F386744
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 285 | 186 | 285 | 463 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10022423|Ga0105240_100224236 |
| Length | 498 |
| Sequence | MIGYSSASAKGLSHQQNSPASRDSNQLTTVRNLNPHINWQRWTKVIVSVSAIALLGTCAPLPSLIDQIKTLGELRMVTRNGPLAYYRGPGDIPEGPEYELARRFADELGVKLKVIPVHTYAEIYAALTTGHAQLAAAGLKVPAQNIPGIEFGPAYQRVTEHLIYRRGAARPNSLADIGGADLEIAAGSSHAKTLYAARNTLPDLVWVENASTDTQALLDGVANGTIDYTIADSTEFALAHDAHPDLRVAFDFAGTQSLAWAASTRNPGFLHDLYGYFGRLSLDGELASIVKRYYGRSEEVHFAGARAAGTRGFMRHLQSRLPLYKKWFQEAAQQSSQDWRLLAAIGYEESKWNPSAASASGAKGLMQLTAQSANAVKVSDPADARQSIFGGARYFRQVYAKIPAHVPEPDRTWFALAAYNIGYGHLEDARVLAQKAGRDPDSWQDVREFLPLLEQEQWYTQTENGYARGSEPVRYVDNVRGYRDMLEWAWGAGRPALN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 21 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 22 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 23 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 24 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 25 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 26 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 28 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 32 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 33 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 34 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 35 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 37 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 38 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 84 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 85 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 86 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 90 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 91 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 92 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 93 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 94 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 95 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 96 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 97 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 98 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 99 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 100 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 101 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 102 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 103 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 104 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 105 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 106 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 107 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 108 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 109 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 110 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 111 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 112 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 113 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 114 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 115 