F386744

General Info

Members Datasets Scaffolds Average Seq Length
285 186 285 463

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10022423|Ga0105240_100224236
Length 498
Sequence MIGYSSASAKGLSHQQNSPASRDSNQLTTVRNLNPHINWQRWTKVIVSVSAIALLGTCAPLPSLIDQIKTLGELRMVTRNGPLAYYRGPGDIPEGPEYELARRFADELGVKLKVIPVHTYAEIYAALTTGHAQLAAAGLKVPAQNIPGIEFGPAYQRVTEHLIYRRGAARPNSLADIGGADLEIAAGSSHAKTLYAARNTLPDLVWVENASTDTQALLDGVANGTIDYTIADSTEFALAHDAHPDLRVAFDFAGTQSLAWAASTRNPGFLHDLYGYFGRLSLDGELASIVKRYYGRSEEVHFAGARAAGTRGFMRHLQSRLPLYKKWFQEAAQQSSQDWRLLAAIGYEESKWNPSAASASGAKGLMQLTAQSANAVKVSDPADARQSIFGGARYFRQVYAKIPAHVPEPDRTWFALAAYNIGYGHLEDARVLAQKAGRDPDSWQDVREFLPLLEQEQWYTQTENGYARGSEPVRYVDNVRGYRDMLEWAWGAGRPALN

