F386824

General Info

Members Datasets Scaffolds Average Seq Length
285 170 570 191

Family's Representative Sequence

Representative Sequence 3300022730|Ga0224570_100605|Ga0224570_1006051
Length 218
Sequence MNPFRTHRGRVAPLDRVNVDTDQIIPKQFLKRIERTGFGQFLFYDWRFSADGKKNADSVPGPSAPEQFVLDRPRYKGASILVAGKNFGCGSSREHAVWALADFGFRAVISSSFADIFANNSTKNGFLTVLLSEREVAELMRRTRETNDYQLTIDLEQCEVSDEQGFRAKFPVDEFVRHCLLNGLDDIGLTLQHEAEITAYEMRHPASTALGAAERASS

Samples

Sample ID Description Type Environment
1 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
95 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
101 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
102 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
105 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
106 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
107 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
119 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
120 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
121 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
122 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.89
Metatranscriptomes 2.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.86
Rhizosphere 93.33
Stem 0
Stem Tuber 0
Unclassified 4.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0224570_100605 3300022730 Bacteria 2858
2 Ga0006562J51391_1026681 3300003578 Bacteria 2301
3 Ga0065707_10226934 3300005295 Bacteria 1203
4 Ga0070683_100038154 3300005329 Bacteria 4401
5 Ga0070690_100764539 3300005330 Bacteria 747
6 Ga0070687_100131796 3300005343 Bacteria 1444
7 Ga0070692_10002575 3300005345 Bacteria 7075
8 Ga0070692_10011633 3300005345 Bacteria 4045
9 Ga0070674_100144394 3300005356 Bacteria 1790
10 Ga0070688_100208914 3300005365 Bacteria 1370
11 Ga0070659_100000132 3300005366 Bacteria 56931
12 Ga0070709_10002749 3300005434 Bacteria 9517
13 Ga0070709_10109024 3300005434 Bacteria 1858
14 Ga0070714_100000347 3300005435 Bacteria 34714
15 Ga0070714_100005669 3300005435 Bacteria 9554
16 Ga0070714_100041946 3300005435 Bacteria 3863
17 Ga0070714_100050103 3300005435 Bacteria 3556
18 Ga0070714_100391450 3300005435 Bacteria 1312
19 Ga0070713_100000876 3300005436 Bacteria 19291
20 Ga0070713_100024438 3300005436 Bacteria 4706
21 Ga0070713_100058925 3300005436 Bacteria 3204
22 Ga0070713_100368769 3300005436 Bacteria 1335
23 Ga0070713_100740513 3300005436 Bacteria 940
24 Ga0070713_101644540 3300005436 Unclassified 623
25 Ga0070710_10012120 3300005437 Bacteria 4273
26 Ga0070711_100000080 3300005439 Bacteria 53781
27 Ga0070711_100077890 3300005439 Bacteria 2354
28 Ga0070711_100384345 3300005439 Bacteria 1136
29 Ga0070705_100023631 3300005440 Bacteria 3305
30 Ga0070694_100000338 3300005444 Bacteria 25162
31 Ga0070663_101106974 3300005455 Bacteria 693
32 Ga0070706_100321119 3300005467 Bacteria 1444
33 Ga0070707_100024668 3300005468 Bacteria 5698
34 Ga0070707_100137211 3300005468 Bacteria 2379