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 116 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 117 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 118 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 119 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 120 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 121 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 122 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 123 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 124 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 125 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 126 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 127 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 128 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 129 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 130 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 131 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 132 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 133 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 134 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 135 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 136 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 141 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 142 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 143 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 144 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 145 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 146 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 147 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 148 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 149 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 150 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 151 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 152 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 177 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 178 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 179 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 180 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 181 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 182 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 183 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 186 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.95 |
| Metatranscriptomes | 1.05 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.16 |
| Nodule | 0 |
| Rhizoplane | 3.16 |
| Rhizosphere | 85.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10103653 | 3300005290 | Bacteria | 1971 |
| 2 | Ga0070683_100279670 | 3300005329 | Bacteria | 1587 |
| 3 | Ga0070666_10004506 | 3300005335 | Bacteria | 8488 |
| 4 | Ga0070666_10014409 | 3300005335 | Bacteria | 5033 |
| 5 | Ga0070680_100020167 | 3300005336 | Bacteria | 5289 |
| 6 | Ga0070680_100059486 | 3300005336 | Bacteria | 3126 |
| 7 | Ga0070680_100067283 | 3300005336 | Bacteria | 2938 |
| 8 | Ga0070660_100076168 | 3300005339 | Bacteria | 2627 |
| 9 | Ga0070675_100004438 | 3300005354 | Bacteria | 10693 |