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
38 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
85 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
97 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
105 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
119 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
120 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
121 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
122 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
123 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
124 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
125 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
148 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
177 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
178 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
179 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
180 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
181 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
182 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 1.05
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.16
Nodule 0
Rhizoplane 3.16
Rhizosphere 85.96
Stem 0
Stem Tuber 0
Unclassified 7.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10103653 3300005290 Bacteria 1971
2 Ga0070683_100279670 3300005329 Bacteria 1587
3 Ga0070666_10004506 3300005335 Bacteria 8488
4 Ga0070666_10014409 3300005335 Bacteria 5033
5 Ga0070680_100020167 3300005336 Bacteria 5289
6 Ga0070680_100059486 3300005336 Bacteria 3126
7 Ga0070680_100067283 3300005336 Bacteria 2938
8 Ga0070660_100076168 3300005339 Bacteria 2627
9 Ga0070675_100004438 3300005354 Bacteria 10693
10 Ga0070671_100002494 3300005355 Bacteria 14239
11 Ga0070671_100010633 3300005355 Bacteria 7386
12 Ga0070667_100006632 3300005367 Bacteria 9623
13 Ga0070667_100011574 3300005367 Bacteria 7292
14 Ga0070709_10003890 3300005434 Bacteria 8048
15 Ga0070709_10049739 3300005434 Bacteria 2622
16 Ga0070713_100003136 3300005436 Bacteria 10880
17 Ga0070713_100192638 3300005436 Bacteria 1838
18 Ga0070678_100057413 3300005456 Bacteria 2852
19 Ga0070681_10000904 3300005458 Bacteria 25100
20 Ga0070681_10006554 3300005458 Bacteria 11333
21 Ga0070681_10014618 3300005458 Bacteria 7811
22 Ga0070681_10097974 3300005458 Bacteria 2878
23 Ga0070699_100142640 3300005518 Bacteria 2116
24 Ga0070679_100169881 3300005530 Bacteria 2153
25 Ga0070686_100083329 3300005544 Bacteria 2122
26 Ga0070695_100021577 3300005545 Bacteria 3944
27 Ga0070696_100003623 3300005546 Bacteria 10288
28 Ga0070693_100094295 3300005547 Bacteria 1811
29 Ga0070665_100002916 3300005548 Bacteria 18473
30 Ga0070665_100050511 3300005548 Bacteria 4173
31 Ga0070665_100061103 3300005548 Bacteria 3777
32 Ga0068855_100008768 3300005563 Bacteria 12224
33 Ga0068855_100054020 3300005563 Bacteria 4724
34 Ga0068855_100123442 3300005563 Bacteria 2962
35 Ga0068856_100027511 3300005614 Bacteria 5547
36 Ga0068859_100042084 3300005617 Bacteria 4588
37 Ga0068859_100115354 3300005617 Bacteria 2751
38 Ga0068861_100013791 3300005719 Bacteria 5661
39 Ga0068863_100003478 3300005841 Bacteria 15537
40 Ga0068863_100020173 3300005841 Bacteria 6376
41 Ga0068863_100109527 3300005841 Bacteria 2629
42 Ga0068858_100006661 3300005842 Bacteria 11237
43 Ga0068858_100100496 3300005842 Bacteria 2697
44 Ga0081455_10000127 3300005937 Bacteria 88574
45 Ga0081539_10000016 3300005985 Bacteria 381648
46 Ga0070716_100011311 3300006173 Bacteria 4494
47 Ga0070712_100000490 3300006175 Bacteria 22572
48 Ga0070712_100107760 3300006175 Bacteria 2073
49 Ga0097621_100017774 3300006237 Bacteria 5411
50 Ga0075428_100007903 3300006844 Bacteria 11792
51 Ga0075433_10001231 3300006852 Bacteria 18666
52 Ga0075434_100005042 3300006871 Bacteria 11994
53 Ga0075436_100011699 3300006914 Bacteria 6024
54 Ga0097620_100042084 3300006931 Bacteria 4588
55 Ga0097620_100115351 3300006931 Bacteria 2751
56 Ga0099794_10061204 3300007265 Bacteria 1829
57 Ga0099795_10034616 3300007788 Bacteria 1761
58 Ga0105250_10015456 3300009092 Bacteria 3125
59 Ga0105240_10004778 3300009093 Bacteria 20433
60 Ga0105240_10014329 3300009093 Bacteria 10829
61 Ga0105240_10019277 3300009093 Bacteria 9118
62 Ga0105240_10022423 3300009093 Bacteria 8371
63 Ga0105240_10022583 3300009093 Bacteria 8337
64 Ga0105240_10050372 3300009093 Bacteria 5251
65 Ga0105240_10058672 3300009093 Bacteria 4805
66 Ga0105240_10078088 3300009093 Bacteria 4077
67 Ga0105240_10095911 3300009093 Bacteria 3615
68 Ga0105240_10102565 3300009093 Bacteria 3476
69 Ga0105240_10322203 3300009093 Bacteria 1761
70 Ga0111539_10004441 3300009094 Bacteria 18326
71 Ga0111539_10048637 3300009094 Bacteria 5062
72 Ga0105247_10000295 3300009101 Bacteria 44958
73 Ga0105242_10005065 3300009176 Bacteria 10177
74 Ga0105248_10043926 3300009177 Bacteria 5012
75 Ga0105248_10120931 3300009177 Bacteria 2954
76 Ga0105237_10006398 3300009545 Bacteria 13072
77 Ga0105237_10130923 3300009545 Bacteria 2503