35 Ga0070707_100682325 3300005468 Bacteria 990
36 Ga0070698_100883656 3300005471 Bacteria 839
37 Ga0070684_100118822 3300005535 Bacteria 2377
38 Ga0070686_100084178 3300005544 Bacteria 2113
39 Ga0070695_100588131 3300005545 Bacteria 872
40 Ga0070696_100088351 3300005546 Bacteria 2203
41 Ga0068855_100811053 3300005563 Bacteria 994
42 Ga0070664_100860288 3300005564 Bacteria 849
43 Ga0068856_100033192 3300005614 Bacteria 5054
44 Ga0068856_100051818 3300005614 Bacteria 4046
45 Ga0068856_100530342 3300005614 Bacteria 1198
46 Ga0070702_100272574 3300005615 Bacteria 1158
47 Ga0068859_100963220 3300005617 Bacteria 936
48 Ga0070717_10000059 3300006028 Bacteria 92958
49 Ga0070717_10067625 3300006028 Bacteria 2973
50 Ga0070717_10125168 3300006028 Bacteria 2206
51 Ga0070717_10152031 3300006028 Bacteria 2003
52 Ga0070717_10168125 3300006028 Bacteria 1906
53 Ga0070717_10169587 3300006028 Bacteria 1898
54 Ga0070717_10285976 3300006028 Bacteria 1463
55 Ga0070715_10002178 3300006163 Bacteria 5938
56 Ga0070715_10004229 3300006163 Bacteria 4684
57 Ga0070716_100013441 3300006173 Bacteria 4172
58 Ga0070716_100020243 3300006173 Bacteria 3491
59 Ga0070716_100534479 3300006173 Bacteria 871
60 Ga0070712_100000551 3300006175 Bacteria 21697
61 Ga0070712_100058263 3300006175 Bacteria 2717
62 Ga0070712_100104130 3300006175 Unclassified 2105
63 Ga0097621_101042128 3300006237 Bacteria 766
64 Ga0068871_100176571 3300006358 Bacteria 1834
65 Ga0075428_100117878 3300006844 Bacteria 2892
66 Ga0075428_100382207 3300006844 Bacteria 1509
67 Ga0075428_100633102 3300006844 Bacteria 1141
68 Ga0075428_100676568 3300006844 Bacteria 1100
69 Ga0075430_100289909 3300006846 Bacteria 1354
70 Ga0075431_100018351 3300006847 Bacteria 7124
71 Ga0075431_100241949 3300006847 Bacteria 1835
72 Ga0075433_10031875 3300006852 Bacteria 4509
73 Ga0075434_100049319 3300006871 Bacteria 4180
74 Ga0075434_100064129 3300006871 Bacteria 3658
75 Ga0075434_100111191 3300006871 Bacteria 2750
76 Ga0075434_100194467 3300006871 Bacteria 2049
77 Ga0075429_100133037 3300006880 Bacteria 2176
78 Ga0075436_100074517 3300006914 Bacteria 2350
79 Ga0075436_100647833 3300006914 Bacteria 780
80 Ga0075436_100704750 3300006914 Unclassified 748
81 Ga0097620_100963275 3300006931 Bacteria 936
82 Ga0075435_100579349 3300007076 Bacteria 973
83 Ga0075435_100676011 3300007076 Bacteria 897
84 Ga0075435_100858336 3300007076 Bacteria 791
85 Ga0075435_100880318 3300007076 Bacteria 781
86 Ga0075435_100965616 3300007076 Bacteria 744
87 Ga0099794_10262646 3300007265 Bacteria 891
88 Ga0105250_10006225 3300009092 Bacteria 5238
89 Ga0105240_10061338 3300009093 Bacteria 4686
90 Ga0111539_10002938 3300009094 Bacteria 22597
91 Ga0111539_10275955 3300009094 Bacteria 1956
92 Ga0111539_10743934 3300009094 Bacteria 1141
93 Ga0111539_10800356 3300009094 Bacteria 1097
94 Ga0105245_10057561 3300009098 Bacteria 3497
95 Ga0114129_10002892 3300009147 Bacteria 24030