| 10 | Ga0070671_100002494 | 3300005355 | Bacteria | 14239 |
| 11 | Ga0070671_100010633 | 3300005355 | Bacteria | 7386 |
| 12 | Ga0070667_100006632 | 3300005367 | Bacteria | 9623 |
| 13 | Ga0070667_100011574 | 3300005367 | Bacteria | 7292 |
| 14 | Ga0070709_10003890 | 3300005434 | Bacteria | 8048 |
| 15 | Ga0070709_10049739 | 3300005434 | Bacteria | 2622 |
| 16 | Ga0070713_100003136 | 3300005436 | Bacteria | 10880 |
| 17 | Ga0070713_100192638 | 3300005436 | Bacteria | 1838 |
| 18 | Ga0070678_100057413 | 3300005456 | Bacteria | 2852 |
| 19 | Ga0070681_10000904 | 3300005458 | Bacteria | 25100 |
| 20 | Ga0070681_10006554 | 3300005458 | Bacteria | 11333 |
| 21 | Ga0070681_10014618 | 3300005458 | Bacteria | 7811 |
| 22 | Ga0070681_10097974 | 3300005458 | Bacteria | 2878 |
| 23 | Ga0070699_100142640 | 3300005518 | Bacteria | 2116 |
| 24 | Ga0070679_100169881 | 3300005530 | Bacteria | 2153 |
| 25 | Ga0070686_100083329 | 3300005544 | Bacteria | 2122 |
| 26 | Ga0070695_100021577 | 3300005545 | Bacteria | 3944 |
| 27 | Ga0070696_100003623 | 3300005546 | Bacteria | 10288 |
| 28 | Ga0070693_100094295 | 3300005547 | Bacteria | 1811 |
| 29 | Ga0070665_100002916 | 3300005548 | Bacteria | 18473 |
| 30 | Ga0070665_100050511 | 3300005548 | Bacteria | 4173 |
| 31 | Ga0070665_100061103 | 3300005548 | Bacteria | 3777 |
| 32 | Ga0068855_100008768 | 3300005563 | Bacteria | 12224 |
| 33 | Ga0068855_100054020 | 3300005563 | Bacteria | 4724 |
| 34 | Ga0068855_100123442 | 3300005563 | Bacteria | 2962 |
| 35 | Ga0068856_100027511 | 3300005614 | Bacteria | 5547 |
| 36 | Ga0068859_100042084 | 3300005617 | Bacteria | 4588 |
| 37 | Ga0068859_100115354 | 3300005617 | Bacteria | 2751 |
| 38 | Ga0068861_100013791 | 3300005719 | Bacteria | 5661 |
| 39 | Ga0068863_100003478 | 3300005841 | Bacteria | 15537 |
| 40 | Ga0068863_100020173 | 3300005841 | Bacteria | 6376 |
| 41 | Ga0068863_100109527 | 3300005841 | Bacteria | 2629 |
| 42 | Ga0068858_100006661 | 3300005842 | Bacteria | 11237 |
| 43 | Ga0068858_100100496 | 3300005842 | Bacteria | 2697 |
| 44 | Ga0081455_10000127 | 3300005937 | Bacteria | 88574 |
| 45 | Ga0081539_10000016 | 3300005985 | Bacteria | 381648 |
| 46 | Ga0070716_100011311 | 3300006173 | Bacteria | 4494 |
| 47 | Ga0070712_100000490 | 3300006175 | Bacteria | 22572 |
| 48 | Ga0070712_100107760 | 3300006175 | Bacteria | 2073 |
| 49 | Ga0097621_100017774 | 3300006237 | Bacteria | 5411 |
| 50 | Ga0075428_100007903 | 3300006844 | Bacteria | 11792 |
| 51 | Ga0075433_10001231 | 3300006852 | Bacteria | 18666 |
| 52 | Ga0075434_100005042 | 3300006871 | Bacteria | 11994 |
| 53 | Ga0075436_100011699 | 3300006914 | Bacteria | 6024 |
| 54 | Ga0097620_100042084 | 3300006931 | Bacteria | 4588 |
| 55 | Ga0097620_100115351 | 3300006931 | Bacteria | 2751 |
| 56 | Ga0099794_10061204 | 3300007265 | Bacteria | 1829 |
| 57 | Ga0099795_10034616 | 3300007788 | Bacteria | 1761 |
| 58 | Ga0105250_10015456 | 3300009092 | Bacteria | 3125 |
| 59 | Ga0105240_10004778 | 3300009093 | Bacteria | 20433 |
| 60 | Ga0105240_10014329 | 3300009093 | Bacteria | 10829 |
| 61 | Ga0105240_10019277 | 3300009093 | Bacteria | 9118 |