78 Ga0105237_10136666 3300009545 Bacteria 2445
79 Ga0105237_10172848 3300009545 Bacteria 2161
80 Ga0105237_10198341 3300009545 Bacteria 2006
81 Ga0105238_10108337 3300009551 Bacteria 2759
82 Ga0105238_10336992 3300009551 Unclassified 1496
83 Ga0099796_10000890 3300010159 Bacteria 5538
84 Ga0105239_10008142 3300010375 Bacteria 11963
85 Ga0105239_10209286 3300010375 Unclassified 2186
86 Ga0157370_10006510 3300013104 Bacteria 12862
87 Ga0157369_10020627 3300013105 Bacteria 7369
88 Ga0157369_10069865 3300013105 Bacteria 3773
89 Ga0157369_10203046 3300013105 Bacteria 2080
90 Ga0163162_10126836 3300013306 Bacteria 2659
91 Ga0157372_10039309 3300013307 Bacteria 5221
92 Ga0157372_10051928 3300013307 Bacteria 4564
93 Ga0157375_10107458 3300013308 Bacteria 2884
94 Ga0163163_10029144 3300014325 Bacteria 5309
95 Ga0163163_10065129 3300014325 Bacteria 3616
96 Ga0163163_10099018 3300014325 Bacteria 2937
97 Ga0157380_10003065 3300014326 Bacteria 11386
98 Ga0157379_10016147 3300014968 Bacteria 6567
99 Ga0157379_10021791 3300014968 Bacteria 5676
100 Ga0157379_10031794 3300014968 Bacteria 4702
101 Ga0157379_10123367 3300014968 Bacteria 2331
102 Ga0157376_10184646 3300014969 Bacteria 1908
103 Ga0207710_10000497 3300025900 Bacteria 24606
104 Ga0207680_10112008 3300025903 Bacteria 1771
105 Ga0207699_10001862 3300025906 Bacteria 9937
106 Ga0207699_10015339 3300025906 Bacteria 3977
107 Ga0207699_10039395 3300025906 Bacteria 2715
108 Ga0207707_10021857 3300025912 Bacteria 5592
109 Ga0207707_10034567 3300025912 Bacteria 4422
110 Ga0207695_10007935 3300025913 Bacteria 13395
111 Ga0207695_10011584 3300025913 Bacteria 10665
112 Ga0207695_10028463 3300025913 Bacteria 6196
113 Ga0207695_10047587 3300025913 Bacteria 4536
114 Ga0207695_10055273 3300025913 Bacteria 4138
115 Ga0207695_10066598 3300025913 Bacteria 3698
116 Ga0207695_10177488 3300025913 Bacteria 2052
117 Ga0207671_10080390 3300025914 Bacteria 2443
118 Ga0207671_10083097 3300025914 Bacteria 2404
119 Ga0207693_10000007 3300025915 Bacteria 173735
120 Ga0207660_10054744 3300025917 Bacteria 2848
121 Ga0207660_10137075 3300025917 Bacteria 1868
122 Ga0207660_10137321 3300025917 Bacteria 1867
123 Ga0207657_10129732 3300025919 Bacteria 2067
124 Ga0207652_10028996 3300025921 Bacteria 4622
125 Ga0207652_10089843 3300025921 Bacteria 2698
126 Ga0207652_10097554 3300025921 Bacteria 2591
127 Ga0207681_10066360 3300025923 Bacteria 2498
128 Ga0207694_10157336 3300025924 Bacteria 1834
129 Ga0207694_10208572 3300025924 Unclassified 1591
130 Ga0207687_10071200 3300025927 Bacteria 2484
131 Ga0207700_10015599 3300025928 Bacteria 5017
132 Ga0207700_10061598 3300025928 Bacteria 2846
133 Ga0207700_10185809 3300025928 Bacteria 1743
134 Ga0207644_10076084 3300025931 Bacteria 2468
135 Ga0207644_10143765 3300025931 Bacteria 1839
136 Ga0207704_10033607 3300025938 Bacteria 2918
137 Ga0207665_10001462 3300025939 Bacteria 15902
138 Ga0207665_10003051 3300025939 Bacteria 11230
139 Ga0207711_10070785 3300025941 Bacteria 3025
140 Ga0207661_10183200 3300025944 Bacteria 1831
141 Ga0207667_10007376 3300025949 Bacteria 13232
142 Ga0207667_10010532 3300025949 Bacteria 10805
143 Ga0207658_10003370 3300025986 Bacteria 11309
144 Ga0207703_10000518 3300026035 Bacteria 39574
145 Ga0207703_10004333 3300026035 Bacteria 11665
146 Ga0207703_10146036 3300026035 Bacteria 2057
147 Ga0207678_10156991 3300026067 Bacteria 1943
148 Ga0207641_10001792 3300026088 Bacteria 20694
149 Ga0207641_10039721 3300026088 Bacteria 3936
150 Ga0207675_100008209 3300026118 Bacteria 9838
151 Ga0207683_10013063 3300026121 Bacteria 7087
152 Ga0207428_10044530 3300027907 Bacteria 3581
153 Ga0265354_1000425 3300028016 Bacteria 7387
154 Ga0265356_1000365 3300028017 Bacteria 8196
155 Ga0268266_10001576 3300028379 Bacteria 26652
156 Ga0268266_10010029 3300028379 Bacteria 8312
157 Ga0268265_10136546 3300028380 Bacteria 2047
158 Ga0268264_10000034 3300028381 Bacteria 401894
159 Ga0268264_10003439 3300028381 Bacteria 13658
160 Ga0307515_10019845 3300028794 Bacteria 12051
161 Ga0265338_10039738 3300028800 Bacteria 4432
162 Ga0265770_1000093 3300030878 Bacteria 10219
163 Ga0265765_1001646 3300030879 Bacteria 2078
164 Ga0265760_10000085 3300031090 Bacteria 23936
165 Ga0265340_10034887 3300031247 Bacteria 2500
166 Ga0265316_10048924 3300031344 Bacteria 3333
167 Ga0307509_10000021 3300031507 Bacteria 250589
168 Ga0307509_10232492 3300031507 Bacteria 1645
169 Ga0307516_10005969 3300031730 Bacteria 14398
170 Ga0307405_10016005 3300031731 Bacteria 4078
171 Ga0307410_10069976 3300031852 Bacteria 2429
172 Ga0307406_10052241 3300031901 Bacteria 2599
173 Ga0307412_10087170 3300031911 Bacteria 2174
174 Ga0307409_100056166 3300031995 Bacteria 3043
175 Ga0307416_100001209 3300032002 Bacteria 13909
176 Ga0307416_100131639 3300032002 Bacteria 2253
177 Ga0307510_10000005 3300033180 Bacteria 633068
178 Ga0307510_10001400 3300033180 Bacteria 26475
179 Ga0373936_0002132 3300035113 Bacteria 7360
180 Ga0373955_0014481 3300035172 Bacteria 3838