96 Ga0114129_10011140 3300009147 Bacteria 12818
97 Ga0114129_10021862 3300009147 Bacteria 9078
98 Ga0114129_10023733 3300009147 Bacteria 8694
99 Ga0114129_10055050 3300009147 Bacteria 5576
100 Ga0114129_10272142 3300009147 Bacteria 2266
101 Ga0114129_10359893 3300009147 Bacteria 1925
102 Ga0114129_11754265 3300009147 Bacteria 756
103 Ga0114129_11964071 3300009147 Bacteria 708
104 Ga0105243_10002510 3300009148 Bacteria 15315
105 Ga0105241_10019783 3300009174 Bacteria 4969
106 Ga0105241_10061297 3300009174 Bacteria 2896
107 Ga0105242_10431284 3300009176 Bacteria 1238
108 Ga0105248_10784132 3300009177 Bacteria 1076
109 Ga0105237_10050604 3300009545 Bacteria 4174
110 Ga0105239_10528816 3300010375 Bacteria 1342
111 Ga0157373_10002519 3300013100 Bacteria 13955
112 Ga0157373_10418965 3300013100 Bacteria 961
113 Ga0157370_10107293 3300013104 Unclassified 2612
114 Ga0157369_10706621 3300013105 Bacteria 1038
115 Ga0157378_10593753 3300013297 Bacteria 1118
116 Ga0157372_10018008 3300013307 Bacteria 7592
117 Ga0157375_10628292 3300013308 Bacteria 1232
118 Ga0163163_10769141 3300014325 Bacteria 1026
119 Ga0163163_11854295 3300014325 Bacteria 663
120 Ga0157376_10111177 3300014969 Bacteria 2412
121 Ga0163161_10669809 3300017792 Bacteria 861
122 Ga0213876_10082218 3300021384 Bacteria 1704
123 Ga0213875_10004576 3300021388 Bacteria 7551
124 Ga0228598_1001460 3300024227 Bacteria 5206
125 Ga0228598_1017878 3300024227 Bacteria 1399
126 Ga0228598_1061665 3300024227 Bacteria 747
127 Ga0207692_10015217 3300025898 Bacteria 3380
128 Ga0207699_10001031 3300025906 Bacteria 13137
129 Ga0207699_10006778 3300025906 Bacteria 5568
130 Ga0207645_10638179 3300025907 Bacteria 723
131 Ga0207684_10120431 3300025910 Bacteria 2250
132 Ga0207654_10042513 3300025911 Unclassified 2573
133 Ga0207707_10044596 3300025912 Bacteria 3866
134 Ga0207695_10256556 3300025913 Bacteria 1647
135 Ga0207671_10251155 3300025914 Bacteria 1390
136 Ga0207693_10000131 3300025915 Bacteria 67893
137 Ga0207693_10005205 3300025915 Bacteria 10890
138 Ga0207693_10015903 3300025915 Bacteria 6023
139 Ga0207693_10286754 3300025915 Unclassified 1290
140 Ga0207693_10493022 3300025915 Bacteria 957
141 Ga0207663_10009243 3300025916 Bacteria 5199
142 Ga0207663_10326915 3300025916 Bacteria 1154
143 Ga0207660_10693922 3300025917 Bacteria 830
144 Ga0207646_10075239 3300025922 Bacteria 3017
145 Ga0207646_10103976 3300025922 Bacteria 2547
146 Ga0207646_10539729 3300025922 Bacteria 1049
147 Ga0207646_10641475 3300025922 Bacteria 952
148 Ga0207646_11088467 3300025922 Eukaryota 704
149 Ga0207700_10000852 3300025928 Bacteria 17553
150 Ga0207700_10002088 3300025928 Bacteria 11395
151 Ga0207700_10054518 3300025928 Bacteria 3001
152 Ga0207664_10000310 3300025929 Bacteria 36142
153 Ga0207664_10008500 3300025929 Bacteria 7166
154 Ga0207664_10046190 3300025929 Bacteria 3418
155 Ga0207664_10235876 3300025929 Bacteria 1591
156 Ga0207664_10264296 3300025929 Bacteria 1506
