9368 260
259 3300048905 Ga0496102_0283629 Ga0496102_0283629_691_1473 260
260 3300048909 Ga0496106_0008007 Ga0496106_0008007_1576_2382 260
261 3300048921 Ga0496118_0000590 Ga0496118_0000590_19215_19997 260
262 3300048924 Ga0496121_0000741 Ga0496121_0000741_2366_3172 260
263 3300048924 Ga0496121_0009919 Ga0496121_0009919_3319_4125 260
264 3300048924 Ga0496121_0100279 Ga0496121_0100279_941_1747 260
265 3300048925 Ga0496122_0018342 Ga0496122_0018342_1833_2618 260
266 3300048926 Ga0496123_0005472 Ga0496123_0005472_9071_9856 260
267 3300048926 Ga0496123_0009083 Ga0496123_0009083_6520_7305 260
268 3300048927 Ga0496124_0000313 Ga0496124_0000313_47401_48186 260
269 3300048927 Ga0496124_0000314 Ga0496124_0000314_42202_42987 260
270 3300048929 Ga0496126_0083930 Ga0496126_0083930_713_1519 260
271 3300049459 Ga0495678_000649 Ga0495678_000649_26907_27689 260
272 3300049460 Ga0495682_0018629 Ga0495682_0018629_1382_2164 260
273 3300049571 Ga0501034_0024267 Ga0501034_0024267_1299_2174 260
274 3300049823 Ga0501044_0006448 Ga0501044_0006448_5316_6191 260
275 3300049823 Ga0501044_0282568 Ga0501044_0282568_264_1106 260
276 3300053087 Ga0500643_000012 Ga0500643_000012_280911_281693 260
277 3300053103 Ga0500555_000600 Ga0500555_000600_6321_7103 260
278 3300053160 Ga0500633_0001923 Ga0500633_0001923_606_1412 260
279 iso_pu_bacteria 2511231027 2511389589 260
280 iso_pu_bacteria 2599185156 2599331483 260
281 iso_pu_bacteria 2718218334 2721028746 260
282 iso_pu_bacteria 2734482264 2735835667 260
283 iso_pu_bacteria 2891088606 2891089031 260
284 iso_pu_bacteria 2904463128 2904465977 260
285 iso_pu_bacteria 8048746797 8048747592 260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

58

208

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.965 5 244
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9607 5 244
7ch8-assembly1.cif.gz_I cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9599 5 244
7d06-assembly1.cif.gz_B cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.9512 4 244
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9454 5 246
ID Description Score Start End Superfamily
af_P9WQL5_26_341_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9623 7 246 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9536 5 245 3.40.50.300
af_P37313_10_333_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9513 4 244 3.40.50.300
af_Q2G1F8_275_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9506 6 244 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9405 2 221 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A522AFW5-F1-model_v4 ATP-binding cassette domain-containing protein 0.9806 2 249 GO:0005524
GO:0016887
AF-A0A377GL99-F1-model_v4 Uncharacterized ABC transporter ATP-binding protein HI_1087 0.9727 4 243 GO:0005524
GO:0016887
AF-A0A1B6Z4L2-F1-model_v4 ABC transporter ATP-binding protein 0.9726 3 257 GO:0005524
GO:0016887
AF-A0A3B9RKA9-F1-model_v4 deleted 0.9671 143 253
AF-A0A3C0PHH4-F1-model_v4 ABC transporter ATP-binding protein 0.9579 2 243 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
91.36 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map