181 Ga0373933_0016863 3300035724 Bacteria 4093
182 Ga0373947_0018652 3300035725 Bacteria 3995
183 Ga0373937_0037512 3300036401 Bacteria 4417
184 Ga0395900_0145249 3300037418 Unclassified 2426
185 Ga0395898_0008541 3300037466 Bacteria 10820
186 Ga0400487_17400 3300039110 Bacteria 4727
187 Ga0436365_1466533 3300039437 Bacteria 13925
188 Ga0436360_0440587 3300039438 Bacteria 2091
189 Ga0436360_0517698 3300039438 Bacteria 2983
190 Ga0436361_0848382 3300039447 Bacteria 6748
191 Ga0436363_0686286 3300039450 Bacteria 2748
192 Ga0436363_1077320 3300039450 Bacteria 2026
193 Ga0436363_1663288 3300039450 Bacteria 2524
194 Ga0436362_0078389 3300039453 Bacteria 1775
195 Ga0450895_001638 3300042132 Bacteria 1578
196 Ga0450896_000489 3300042133 Bacteria 4113
197 Ga0450907_010983 3300042146 Bacteria 1505
198 Ga0439446_0010587 3300042156 Bacteria 2486
199 Ga0450908_003816 3300042184 Bacteria 2917
200 Ga0439434_0004973 3300042435 Bacteria 3887
201 Ga0439435_0002114 3300042436 Bacteria 3863
202 Ga0439444_0000436 3300042437 Bacteria 4648
203 Ga0451577_0012893 3300042876 Bacteria 7846
204 Ga0466969_0001998 3300044656 Bacteria 10895
205 Ga0466966_0094066 3300044684 Bacteria 1858
206 Ga0466961_0081913 3300044693 Bacteria 2042
207 Ga0466963_0064398 3300044694 Bacteria 2456
208 Ga0466964_0010618 3300044706 Bacteria 3474
209 Ga0466970_0005809 3300044765 Bacteria 6137
210 Ga0466960_0092129 3300044901 Bacteria 1547
211 Ga0466959_0015956 3300045049 Bacteria 5481
212 Ga0466959_0015961 3300045049 Bacteria 5480
213 Ga0466959_0095516 3300045049 Bacteria 2132
214 Ga0466958_0032256 3300045836 Bacteria 3116
215 Ga0495580_0014852 3300046472 Bacteria 5901
216 Ga0495580_0072370 3300046472 Bacteria 2407
217 Ga0495587_0035757 3300046536 Bacteria 2991
218 Ga0495671_0044111 3300046692 Bacteria 2236
219 Ga0496100_0005412 3300048903 Bacteria 6873
220 Ga0496100_0138477 3300048903 Bacteria 1722
221 Ga0496102_0007610 3300048905 Bacteria 9254
222 Ga0496102_0174314 3300048905 Bacteria 2025
223 Ga0496104_0005588 3300048907 Bacteria 11007
224 Ga0496112_0218330 3300048915 Bacteria 1863
225 Ga0496114_0011448 3300048917 Bacteria 7087
226 Ga0496115_0040910 3300048918 Bacteria 3686
227 Ga0496115_0118732 3300048918 Bacteria 2175
228 Ga0496116_0006071 3300048919 Bacteria 11053
229 Ga0496117_0000012 3300048920 Bacteria 608530
230 Ga0496118_0000051 3300048921 Bacteria 241198
231 Ga0496120_0000191 3300048923 Bacteria 105146
232 Ga0496120_0001464 3300048923 Bacteria 28168
233 Ga0496121_0008161 3300048924 Bacteria 12437
234 Ga0496121_0067514 3300048924 Bacteria 2898
235 Ga0496125_0001779 3300048928 Bacteria 29785
236 Ga0496125_0003243 3300048928 Bacteria 20050
237 Ga0496125_0129060 3300048928 Bacteria 1784
238 Ga0496126_0004328 3300048929 Bacteria 17038
239 Ga0501032_0007943 3300049569 Bacteria 7729
240 Ga0501036_0013836 3300049572 Bacteria 6710
241 Ga0501039_0006731 3300049575 Bacteria 8747
242 Ga0501039_0042304 3300049575 Bacteria 3520
243 Ga0501039_0106683 3300049575 Bacteria 2188
244 Ga0501040_0032885 3300049576 Bacteria 3510
245 Ga0501042_0001379 3300049578 Bacteria 14260
246 Ga0501042_0016423 3300049578 Bacteria 5080
247 Ga0501046_0037587 3300049580 Bacteria 3890
248 Ga0501048_0004714 3300049582 Bacteria 10382
249 Ga0501067_0004732 3300049583 Bacteria 7536
250 Ga0501068_0048254 3300049584 Bacteria 2570
251 Ga0501071_0001019 3300049587 Bacteria 15431
252 Ga0501071_0133441 3300049587 Bacteria 1846
253 Ga0501072_0018290 3300049588 Bacteria 5393
254 Ga0501072_0020846 3300049588 Bacteria 5081
255 Ga0501074_0030588 3300049590 Bacteria 3902
256 Ga0501075_0014639 3300049591 Bacteria 5621
257 Ga0501076_0010585 3300049592 Bacteria 6848
258 Ga0501076_0049226 3300049592 Bacteria 3332
259 Ga0501077_0004272 3300049593 Bacteria 8639
260 Ga0501079_0027680 3300049741 Bacteria 4348
261 Ga0501079_0155469 3300049741 Bacteria 1783
262 Ga0501080_0048703 3300049742 Bacteria 3943
263 Ga0501080_0078328 3300049742 Bacteria 3074
264 Ga0501081_0018688 3300049743 Bacteria 4606
265 Ga0501081_0045484 3300049743 Bacteria 3014
266 Ga0501035_0035917 3300049822 Bacteria 4495
267 Ga0501044_0202789 3300049823 Bacteria 1941
268 nmdc:mga08y16_84028_c1 3300050511 Bacteria 3318
269 nmdc:mga08y16_85531_c1 3300050511 Bacteria 3287
270 nmdc:mga0n895_30856_c1 3300050512 Bacteria 5127
271 nmdc:mga08x19_26458_c1 3300050514 Bacteria 3620
272 nmdc:mga0a205_188_c1 3300050515 Bacteria 30684
273 Ga0500646_0022224 3300053090 Bacteria 1696
274 Ga0500583_0003753 3300053092 Bacteria 4840
275 Ga0500658_0023839 3300053134 Bacteria 2340
276 Ga0500616_0000018 3300053153 Bacteria 610976
277 Ga0500616_0052424 3300053153 Bacteria 2145
278 Ga0500622_0002638 3300053156 Bacteria 12741
279 Ga0500637_0056541 3300053178 Bacteria 2242
280 Ga0500637_0081625 3300053178 Bacteria 1867
281 Ga0500611_022996 3300053727 Bacteria 1209
282 Ga0501084_0043184 3300054114 Bacteria 3771
283 Ga0501082_0039079 3300060353 Bacteria 4093
284 Ga0466962_0001377 3300061719 Bacteria 11263
285 Ga0530510_0019793 3300061734 Bacteria 4783