157 Ga0207690_10001305 3300025932 Bacteria 15653
158 Ga0207709_10416822 3300025935 Bacteria 1030
159 Ga0207669_10260438 3300025937 Bacteria 1297
160 Ga0207704_10148642 3300025938 Bacteria 1650
161 Ga0207665_10030450 3300025939 Bacteria 3566
162 Ga0207665_10050132 3300025939 Bacteria 2807
163 Ga0207665_10207363 3300025939 Bacteria 1430
164 Ga0207665_10307366 3300025939 Bacteria 1187
165 Ga0207679_11011184 3300025945 Bacteria 762
166 Ga0207702_10009785 3300026078 Bacteria 8043
167 Ga0207702_10098661 3300026078 Unclassified 2573
168 Ga0207648_10222953 3300026089 Bacteria 1676
169 Ga0207675_101231119 3300026118 Bacteria 769
170 Ga0207428_10072421 3300027907 Bacteria 2705
171 Ga0207428_10608434 3300027907 Unclassified 787
172 Ga0265356_1000507 3300028017 Bacteria 7035
173 Ga0265319_1003540 3300028563 Bacteria 8105
174 Ga0265338_10045220 3300028800 Bacteria 4052
175 Ga0265338_10197952 3300028800 Bacteria 1517
176 Ga0265338_10484588 3300028800 Bacteria 872
177 Ga0265762_1002834 3300030760 Bacteria 3101
178 Ga0265762_1009843 3300030760 Bacteria 1707
179 Ga0265762_1046825 3300030760 Bacteria 859
180 Ga0265760_10011564 3300031090 Bacteria 2521
181 Ga0265760_10016594 3300031090 Bacteria 2113
182 Ga0265316_10171142 3300031344 Bacteria 1620
183 Ga0316578_10072812 3300031728 Bacteria 2036
184 Ga0373926_0123511 3300035083 Bacteria 977
185 Ga0373923_0050247 3300035111 Bacteria 1746
186 Ga0373936_0044871 3300035113 Bacteria 1779
187 Ga0373945_0024047 3300035116 Bacteria 2108
188 Ga0373954_0181912 3300035118 Unclassified 1031
189 Ga0373946_0077392 3300035171 Bacteria 1450
190 Ga0373924_0358449 3300035410 Bacteria 650
191 Ga0373927_0162128 3300035695 Bacteria 1465
192 Ga0373947_0068319 3300035725 Bacteria 2173
193 Ga0373937_0306039 3300036401 Unclassified 1503
194 Ga0373937_0357996 3300036401 Bacteria 1383
195 Ga0373937_0423859 3300036401 Bacteria 1263
196 Ga0373925_0374012 3300037068 Bacteria 1159
197 Ga0373925_0412717 3300037068 Bacteria 1102
198 Ga0395898_0201069 3300037466 Bacteria 1902
199 Ga0395905_0569783 3300037471 Bacteria 1034
200 Ga0436364_0113354 3300037853 Bacteria 11149
201 Ga0436364_0585883 3300037853 Bacteria 1136
202 Ga0400483_132252 3300039062 Bacteria 18297
203 Ga0400483_246612 3300039062 Bacteria 30614
204 Ga0436365_0665495 3300039437 Bacteria 6543
205 Ga0436362_0614080 3300039453 Bacteria 1020
206 Ga0451797_0928166 3300041453 Bacteria 600
207 Ga0439456_004124 3300042013 Bacteria 2946
208 Ga0450902_056097 3300042137 Bacteria 678
209 Ga0450905_088029 3300042142 Bacteria 546
210 Ga0450906_015674 3300042145 Bacteria 1375
211 Ga0453684_0136076 3300044712 Bacteria 2942
212 Ga0466959_0336694 3300045049 Bacteria 1030
213 Ga0466958_0192298 3300045836 Bacteria 1297
214 Ga0495629_0049786 3300046459 Bacteria 2936
215 Ga0495580_0001900 3300046472 Bacteria 18368
216 Ga0495580_0002512 3300046472 Bacteria 16001
217 Ga0495582_0000558 3300046473 Bacteria 20599
218 Ga0495594_0160884 3300046499 Bacteria 1276