| 62 | Ga0105240_10022423 | 3300009093 | Bacteria | 8371 |
| 63 | Ga0105240_10022583 | 3300009093 | Bacteria | 8337 |
| 64 | Ga0105240_10050372 | 3300009093 | Bacteria | 5251 |
| 65 | Ga0105240_10058672 | 3300009093 | Bacteria | 4805 |
| 66 | Ga0105240_10078088 | 3300009093 | Bacteria | 4077 |
| 67 | Ga0105240_10095911 | 3300009093 | Bacteria | 3615 |
| 68 | Ga0105240_10102565 | 3300009093 | Bacteria | 3476 |
| 69 | Ga0105240_10322203 | 3300009093 | Bacteria | 1761 |
| 70 | Ga0111539_10004441 | 3300009094 | Bacteria | 18326 |
| 71 | Ga0111539_10048637 | 3300009094 | Bacteria | 5062 |
| 72 | Ga0105247_10000295 | 3300009101 | Bacteria | 44958 |
| 73 | Ga0105242_10005065 | 3300009176 | Bacteria | 10177 |
| 74 | Ga0105248_10043926 | 3300009177 | Bacteria | 5012 |
| 75 | Ga0105248_10120931 | 3300009177 | Bacteria | 2954 |
| 76 | Ga0105237_10006398 | 3300009545 | Bacteria | 13072 |
| 77 | Ga0105237_10130923 | 3300009545 | Bacteria | 2503 |
| 78 | Ga0105237_10136666 | 3300009545 | Bacteria | 2445 |
| 79 | Ga0105237_10172848 | 3300009545 | Bacteria | 2161 |
| 80 | Ga0105237_10198341 | 3300009545 | Bacteria | 2006 |
| 81 | Ga0105238_10108337 | 3300009551 | Bacteria | 2759 |
| 82 | Ga0105238_10336992 | 3300009551 | Unclassified | 1496 |
| 83 | Ga0099796_10000890 | 3300010159 | Bacteria | 5538 |
| 84 | Ga0105239_10008142 | 3300010375 | Bacteria | 11963 |
| 85 | Ga0105239_10209286 | 3300010375 | Unclassified | 2186 |
| 86 | Ga0157370_10006510 | 3300013104 | Bacteria | 12862 |
| 87 | Ga0157369_10020627 | 3300013105 | Bacteria | 7369 |
| 88 | Ga0157369_10069865 | 3300013105 | Bacteria | 3773 |
| 89 | Ga0157369_10203046 | 3300013105 | Bacteria | 2080 |
| 90 | Ga0163162_10126836 | 3300013306 | Bacteria | 2659 |
| 91 | Ga0157372_10039309 | 3300013307 | Bacteria | 5221 |
| 92 | Ga0157372_10051928 | 3300013307 | Bacteria | 4564 |
| 93 | Ga0157375_10107458 | 3300013308 | Bacteria | 2884 |
| 94 | Ga0163163_10029144 | 3300014325 | Bacteria | 5309 |
| 95 | Ga0163163_10065129 | 3300014325 | Bacteria | 3616 |
| 96 | Ga0163163_10099018 | 3300014325 | Bacteria | 2937 |
| 97 | Ga0157380_10003065 | 3300014326 | Bacteria | 11386 |
| 98 | Ga0157379_10016147 | 3300014968 | Bacteria | 6567 |
| 99 | Ga0157379_10021791 | 3300014968 | Bacteria | 5676 |
| 100 | Ga0157379_10031794 | 3300014968 | Bacteria | 4702 |
| 101 | Ga0157379_10123367 | 3300014968 | Bacteria | 2331 |
| 102 | Ga0157376_10184646 | 3300014969 | Bacteria | 1908 |
| 103 | Ga0207710_10000497 | 3300025900 | Bacteria | 24606 |
| 104 | Ga0207680_10112008 | 3300025903 | Bacteria | 1771 |
| 105 | Ga0207699_10001862 | 3300025906 | Bacteria | 9937 |
| 106 | Ga0207699_10015339 | 3300025906 | Bacteria | 3977 |
| 107 | Ga0207699_10039395 | 3300025906 | Bacteria | 2715 |
| 108 | Ga0207707_10021857 | 3300025912 | Bacteria | 5592 |
| 109 | Ga0207707_10034567 | 3300025912 | Bacteria | 4422 |
| 110 | Ga0207695_10007935 | 3300025913 | Bacteria | 13395 |
| 111 | Ga0207695_10011584 | 3300025913 | Bacteria | 10665 |
| 112 | Ga0207695_10028463 | 3300025913 | Bacteria | 6196 |
| 113 | Ga0207695_10047587 | 3300025913 | Bacteria | 4536 |