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053727 Ga0500611_022996 Ga0500611_022996_36_1196 367
2 3300053090 Ga0500646_0022224 Ga0500646_0022224_42_1286 391
3 3300053156 Ga0500622_0002638 Ga0500622_0002638_1605_2849 391
4 3300005546 Ga0070696_100003623 Ga0070696_1000036237 403
5 3300053153 Ga0500616_0000018 Ga0500616_0000018_1662_3083 407
6 3300005841 Ga0068863_100003478 Ga0068863_10000347812 411
7 3300005985 Ga0081539_10000016 Ga0081539_10000016264 413
8 3300053134 Ga0500658_0023839 Ga0500658_0023839_346_1761 414
9 3300006175 Ga0070712_100107760 Ga0070712_1001077602 417
10 3300025906 Ga0207699_10015339 Ga0207699_100153392 417
11 3300025939 Ga0207665_10003051 Ga0207665_100030517 417
12 3300048918 Ga0496115_0118732 Ga0496115_0118732_716_2131 418
13 3300009093 Ga0105240_10019277 Ga0105240_100192775 419
14 3300014325 Ga0163163_10065129 Ga0163163_100651292 419
15 3300048929 Ga0496126_0004328 Ga0496126_0004328_5238_6548 419
16 3300053178 Ga0500637_0056541 Ga0500637_0056541_345_1655 419
17 3300048905 Ga0496102_0174314 Ga0496102_0174314_230_1684 421
18 3300007265 Ga0099794_10061204 Ga0099794_100612042 423
19 3300007788 Ga0099795_10034616 Ga0099795_100346161 423
20 3300010159 Ga0099796_10000890 Ga0099796_100008902 423
21 3300006914 Ga0075436_100011699 Ga0075436_1000116995 425
22 3300050514 nmdc:mga08x19_26458_c1 nmdc:mga08x19_26458_c1_912_2357 425
23 3300028800 Ga0265338_10039738 Ga0265338_100397385 426
24 3300031247 Ga0265340_10034887 Ga0265340_100348873 426
25 3300031507 Ga0307509_10232492 Ga0307509_102324922 426
26 3300035725 Ga0373947_0018652 Ga0373947_0018652_2082_3560 426
27 3300039450 Ga0436363_1077320 Ga0436363_1077320_283_1740 426
28 3300046472 Ga0495580_0072370 Ga0495580_0072370_573_2051 426
29 3300028794 Ga0307515_10019845 Ga0307515_100198453 427
30 3300005335 Ga0070666_10004506 Ga0070666_100045064 428
31 3300005355 Ga0070671_100002494 Ga0070671_1000024949 428
32 3300005367 Ga0070667_100011574 Ga0070667_1000115746 428
33 3300005434 Ga0070709_10049739 Ga0070709_100497394 428
34 3300005436 Ga0070713_100003136 Ga0070713_1000031362 428
35 3300005456 Ga0070678_100057413 Ga0070678_1000574133 428
36 3300005547 Ga0070693_100094295 Ga0070693_1000942952 428
37 3300005548 Ga0070665_100061103 Ga0070665_1000611034 428
38 3300005614 Ga0068856_100027511 Ga0068856_1000275114 428
39 3300005841 Ga0068863_100109527 Ga0068863_1001095272 428
40 3300005842 Ga0068858_100100496 Ga0068858_1001004963 428
41 3300006173 Ga0070716_100011311 Ga0070716_1000113114 428
42 3300006175 Ga0070712_100000490 Ga0070712_1000004903 428
43 3300006237 Ga0097621_100017774 Ga0097621_1000177745 428
44 3300009176 Ga0105242_10005065 Ga0105242_100050652 428
45 3300009177 Ga0105248_10120931 Ga0105248_101209313 428
46 3300009545 Ga0105237_10006398 Ga0105237_100063988 428
47 3300010375 Ga0105239_10008142 Ga0105239_100081423 428
48 3300013308 Ga0157375_10107458 Ga0157375_101074583 428
49 3300014968 Ga0157379_10031794 Ga0157379_100317942 428
50 3300025906 Ga0207699_10039395 Ga0207699_100393953 428
51 3300025913 Ga0207695_10055273 Ga0207695_100552734 428
52 3300025915 Ga0207693_10000007 Ga0207693_1000000746 428
53 3300025927 Ga0207687_10071200 Ga0207687_100712002 428
54 3300025928 Ga0207700_10015599 Ga0207700_100155992 428
55 3300025931 Ga0207644_10076084 Ga0207644_100760842 428
56 3300025938 Ga0207704_10033607 Ga0207704_100336071 428
57 3300025939 Ga0207665_10001462 Ga0207665_100014626 428
58 3300025941 Ga0207711_10070785 Ga0207711_100707853 428
59 3300026035 Ga0207703_10146036 Ga0207703_101460362 428
60 3300026121 Ga0207683_10013063 Ga0207683_100130634 428
61 3300035172 Ga0373955_0014481 Ga0373955_0014481_534_2036 428
62 3300035724 Ga0373933_0016863 Ga0373933_0016863_2519_4021 428
63 3300036401 Ga0373937_0037512 Ga0373937_0037512_1495_2997 428
64 3300046536 Ga0495587_0035757 Ga0495587_0035757_26_1528 428
65 3300046692 Ga0495671_0044111 Ga0495671_0044111_557_1969 428
66 3300048903 Ga0496100_0005412 Ga0496100_0005412_1110_2606 428
67 3300048905 Ga0496102_0007610 Ga0496102_0007610_5955_7451 428
68 3300048915 Ga0496112_0218330 Ga0496112_0218330_62_1558 428
69 3300048917 Ga0496114_0011448 Ga0496114_0011448_56_1552 428
70 3300039447 Ga0436361_0848382 Ga0436361_0848382_1784_3193 429
71 3300049575 Ga0501039_0042304 Ga0501039_0042304_1185_2582 429
72 3300049576 Ga0501040_0032885 Ga0501040_0032885_1544_2941 429
73 3300049578 Ga0501042_0016423 Ga0501042_0016423_2053_3450 429
74 3300049580 Ga0501046_0037587 Ga0501046_0037587_1833_3230 429
75 3300049584 Ga0501068_0048254 Ga0501068_0048254_312_1709 429
76 3300049591 Ga0501075_0014639 Ga0501075_0014639_1370_2767 429
77 3300049592 Ga0501076_0010585 Ga0501076_0010585_2581_3978 429
78 3300049741 Ga0501079_0027680 Ga0501079_0027680_899_2296 429
79 3300049742 Ga0501080_0048703 Ga0501080_0048703_1818_3215 429
80 3300049743 Ga0501081_0018688 Ga0501081_0018688_1373_2770 429
81 3300053092 Ga0500583_0003753 Ga0500583_0003753_2902_4356 429
82 3300054114 Ga0501084_0043184 Ga0501084_0043184_658_2055 429
83 3300060353 Ga0501082_0039079 Ga0501082_0039079_765_2162 429
84 3300061734 Ga0530510_0019793 Ga0530510_0019793_1999_3396 429
85 3300005355 Ga0070671_100010633 Ga0070671_1000106331 430
86 3300005367 Ga0070667_100006632 Ga0070667_1000066325 430
87 3300005544 Ga0070686_100083329 Ga0070686_1000833291 430
88 3300005617 Ga0068859_100042084 Ga0068859_1000420845 430
89 3300005841 Ga0068863_100020173 Ga0068863_1000201737 430
90 3300005842 Ga0068858_100006661 Ga0068858_1000066617 430
91 3300006931 Ga0097620_100042084 Ga0097620_1000420845 430
92 3300009092 Ga0105250_10015456 Ga0105250_100154564 430
93 3300009101 Ga0105247_10000295 Ga0105247_1000029535 430
94 3300009177 Ga0105248_10043926 Ga0105248_100439265 430
95 3300014325 Ga0163163_10029144 Ga0163163_100291444 430