219 Ga0495607_0175486 3300046501 Bacteria 1078
220 Ga0495630_0225763 3300046517 Bacteria 1430
221 Ga0495665_0189518 3300046531 Bacteria 1067
222 Ga0495665_0284335 3300046531 Bacteria 848
223 Ga0495665_0458669 3300046531 Bacteria 644
224 Ga0495640_0368841 3300046533 Bacteria 884
225 Ga0495586_0061413 3300046535 Bacteria 2045
226 Ga0495645_0135536 3300046543 Unclassified 1723
227 Ga0495634_0366730 3300046642 Bacteria 860
228 Ga0495658_0085236 3300046683 Bacteria 1862
229 Ga0495613_0080955 3300046689 Bacteria 2360
230 Ga0495649_0203472 3300046694 Bacteria 1027
231 Ga0495674_0189169 3300047319 Bacteria 1711
232 Ga0495672_0015067 3300047320 Bacteria 5262
233 Ga0495673_0101194 3300047469 Bacteria 1164
234 Ga0495593_0110271 3300047673 Bacteria 1406
235 Ga0496102_0512700 3300048905 Bacteria 1122
236 Ga0496103_0052428 3300048906 Bacteria 2527
237 Ga0496104_0121507 3300048907 Bacteria 2508
238 Ga0496104_0498217 3300048907 Bacteria 1129
239 Ga0496105_0206924 3300048908 Bacteria 1600
240 Ga0496105_0542222 3300048908 Bacteria 909
241 Ga0496109_0608029 3300048912 Bacteria 1029
242 Ga0496112_0029193 3300048915 Bacteria 5332
243 Ga0496113_0013063 3300048916 Bacteria 5607
244 Ga0496114_0104880 3300048917 Bacteria 2418
245 Ga0501031_0346372 3300049568 Bacteria 962
246 Ga0501034_0004445 3300049571 Bacteria 15584
247 Ga0501038_0255135 3300049574 Bacteria 1388
248 Ga0501041_0167370 3300049577 Bacteria 1375
249 Ga0501073_0894433 3300049589 Bacteria 611
250 Ga0501075_0105078 3300049591 Bacteria 2146
251 Ga0501077_0110036 3300049593 Bacteria 1746
252 Ga0501045_0223153 3300049824 Bacteria 1403
253 nmdc:mga05p37_104506_c1 3300050507 Bacteria 3485
254 nmdc:mga05p37_10937_c1 3300050507 Bacteria 10774
255 nmdc:mga05p37_10943_c1 3300050507 Bacteria 10772
256 nmdc:mga05p37_1425790_c1 3300050507 Bacteria 695
257 nmdc:mga05p37_1495808_c1 3300050507 Unclassified 673
258 nmdc:mga05p37_15381_c1 3300050507 Bacteria 9192
259 nmdc:mga05p37_379851_c1 3300050507 Bacteria 1656
260 nmdc:mga09592_25265_c1 3300050508 Bacteria 4915
261 nmdc:mga09592_542783_c1 3300050508 Bacteria 999
262 nmdc:mga09592_83691_c1 3300050508 Bacteria 2719
263 nmdc:mga0qj67_262942_c1 3300050509 Bacteria 1399
264 nmdc:mga06r32_1526670_c1 3300050510 Bacteria 608
265 nmdc:mga06r32_445578_c1 3300050510 Bacteria 1275
266 nmdc:mga08y16_1672641_c1 3300050511 Bacteria 592
267 nmdc:mga08y16_16974_c1 3300050511 Bacteria 7666
268 nmdc:mga08y16_547893_c1 3300050511 Bacteria 1171
269 nmdc:mga0n895_139254_c1 3300050512 Bacteria 2454
270 nmdc:mga0n895_2061777_c1 3300050512 Archaea 527
271 nmdc:mga0n895_55458_c1 3300050512 Bacteria 3900
272 nmdc:mga0n895_59299_c1 3300050512 Bacteria 3776
273 nmdc:mga0n895_641288_c1 3300050512 Bacteria 1062
274 nmdc:mga0rr50_1447594_c1 3300050513 Bacteria 581
275 nmdc:mga0rr50_570690_c1 3300050513 Unclassified 964
276 nmdc:mga0rr50_609227_c1 3300050513 Bacteria 931
277 nmdc:mga0rr50_66170_c1 3300050513 Bacteria 2740