| 114 | Ga0207695_10055273 | 3300025913 | Bacteria | 4138 |
| 115 | Ga0207695_10066598 | 3300025913 | Bacteria | 3698 |
| 116 | Ga0207695_10177488 | 3300025913 | Bacteria | 2052 |
| 117 | Ga0207671_10080390 | 3300025914 | Bacteria | 2443 |
| 118 | Ga0207671_10083097 | 3300025914 | Bacteria | 2404 |
| 119 | Ga0207693_10000007 | 3300025915 | Bacteria | 173735 |
| 120 | Ga0207660_10054744 | 3300025917 | Bacteria | 2848 |
| 121 | Ga0207660_10137075 | 3300025917 | Bacteria | 1868 |
| 122 | Ga0207660_10137321 | 3300025917 | Bacteria | 1867 |
| 123 | Ga0207657_10129732 | 3300025919 | Bacteria | 2067 |
| 124 | Ga0207652_10028996 | 3300025921 | Bacteria | 4622 |
| 125 | Ga0207652_10089843 | 3300025921 | Bacteria | 2698 |
| 126 | Ga0207652_10097554 | 3300025921 | Bacteria | 2591 |
| 127 | Ga0207681_10066360 | 3300025923 | Bacteria | 2498 |
| 128 | Ga0207694_10157336 | 3300025924 | Bacteria | 1834 |
| 129 | Ga0207694_10208572 | 3300025924 | Unclassified | 1591 |
| 130 | Ga0207687_10071200 | 3300025927 | Bacteria | 2484 |
| 131 | Ga0207700_10015599 | 3300025928 | Bacteria | 5017 |
| 132 | Ga0207700_10061598 | 3300025928 | Bacteria | 2846 |
| 133 | Ga0207700_10185809 | 3300025928 | Bacteria | 1743 |
| 134 | Ga0207644_10076084 | 3300025931 | Bacteria | 2468 |
| 135 | Ga0207644_10143765 | 3300025931 | Bacteria | 1839 |
| 136 | Ga0207704_10033607 | 3300025938 | Bacteria | 2918 |
| 137 | Ga0207665_10001462 | 3300025939 | Bacteria | 15902 |
| 138 | Ga0207665_10003051 | 3300025939 | Bacteria | 11230 |
| 139 | Ga0207711_10070785 | 3300025941 | Bacteria | 3025 |
| 140 | Ga0207661_10183200 | 3300025944 | Bacteria | 1831 |
| 141 | Ga0207667_10007376 | 3300025949 | Bacteria | 13232 |
| 142 | Ga0207667_10010532 | 3300025949 | Bacteria | 10805 |
| 143 | Ga0207658_10003370 | 3300025986 | Bacteria | 11309 |
| 144 | Ga0207703_10000518 | 3300026035 | Bacteria | 39574 |
| 145 | Ga0207703_10004333 | 3300026035 | Bacteria | 11665 |
| 146 | Ga0207703_10146036 | 3300026035 | Bacteria | 2057 |
| 147 | Ga0207678_10156991 | 3300026067 | Bacteria | 1943 |
| 148 | Ga0207641_10001792 | 3300026088 | Bacteria | 20694 |
| 149 | Ga0207641_10039721 | 3300026088 | Bacteria | 3936 |
| 150 | Ga0207675_100008209 | 3300026118 | Bacteria | 9838 |
| 151 | Ga0207683_10013063 | 3300026121 | Bacteria | 7087 |
| 152 | Ga0207428_10044530 | 3300027907 | Bacteria | 3581 |
| 153 | Ga0265354_1000425 | 3300028016 | Bacteria | 7387 |
| 154 | Ga0265356_1000365 | 3300028017 | Bacteria | 8196 |
| 155 | Ga0268266_10001576 | 3300028379 | Bacteria | 26652 |
| 156 | Ga0268266_10010029 | 3300028379 | Bacteria | 8312 |
| 157 | Ga0268265_10136546 | 3300028380 | Bacteria | 2047 |
| 158 | Ga0268264_10000034 | 3300028381 | Bacteria | 401894 |
| 159 | Ga0268264_10003439 | 3300028381 | Bacteria | 13658 |
| 160 | Ga0307515_10019845 | 3300028794 | Bacteria | 12051 |
| 161 | Ga0265338_10039738 | 3300028800 | Bacteria | 4432 |
| 162 | Ga0265770_1000093 | 3300030878 | Bacteria | 10219 |
| 163 | Ga0265765_1001646 | 3300030879 | Bacteria | 2078 |
| 164 | Ga0265760_10000085 | 3300031090 | Bacteria | 23936 |
| 165 | Ga0265340_10034887 | 3300031247 | Bacteria | 2500 |