96 3300014968 Ga0157379_10123367 Ga0157379_101233673 430
97 3300025900 Ga0207710_10000497 Ga0207710_1000049724 430
98 3300025931 Ga0207644_10143765 Ga0207644_101437651 430
99 3300025986 Ga0207658_10003370 Ga0207658_100033707 430
100 3300026035 Ga0207703_10004333 Ga0207703_100043335 430
101 3300026088 Ga0207641_10039721 Ga0207641_100397216 430
102 3300028381 Ga0268264_10003439 Ga0268264_1000343914 430
103 3300031344 Ga0265316_10048924 Ga0265316_100489242 430
104 3300039110 Ga0400487_17400 Ga0400487_17400_1343_2770 430
105 3300039437 Ga0436365_1466533 Ga0436365_1466533_6568_7923 430
106 3300039450 Ga0436363_1663288 Ga0436363_1663288_480_1835 430
107 3300048903 Ga0496100_0138477 Ga0496100_0138477_152_1546 430
108 3300048907 Ga0496104_0005588 Ga0496104_0005588_5181_6575 430
109 3300048918 Ga0496115_0040910 Ga0496115_0040910_478_1872 430
110 3300048924 Ga0496121_0008161 Ga0496121_0008161_176_1579 430
111 3300048928 Ga0496125_0129060 Ga0496125_0129060_88_1491 430
112 3300005458 Ga0070681_10014618 Ga0070681_100146181 431
113 3300005937 Ga0081455_10000127 Ga0081455_1000012758 431
114 3300025924 Ga0207694_10208572 Ga0207694_102085721 431
115 3300028380 Ga0268265_10136546 Ga0268265_101365462 431
116 3300031730 Ga0307516_10005969 Ga0307516_100059696 431
117 3300039453 Ga0436362_0078389 Ga0436362_0078389_30_1439 431
118 3300044693 Ga0466961_0081913 Ga0466961_0081913_38_1420 431
119 3300044706 Ga0466964_0010618 Ga0466964_0010618_1245_2627 431
120 3300044765 Ga0466970_0005809 Ga0466970_0005809_3757_5139 431
121 3300044901 Ga0466960_0092129 Ga0466960_0092129_10_1434 431
122 3300045049 Ga0466959_0095516 Ga0466959_0095516_252_1634 431
123 3300045836 Ga0466958_0032256 Ga0466958_0032256_415_1797 431
124 3300053153 Ga0500616_0052424 Ga0500616_0052424_540_1976 431
125 3300061719 Ga0466962_0001377 Ga0466962_0001377_6519_7901 431
126 3300005329 Ga0070683_100279670 Ga0070683_1002796701 432
127 3300005335 Ga0070666_10014409 Ga0070666_100144096 432
128 3300005336 Ga0070680_100020167 Ga0070680_1000201672 432
129 3300005436 Ga0070713_100192638 Ga0070713_1001926382 432
130 3300005530 Ga0070679_100169881 Ga0070679_1001698812 432
131 3300005548 Ga0070665_100002916 Ga0070665_1000029167 432
132 3300005548 Ga0070665_100050511 Ga0070665_1000505116 432
133 3300005563 Ga0068855_100008768 Ga0068855_1000087686 432
134 3300006852 Ga0075433_10001231 Ga0075433_100012317 432
135 3300006871 Ga0075434_100005042 Ga0075434_1000050428 432
136 3300009093 Ga0105240_10004778 Ga0105240_1000477810 432
137 3300009093 Ga0105240_10022423 Ga0105240_100224236 432
138 3300009093 Ga0105240_10050372 Ga0105240_100503722 432
139 3300009093 Ga0105240_10058672 Ga0105240_100586725 432
140 3300009093 Ga0105240_10078088 Ga0105240_100780884 432
141 3300009093 Ga0105240_10095911 Ga0105240_100959111 432
142 3300009545 Ga0105237_10130923 Ga0105237_101309233 432
143 3300009545 Ga0105237_10198341 Ga0105237_101983411 432
144 3300010375 Ga0105239_10209286 Ga0105239_102092862 432
145 3300013306 Ga0163162_10126836 Ga0163162_101268363 432
146 3300013307 Ga0157372_10039309 Ga0157372_100393093 432
147 3300014325 Ga0163163_10099018 Ga0163163_100990182 432
148 3300014326 Ga0157380_10003065 Ga0157380_100030658 432
149 3300014968 Ga0157379_10016147 Ga0157379_100161475 432
150 3300014968 Ga0157379_10021791 Ga0157379_100217915 432
151 3300014969 Ga0157376_10184646 Ga0157376_101846462 432
152 3300025903 Ga0207680_10112008 Ga0207680_101120082 432
153 3300025913 Ga0207695_10007935 Ga0207695_100079357 432
154 3300025913 Ga0207695_10028463 Ga0207695_100284632 432
155 3300025913 Ga0207695_10047587 Ga0207695_100475873 432
156 3300025913 Ga0207695_10066598 Ga0207695_100665982 432
157 3300025914 Ga0207671_10083097 Ga0207671_100830972 432
158 3300025917 Ga0207660_10054744 Ga0207660_100547442 432
159 3300025921 Ga0207652_10097554 Ga0207652_100975543 432
160 3300025924 Ga0207694_10157336 Ga0207694_101573362 432
161 3300025928 Ga0207700_10185809 Ga0207700_101858092 432
162 3300025944 Ga0207661_10183200 Ga0207661_101832002 432
163 3300025949 Ga0207667_10010532 Ga0207667_100105329 432
164 3300026035 Ga0207703_10000518 Ga0207703_1000051817 432
165 3300026067 Ga0207678_10156991 Ga0207678_101569911 432
166 3300026088 Ga0207641_10001792 Ga0207641_1000179213 432
167 3300028016 Ga0265354_1000425 Ga0265354_10004255 432
168 3300028017 Ga0265356_1000365 Ga0265356_10003657 432
169 3300028379 Ga0268266_10001576 Ga0268266_1000157619 432
170 3300028379 Ga0268266_10010029 Ga0268266_100100295 432
171 3300028381 Ga0268264_10000034 Ga0268264_10000034268 432
172 3300030878 Ga0265770_1000093 Ga0265770_10000934 432
173 3300030879 Ga0265765_1001646 Ga0265765_10016462 432
174 3300031090 Ga0265760_10000085 Ga0265760_1000008513 432
175 3300031507 Ga0307509_10000021 Ga0307509_100000219 432
176 3300033180 Ga0307510_10000005 Ga0307510_10000005122 432
177 3300033180 Ga0307510_10001400 Ga0307510_100014002 432
178 3300035113 Ga0373936_0002132 Ga0373936_0002132_4061_5425 432
179 3300042132 Ga0450895_001638 Ga0450895_001638_96_1415 432
180 3300042146 Ga0450907_010983 Ga0450907_010983_81_1400 432
181 3300042184 Ga0450908_003816 Ga0450908_003816_881_2200 432
182 3300044656 Ga0466969_0001998 Ga0466969_0001998_7551_8912 432
183 3300044684 Ga0466966_0094066 Ga0466966_0094066_225_1586 432
184 3300045049 Ga0466959_0015956 Ga0466959_0015956_3237_4598 432
185 3300045049 Ga0466959_0015961 Ga0466959_0015961_1414_2775 432
186 3300048919 Ga0496116_0006071 Ga0496116_0006071_9093_10571 432
187 3300048920 Ga0496117_0000012 Ga0496117_0000012_492726_494204 432
188 3300048921 Ga0496118_0000051 Ga0496118_0000051_123842_125320 432
189 3300048923 Ga0496120_0000191 Ga0496120_0000191_44728_46137 432
190 3300048923 Ga0496120_0001464 Ga0496120_0001464_786_2264 432
191 3300048924 Ga0496121_0067514 Ga0496121_0067514_561_1970 432