278 nmdc:mga0rr50_839228_c1 3300050513 Bacteria 784
279 nmdc:mga08x19_165767_c1 3300050514 Bacteria 1502
280 nmdc:mga08x19_503565_c1 3300050514 Bacteria 855
281 nmdc:mga08x19_600878_c1 3300050514 Unclassified 780
282 nmdc:mga0a205_219571_c1 3300050515 Bacteria 1787
283 nmdc:mga0a205_32797_c1 3300050515 Bacteria 4978
284 Ga0495601_0293784 3300053077 Bacteria 1059
285 Ga0501082_0148541 3300060353 Bacteria 2035
286 Ga0224570_100605
287 Ga0006562J51391_1026681
288 Ga0065707_10226934
289 Ga0070683_100038154
290 Ga0070690_100764539
291 Ga0070687_100131796
292 Ga0070692_10002575
293 Ga0070692_10011633
294 Ga0070674_100144394
295 Ga0070688_100208914
296 Ga0070659_100000132
297 Ga0070709_10002749
298 Ga0070709_10109024
299 Ga0070714_100000347
300 Ga0070714_100005669
301 Ga0070714_100041946
302 Ga0070714_100050103
303 Ga0070714_100391450
304 Ga0070713_100000876
305 Ga0070713_100024438
306 Ga0070713_100058925
307 Ga0070713_100368769
308 Ga0070713_100740513
309 Ga0070713_101644540
310 Ga0070710_10012120
311 Ga0070711_100000080
312 Ga0070711_100077890
313 Ga0070711_100384345
314 Ga0070705_100023631
315 Ga0070694_100000338
316 Ga0070663_101106974
317 Ga0070706_100321119
318 Ga0070707_100024668
319 Ga0070707_100137211
320 Ga0070707_100682325
321 Ga0070698_100883656
322 Ga0070684_100118822
323 Ga0070686_100084178
324 Ga0070695_100588131
325 Ga0070696_100088351
326 Ga0068855_100811053
327 Ga0070664_100860288
328 Ga0068856_100033192
329 Ga0068856_100051818
330 Ga0068856_100530342
331 Ga0070702_100272574
332 Ga0068859_100963220
333 Ga0070717_10000059
334 Ga0070717_10067625
335 Ga0070717_10125168
336 Ga0070717_10152031
337 Ga0070717_10168125
338 Ga0070717_10169587
339 Ga0070717_10285976
340 Ga0070715_10002178
341 Ga0070715_10004229
342 Ga0070716_100013441
343 Ga0070716_100020243
344 Ga0070716_100534479
345 Ga0070712_100000551
346 Ga0070712_100058263
347 Ga0070712_100104130
348 Ga0097621_101042128
349 Ga0068871_100176571
350 Ga0075428_100117878
351 Ga0075428_100382207
352 Ga0075428_100633102
353 Ga0075428_100676568
354 Ga0075430_100289909
355 Ga0075431_100018351
356 Ga0075431_100241949
357 Ga0075433_10031875
358 Ga0075434_100049319
359 Ga0075434_100064129
360 Ga0075434_100111191
361 Ga0075434_100194467
362 Ga0075429_100133037
363 Ga0075436_100074517
364 Ga0075436_100647833
365 Ga0075436_100704750
366 Ga0097620_100963275
367 Ga0075435_100579349
368 Ga0075435_100676011
369 Ga0075435_100858336
370 Ga0075435_100880318
371 Ga0075435_100965616
372 Ga0099794_10262646
373 Ga0105250_10006225
374 Ga0105240_10061338
375 Ga0111539_10002938
376 Ga0111539_10275955
377 Ga0111539_10743934
378 Ga0111539_10800356
379 Ga0105245_10057561
380 Ga0114129_10002892
381 Ga0114129_10011140
382 Ga0114129_10021862
383 Ga0114129_10023733
384 Ga0114129_10055050
385 Ga0114129_10272142
386 Ga0114129_10359893
387 Ga0114129_11754265
388 Ga0114129_11964071
389 Ga0105243_10002510
390 Ga0105241_10019783
391 Ga0105241_10061297