| 166 | Ga0265316_10048924 | 3300031344 | Bacteria | 3333 |
| 167 | Ga0307509_10000021 | 3300031507 | Bacteria | 250589 |
| 168 | Ga0307509_10232492 | 3300031507 | Bacteria | 1645 |
| 169 | Ga0307516_10005969 | 3300031730 | Bacteria | 14398 |
| 170 | Ga0307405_10016005 | 3300031731 | Bacteria | 4078 |
| 171 | Ga0307410_10069976 | 3300031852 | Bacteria | 2429 |
| 172 | Ga0307406_10052241 | 3300031901 | Bacteria | 2599 |
| 173 | Ga0307412_10087170 | 3300031911 | Bacteria | 2174 |
| 174 | Ga0307409_100056166 | 3300031995 | Bacteria | 3043 |
| 175 | Ga0307416_100001209 | 3300032002 | Bacteria | 13909 |
| 176 | Ga0307416_100131639 | 3300032002 | Bacteria | 2253 |
| 177 | Ga0307510_10000005 | 3300033180 | Bacteria | 633068 |
| 178 | Ga0307510_10001400 | 3300033180 | Bacteria | 26475 |
| 179 | Ga0373936_0002132 | 3300035113 | Bacteria | 7360 |
| 180 | Ga0373955_0014481 | 3300035172 | Bacteria | 3838 |
| 181 | Ga0373933_0016863 | 3300035724 | Bacteria | 4093 |
| 182 | Ga0373947_0018652 | 3300035725 | Bacteria | 3995 |
| 183 | Ga0373937_0037512 | 3300036401 | Bacteria | 4417 |
| 184 | Ga0395900_0145249 | 3300037418 | Unclassified | 2426 |
| 185 | Ga0395898_0008541 | 3300037466 | Bacteria | 10820 |
| 186 | Ga0400487_17400 | 3300039110 | Bacteria | 4727 |
| 187 | Ga0436365_1466533 | 3300039437 | Bacteria | 13925 |
| 188 | Ga0436360_0440587 | 3300039438 | Bacteria | 2091 |
| 189 | Ga0436360_0517698 | 3300039438 | Bacteria | 2983 |
| 190 | Ga0436361_0848382 | 3300039447 | Bacteria | 6748 |
| 191 | Ga0436363_0686286 | 3300039450 | Bacteria | 2748 |
| 192 | Ga0436363_1077320 | 3300039450 | Bacteria | 2026 |
| 193 | Ga0436363_1663288 | 3300039450 | Bacteria | 2524 |
| 194 | Ga0436362_0078389 | 3300039453 | Bacteria | 1775 |
| 195 | Ga0450895_001638 | 3300042132 | Bacteria | 1578 |
| 196 | Ga0450896_000489 | 3300042133 | Bacteria | 4113 |
| 197 | Ga0450907_010983 | 3300042146 | Bacteria | 1505 |
| 198 | Ga0439446_0010587 | 3300042156 | Bacteria | 2486 |
| 199 | Ga0450908_003816 | 3300042184 | Bacteria | 2917 |
| 200 | Ga0439434_0004973 | 3300042435 | Bacteria | 3887 |
| 201 | Ga0439435_0002114 | 3300042436 | Bacteria | 3863 |
| 202 | Ga0439444_0000436 | 3300042437 | Bacteria | 4648 |
| 203 | Ga0451577_0012893 | 3300042876 | Bacteria | 7846 |
| 204 | Ga0466969_0001998 | 3300044656 | Bacteria | 10895 |
| 205 | Ga0466966_0094066 | 3300044684 | Bacteria | 1858 |
| 206 | Ga0466961_0081913 | 3300044693 | Bacteria | 2042 |
| 207 | Ga0466963_0064398 | 3300044694 | Bacteria | 2456 |
| 208 | Ga0466964_0010618 | 3300044706 | Bacteria | 3474 |
| 209 | Ga0466970_0005809 | 3300044765 | Bacteria | 6137 |
| 210 | Ga0466960_0092129 | 3300044901 | Bacteria | 1547 |
| 211 | Ga0466959_0015956 | 3300045049 | Bacteria | 5481 |
| 212 | Ga0466959_0015961 | 3300045049 | Bacteria | 5480 |
| 213 | Ga0466959_0095516 | 3300045049 | Bacteria | 2132 |
| 214 | Ga0466958_0032256 | 3300045836 | Bacteria | 3116 |
| 215 | Ga0495580_0014852 | 3300046472 | Bacteria | 5901 |
| 216 | Ga0495580_0072370 | 3300046472 | Bacteria | 2407 |
| 217 | Ga0495587_0035757 | 3300046536 | Bacteria | 2991 |
| 218 | Ga0495671_0044111 | 3300046692 | Bacteria | 2236 |