192 3300048928 Ga0496125_0001779 Ga0496125_0001779_25183_26661 432
193 3300048928 Ga0496125_0003243 Ga0496125_0003243_2307_3716 432
194 3300053178 Ga0500637_0081625 Ga0500637_0081625_237_1631 432
195 3300005336 Ga0070680_100059486 Ga0070680_1000594864 433
196 3300005336 Ga0070680_100067283 Ga0070680_1000672833 433
197 3300005339 Ga0070660_100076168 Ga0070660_1000761683 433
198 3300005434 Ga0070709_10003890 Ga0070709_100038904 433
199 3300005458 Ga0070681_10000904 Ga0070681_100009044 433
200 3300005458 Ga0070681_10097974 Ga0070681_100979743 433
201 3300005518 Ga0070699_100142640 Ga0070699_1001426402 433
202 3300005563 Ga0068855_100054020 Ga0068855_1000540204 433
203 3300005563 Ga0068855_100123442 Ga0068855_1001234423 433
204 3300005719 Ga0068861_100013791 Ga0068861_1000137915 433
205 3300009093 Ga0105240_10014329 Ga0105240_100143291 433
206 3300009093 Ga0105240_10022583 Ga0105240_1002258310 433
207 3300009093 Ga0105240_10102565 Ga0105240_101025652 433
208 3300009093 Ga0105240_10322203 Ga0105240_103222032 433
209 3300009545 Ga0105237_10136666 Ga0105237_101366663 433
210 3300009545 Ga0105237_10172848 Ga0105237_101728482 433
211 3300009551 Ga0105238_10108337 Ga0105238_101083374 433
212 3300009551 Ga0105238_10336992 Ga0105238_103369921 433
213 3300013104 Ga0157370_10006510 Ga0157370_100065103 433
214 3300013105 Ga0157369_10020627 Ga0157369_100206276 433
215 3300013105 Ga0157369_10069865 Ga0157369_100698654 433
216 3300013105 Ga0157369_10203046 Ga0157369_102030462 433
217 3300013307 Ga0157372_10051928 Ga0157372_100519282 433
218 3300025912 Ga0207707_10034567 Ga0207707_100345673 433
219 3300025913 Ga0207695_10011584 Ga0207695_100115842 433
220 3300025913 Ga0207695_10177488 Ga0207695_101774882 433
221 3300025914 Ga0207671_10080390 Ga0207671_100803902 433
222 3300025917 Ga0207660_10137075 Ga0207660_101370752 433
223 3300025917 Ga0207660_10137321 Ga0207660_101373211 433
224 3300025919 Ga0207657_10129732 Ga0207657_101297322 433
225 3300025921 Ga0207652_10028996 Ga0207652_100289962 433
226 3300025921 Ga0207652_10089843 Ga0207652_100898433 433
227 3300025928 Ga0207700_10061598 Ga0207700_100615983 433
228 3300025949 Ga0207667_10007376 Ga0207667_100073763 433
229 3300026118 Ga0207675_100008209 Ga0207675_1000082097 433
230 3300037418 Ga0395900_0145249 Ga0395900_0145249_1008_2402 433
231 3300039438 Ga0436360_0440587 Ga0436360_0440587_411_1829 433
232 3300039438 Ga0436360_0517698 Ga0436360_0517698_1202_2695 433
233 3300039450 Ga0436363_0686286 Ga0436363_0686286_1036_2448 433
234 3300046472 Ga0495580_0014852 Ga0495580_0014852_2866_4368 433
235 3300037466 Ga0395898_0008541 Ga0395898_0008541_1611_2996 434
236 3300044694 Ga0466963_0064398 Ga0466963_0064398_116_1510 434
237 3300049588 Ga0501072_0020846 Ga0501072_0020846_1521_2948 434
238 3300042876 Ga0451577_0012893 Ga0451577_0012893_233_1633 436
239 3300005458 Ga0070681_10006554 Ga0070681_100065545 438
240 3300005545 Ga0070695_100021577 Ga0070695_1000215772 438
241 3300025906 Ga0207699_10001862 Ga0207699_100018626 438
242 3300025912 Ga0207707_10021857 Ga0207707_100218571 438
243 3300049583 Ga0501067_0004732 Ga0501067_0004732_4773_6110 438
244 3300049593 Ga0501077_0004272 Ga0501077_0004272_7279_8616 438
245 3300049742 Ga0501080_0078328 Ga0501080_0078328_601_1938 438
246 3300005290 Ga0065712_10103653 Ga0065712_101036533 439
247 3300005354 Ga0070675_100004438 Ga0070675_1000044385 439
248 3300005617 Ga0068859_100115354 Ga0068859_1001153543 439
249 3300006844 Ga0075428_100007903 Ga0075428_1000079038 439
250 3300006931 Ga0097620_100115351 Ga0097620_1001153513 439
251 3300009094 Ga0111539_10004441 Ga0111539_100044418 439
252 3300009094 Ga0111539_10048637 Ga0111539_100486373 439
253 3300025923 Ga0207681_10066360 Ga0207681_100663603 439
254 3300027907 Ga0207428_10044530 Ga0207428_100445303 439
255 3300031731 Ga0307405_10016005 Ga0307405_100160053 439
256 3300031852 Ga0307410_10069976 Ga0307410_100699762 439
257 3300031901 Ga0307406_10052241 Ga0307406_100522412 439
258 3300031911 Ga0307412_10087170 Ga0307412_100871701 439
259 3300031995 Ga0307409_100056166 Ga0307409_1000561663 439
260 3300032002 Ga0307416_100001209 Ga0307416_1000012098 439
261 3300032002 Ga0307416_100131639 Ga0307416_1001316393 439
262 3300042133 Ga0450896_000489 Ga0450896_000489_705_2132 439
263 3300042156 Ga0439446_0010587 Ga0439446_0010587_905_2251 439
264 3300042435 Ga0439434_0004973 Ga0439434_0004973_940_2367 439
265 3300042436 Ga0439435_0002114 Ga0439435_0002114_1347_2774 439
266 3300042437 Ga0439444_0000436 Ga0439444_0000436_515_1942 439
267 3300049569 Ga0501032_0007943 Ga0501032_0007943_3505_4932 439
268 3300049572 Ga0501036_0013836 Ga0501036_0013836_312_1739 439
269 3300049575 Ga0501039_0006731 Ga0501039_0006731_165_1592 439
270 3300049575 Ga0501039_0106683 Ga0501039_0106683_463_1803 439
271 3300049578 Ga0501042_0001379 Ga0501042_0001379_159_1586 439
272 3300049582 Ga0501048_0004714 Ga0501048_0004714_6201_7628 439
273 3300049587 Ga0501071_0001019 Ga0501071_0001019_876_2303 439
274 3300049587 Ga0501071_0133441 Ga0501071_0133441_257_1684 439
275 3300049588 Ga0501072_0018290 Ga0501072_0018290_10_1437 439
276 3300049590 Ga0501074_0030588 Ga0501074_0030588_2269_3696 439
277 3300049592 Ga0501076_0049226 Ga0501076_0049226_1700_3127 439
278 3300049741 Ga0501079_0155469 Ga0501079_0155469_213_1640 439
279 3300049743 Ga0501081_0045484 Ga0501081_0045484_261_1688 439
280 3300049822 Ga0501035_0035917 Ga0501035_0035917_134_1561 439
281 3300049823 Ga0501044_0202789 Ga0501044_0202789_422_1849 439
282 3300050511 nmdc:mga08y16_84028_c1 nmdc:mga08y16_84028_c1_104_1459 439
283 3300050511 nmdc:mga08y16_85531_c1 nmdc:mga08y16_85531_c1_961_2388 439
284 3300050512 nmdc:mga0n895_30856_c1 nmdc:mga0n895_30856_c1_1568_2923 439
285 3300050515 nmdc:mga0a205_188_c1 nmdc:mga0a205_188_c1_2356_3711 439