392 Ga0105242_10431284
393 Ga0105248_10784132
394 Ga0105237_10050604
395 Ga0105239_10528816
396 Ga0157373_10002519
397 Ga0157373_10418965
398 Ga0157370_10107293
399 Ga0157369_10706621
400 Ga0157378_10593753
401 Ga0157372_10018008
402 Ga0157375_10628292
403 Ga0163163_10769141
404 Ga0163163_11854295
405 Ga0157376_10111177
406 Ga0163161_10669809
407 Ga0213876_10082218
408 Ga0213875_10004576
409 Ga0228598_1001460
410 Ga0228598_1017878
411 Ga0228598_1061665
412 Ga0207692_10015217
413 Ga0207699_10001031
414 Ga0207699_10006778
415 Ga0207645_10638179
416 Ga0207684_10120431
417 Ga0207654_10042513
418 Ga0207707_10044596
419 Ga0207695_10256556
420 Ga0207671_10251155
421 Ga0207693_10000131
422 Ga0207693_10005205
423 Ga0207693_10015903
424 Ga0207693_10286754
425 Ga0207693_10493022
426 Ga0207663_10009243
427 Ga0207663_10326915
428 Ga0207660_10693922
429 Ga0207646_10075239
430 Ga0207646_10103976
431 Ga0207646_10539729
432 Ga0207646_10641475
433 Ga0207646_11088467
434 Ga0207700_10000852
435 Ga0207700_10002088
436 Ga0207700_10054518
437 Ga0207664_10000310
438 Ga0207664_10008500
439 Ga0207664_10046190
440 Ga0207664_10235876
441 Ga0207664_10264296
442 Ga0207690_10001305
443 Ga0207709_10416822
444 Ga0207669_10260438
445 Ga0207704_10148642
446 Ga0207665_10030450
447 Ga0207665_10050132
448 Ga0207665_10207363
449 Ga0207665_10307366
450 Ga0207679_11011184
451 Ga0207702_10009785
452 Ga0207702_10098661
453 Ga0207648_10222953
454 Ga0207675_101231119
455 Ga0207428_10072421
456 Ga0207428_10608434
457 Ga0265356_1000507
458 Ga0265319_1003540
459 Ga0265338_10045220
460 Ga0265338_10197952
461 Ga0265338_10484588
462 Ga0265762_1002834
463 Ga0265762_1009843
464 Ga0265762_1046825
465 Ga0265760_10011564
466 Ga0265760_10016594
467 Ga0265316_10171142
468 Ga0316578_10072812
469 Ga0373926_0123511
470 Ga0373923_0050247
471 Ga0373936_0044871
472 Ga0373945_0024047
473 Ga0373954_0181912
474 Ga0373946_0077392
475 Ga0373924_0358449
476 Ga0373927_0162128
477 Ga0373947_0068319
478 Ga0373937_0306039
479 Ga0373937_0357996
480 Ga0373937_0423859
481 Ga0373925_0374012
482 Ga0373925_0412717
483 Ga0395898_0201069
484 Ga0395905_0569783
485 Ga0436364_0113354
486 Ga0436364_0585883
487 Ga0400483_132252
488 Ga0400483_246612
489 Ga0436365_0665495
490 Ga0436362_0614080
491 Ga0451797_0928166
492 Ga0439456_004124
493 Ga0450902_056097
494 Ga0450905_088029
495 Ga0450906_015674
496 Ga0453684_0136076
497 Ga0466959_0336694
498 Ga0466958_0192298
499 Ga0495629_0049786
500 Ga0495580_0001900
501 Ga0495580_0002512
502 Ga0495582_0000558
503 Ga0495594_0160884
504 Ga0495607_0175486
505 Ga0495630_0225763
506 Ga0495665_0189518
507 Ga0495665_0284335
508 Ga0495665_0458669
509 Ga0495640_0368841
510 Ga0495586_0061413
511 Ga0495645_0135536
512 Ga0495634_0366730
513 Ga0495658_0085236
514 Ga0495613_0080955
515 Ga0495649_0203472
516 Ga0495674_0189169
517 Ga0495672_0015067
518 Ga0495673_0101194
519 Ga0495593_0110271
520 Ga0496102_0512700
521 Ga0496103_0052428