| 219 | Ga0496100_0005412 | 3300048903 | Bacteria | 6873 |
| 220 | Ga0496100_0138477 | 3300048903 | Bacteria | 1722 |
| 221 | Ga0496102_0007610 | 3300048905 | Bacteria | 9254 |
| 222 | Ga0496102_0174314 | 3300048905 | Bacteria | 2025 |
| 223 | Ga0496104_0005588 | 3300048907 | Bacteria | 11007 |
| 224 | Ga0496112_0218330 | 3300048915 | Bacteria | 1863 |
| 225 | Ga0496114_0011448 | 3300048917 | Bacteria | 7087 |
| 226 | Ga0496115_0040910 | 3300048918 | Bacteria | 3686 |
| 227 | Ga0496115_0118732 | 3300048918 | Bacteria | 2175 |
| 228 | Ga0496116_0006071 | 3300048919 | Bacteria | 11053 |
| 229 | Ga0496117_0000012 | 3300048920 | Bacteria | 608530 |
| 230 | Ga0496118_0000051 | 3300048921 | Bacteria | 241198 |
| 231 | Ga0496120_0000191 | 3300048923 | Bacteria | 105146 |
| 232 | Ga0496120_0001464 | 3300048923 | Bacteria | 28168 |
| 233 | Ga0496121_0008161 | 3300048924 | Bacteria | 12437 |
| 234 | Ga0496121_0067514 | 3300048924 | Bacteria | 2898 |
| 235 | Ga0496125_0001779 | 3300048928 | Bacteria | 29785 |
| 236 | Ga0496125_0003243 | 3300048928 | Bacteria | 20050 |
| 237 | Ga0496125_0129060 | 3300048928 | Bacteria | 1784 |
| 238 | Ga0496126_0004328 | 3300048929 | Bacteria | 17038 |
| 239 | Ga0501032_0007943 | 3300049569 | Bacteria | 7729 |
| 240 | Ga0501036_0013836 | 3300049572 | Bacteria | 6710 |
| 241 | Ga0501039_0006731 | 3300049575 | Bacteria | 8747 |
| 242 | Ga0501039_0042304 | 3300049575 | Bacteria | 3520 |
| 243 | Ga0501039_0106683 | 3300049575 | Bacteria | 2188 |
| 244 | Ga0501040_0032885 | 3300049576 | Bacteria | 3510 |
| 245 | Ga0501042_0001379 | 3300049578 | Bacteria | 14260 |
| 246 | Ga0501042_0016423 | 3300049578 | Bacteria | 5080 |
| 247 | Ga0501046_0037587 | 3300049580 | Bacteria | 3890 |
| 248 | Ga0501048_0004714 | 3300049582 | Bacteria | 10382 |
| 249 | Ga0501067_0004732 | 3300049583 | Bacteria | 7536 |
| 250 | Ga0501068_0048254 | 3300049584 | Bacteria | 2570 |
| 251 | Ga0501071_0001019 | 3300049587 | Bacteria | 15431 |
| 252 | Ga0501071_0133441 | 3300049587 | Bacteria | 1846 |
| 253 | Ga0501072_0018290 | 3300049588 | Bacteria | 5393 |
| 254 | Ga0501072_0020846 | 3300049588 | Bacteria | 5081 |
| 255 | Ga0501074_0030588 | 3300049590 | Bacteria | 3902 |
| 256 | Ga0501075_0014639 | 3300049591 | Bacteria | 5621 |
| 257 | Ga0501076_0010585 | 3300049592 | Bacteria | 6848 |
| 258 | Ga0501076_0049226 | 3300049592 | Bacteria | 3332 |
| 259 | Ga0501077_0004272 | 3300049593 | Bacteria | 8639 |
| 260 | Ga0501079_0027680 | 3300049741 | Bacteria | 4348 |
| 261 | Ga0501079_0155469 | 3300049741 | Bacteria | 1783 |
| 262 | Ga0501080_0048703 | 3300049742 | Bacteria | 3943 |
| 263 | Ga0501080_0078328 | 3300049742 | Bacteria | 3074 |
| 264 | Ga0501081_0018688 | 3300049743 | Bacteria | 4606 |
| 265 | Ga0501081_0045484 | 3300049743 | Bacteria | 3014 |
| 266 | Ga0501035_0035917 | 3300049822 | Bacteria | 4495 |
| 267 | Ga0501044_0202789 | 3300049823 | Bacteria | 1941 |
| 268 | nmdc:mga08y16_84028_c1 | 3300050511 | Bacteria | 3318 |
| 269 | nmdc:mga08y16_85531_c1 | 3300050511 | Bacteria | 3287 |
| 270 | nmdc:mga0n895_30856_c1 | 3300050512 | Bacteria | 5127 |