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

74

296

0.95

PF01464

SLT

Transglycosylase SLT domain

326

441

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5aa1-assembly2.cif.gz_B crystal structure of mltf from pseudomonas aeruginosa in complex with nag-anhnam-pentapeptide 0.8863 20 423
5aa2-assembly2.cif.gz_B crystal structure of mltf from pseudomonas aeruginosa in complex with nam-pentapeptide. 0.8855 20 423
5aa3-assembly8.cif.gz_F crystal structure of mltf from pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide 0.8843 20 424
5aa4-assembly3.cif.gz_C crystal structure of mltf from pseudomonas aeruginosa in complex with cell-wall tetrapeptide 0.8826 19 424
5aa2-assembly4.cif.gz_D crystal structure of mltf from pseudomonas aeruginosa in complex with nam-pentapeptide. 0.8793 20 422
ID Description Score Start End Superfamily
af_P0AGC5_272_452_1.10.530.10 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.9619 239 420 1.10.530.10
af_P0AGC5_272_452_1.10.530.10 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.9515 239 420 1.10.530.10
5a5xB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9494 99 193 3.40.190.10
5a5xB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.93 99 193 3.40.190.10
5uh0B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9212 100 189 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6J4YBU9-F1-model_v4 Transglycosylase SLT domain-containing protein 0.9786 276 423
AF-A0A855HPH7-F1-model_v4 deleted 0.9764 258 335
AF-A0A3D3M775-F1-model_v4 Lytic transglycosylase 0.9744 260 335 GO:0000270
GO:0008933
GO:0016020
AF-A0A1X7AHV5-F1-model_v4 Membrane-bound lytic murein transglycosylase F (EC 4.2.2.-) 0.9661 238 424 GO:0000270
GO:0008933
GO:0016020
AF-A0A353XBQ9-F1-model_v4 deleted 0.9645 253 335

Feature Viewer

pLDDT pTM Quality
87.41 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map