522 Ga0496104_0121507
523 Ga0496104_0498217
524 Ga0496105_0206924
525 Ga0496105_0542222
526 Ga0496109_0608029
527 Ga0496112_0029193
528 Ga0496113_0013063
529 Ga0496114_0104880
530 Ga0501031_0346372
531 Ga0501034_0004445
532 Ga0501038_0255135
533 Ga0501041_0167370
534 Ga0501073_0894433
535 Ga0501075_0105078
536 Ga0501077_0110036
537 Ga0501045_0223153
538 nmdc:mga05p37_104506_c1
539 nmdc:mga05p37_10937_c1
540 nmdc:mga05p37_10943_c1
541 nmdc:mga05p37_1425790_c1
542 nmdc:mga05p37_1495808_c1
543 nmdc:mga05p37_15381_c1
544 nmdc:mga05p37_379851_c1
545 nmdc:mga09592_25265_c1
546 nmdc:mga09592_542783_c1
547 nmdc:mga09592_83691_c1
548 nmdc:mga0qj67_262942_c1
549 nmdc:mga06r32_1526670_c1
550 nmdc:mga06r32_445578_c1
551 nmdc:mga08y16_1672641_c1
552 nmdc:mga08y16_16974_c1
553 nmdc:mga08y16_547893_c1
554 nmdc:mga0n895_139254_c1
555 nmdc:mga0n895_2061777_c1
556 nmdc:mga0n895_55458_c1
557 nmdc:mga0n895_59299_c1
558 nmdc:mga0n895_641288_c1
559 nmdc:mga0rr50_1447594_c1
560 nmdc:mga0rr50_570690_c1
561 nmdc:mga0rr50_609227_c1
562 nmdc:mga0rr50_66170_c1
563 nmdc:mga0rr50_839228_c1
564 nmdc:mga08x19_165767_c1
565 nmdc:mga08x19_503565_c1
566 nmdc:mga08x19_600878_c1
567 nmdc:mga0a205_219571_c1
568 nmdc:mga0a205_32797_c1
569 Ga0495601_0293784
570 Ga0501082_0148541

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00694

Aconitase_C

Aconitase C-terminal domain

1

134

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q3w-assembly1.cif.gz_A isopropylmalate isomerase small subunit from campylobacter jejuni. 0.9699 1 185
3q3w-assembly1.cif.gz_A isopropylmalate isomerase small subunit from campylobacter jejuni. 0.954 1 185
2hcu-assembly1.cif.gz_A crystal structure of smu.1381 (or leud) from streptococcus mutans 0.9506 1 184
3h5j-assembly1.cif.gz_A leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9448 1 184
3h5j-assembly1.cif.gz_A leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9393 1 184
ID Description Score Start End Superfamily
3q3wA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9684 1 185 3.20.19.10
af_O14289_535_712_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9634 1 187 3.20.19.10
3q3wA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9577 1 185 3.20.19.10
af_Q2FWK0_1_171_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9573 2 184 3.20.19.10
3h5jA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9448 1 184 3.20.19.10
ID Description Score Start End GO Terms
AF-A0A533XLR3-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9994 62 148 GO:0003861
GO:0009098
GO:0009316
AF-A0A659SHW6-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9835 73 205 GO:0003861
GO:0009098
GO:0009316
AF-A0A5U4RIL6-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9825 2 184 GO:0003861
GO:0009098
GO:0009316
AF-A0A4Q3TAS6-F1-model_v4 deleted 0.9807 1 142
AF-A0A3D0TFR5-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9805 1 139 GO:0003861
GO:0009098
GO:0009316

Map