| 271 | nmdc:mga08x19_26458_c1 | 3300050514 | Bacteria | 3620 |
| 272 | nmdc:mga0a205_188_c1 | 3300050515 | Bacteria | 30684 |
| 273 | Ga0500646_0022224 | 3300053090 | Bacteria | 1696 |
| 274 | Ga0500583_0003753 | 3300053092 | Bacteria | 4840 |
| 275 | Ga0500658_0023839 | 3300053134 | Bacteria | 2340 |
| 276 | Ga0500616_0000018 | 3300053153 | Bacteria | 610976 |
| 277 | Ga0500616_0052424 | 3300053153 | Bacteria | 2145 |
| 278 | Ga0500622_0002638 | 3300053156 | Bacteria | 12741 |
| 279 | Ga0500637_0056541 | 3300053178 | Bacteria | 2242 |
| 280 | Ga0500637_0081625 | 3300053178 | Bacteria | 1867 |
| 281 | Ga0500611_022996 | 3300053727 | Bacteria | 1209 |
| 282 | Ga0501084_0043184 | 3300054114 | Bacteria | 3771 |
| 283 | Ga0501082_0039079 | 3300060353 | Bacteria | 4093 |
| 284 | Ga0466962_0001377 | 3300061719 | Bacteria | 11263 |
| 285 | Ga0530510_0019793 | 3300061734 | Bacteria | 4783 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053727 | Ga0500611_022996 | Ga0500611_022996_36_1196 | 367 |
| 2 | 3300053090 | Ga0500646_0022224 | Ga0500646_0022224_42_1286 | 391 |
| 3 | 3300053156 | Ga0500622_0002638 | Ga0500622_0002638_1605_2849 | 391 |
| 4 | 3300005546 | Ga0070696_100003623 | Ga0070696_1000036237 | 403 |
| 5 | 3300053153 | Ga0500616_0000018 | Ga0500616_0000018_1662_3083 | 407 |
| 6 | 3300005841 | Ga0068863_100003478 | Ga0068863_10000347812 | 411 |
| 7 | 3300005985 | Ga0081539_10000016 | Ga0081539_10000016264 | 413 |
| 8 | 3300053134 | Ga0500658_0023839 | Ga0500658_0023839_346_1761 | 414 |
| 9 | 3300006175 | Ga0070712_100107760 | Ga0070712_1001077602 | 417 |
| 10 | 3300025906 | Ga0207699_10015339 | Ga0207699_100153392 | 417 |
| 11 | 3300025939 | Ga0207665_10003051 | Ga0207665_100030517 | 417 |
| 12 | 3300048918 | Ga0496115_0118732 | Ga0496115_0118732_716_2131 | 418 |
| 13 | 3300009093 | Ga0105240_10019277 | Ga0105240_100192775 | 419 |
| 14 | 3300014325 | Ga0163163_10065129 | Ga0163163_100651292 | 419 |
| 15 | 3300048929 | Ga0496126_0004328 | Ga0496126_0004328_5238_6548 | 419 |
| 16 | 3300053178 | Ga0500637_0056541 | Ga0500637_0056541_345_1655 | 419 |
| 17 | 3300048905 | Ga0496102_0174314 | Ga0496102_0174314_230_1684 | 421 |
| 18 | 3300007265 | Ga0099794_10061204 | Ga0099794_100612042 | 423 |
| 19 | 3300007788 | Ga0099795_10034616 | Ga0099795_100346161 | 423 |
| 20 | 3300010159 | Ga0099796_10000890 | Ga0099796_100008902 | 423 |
| 21 | 3300006914 | Ga0075436_100011699 | Ga0075436_1000116995 | 425 |
| 22 | 3300050514 | nmdc:mga08x19_26458_c1 | nmdc:mga08x19_26458_c1_912_2357 | 425 |
| 23 | 3300028800 | Ga0265338_10039738 | Ga0265338_100397385 | 426 |
| 24 | 3300031247 | Ga0265340_10034887 | Ga0265340_100348873 | 426 |
| 25 | 3300031507 | Ga0307509_10232492 | Ga0307509_102324922 | 426 |
| 26 | 3300035725 | Ga0373947_0018652 | Ga0373947_0018652_2082_3560 | 426 |
| 27 | 3300039450 | Ga0436363_1077320 | Ga0436363_1077320_283_1740 | 426 |
| 28 | 3300046472 | Ga0495580_0072370 | Ga0495580_0072370_573_2051 | 426 |
| 29 | 3300028794 | Ga0307515_10019845 | Ga0307515_100198453 | 427 |
| 30 | 3300005335 | Ga0070666_10004506 | Ga0070666_100045064 | 428 |
| 31 | 3300005355 | Ga0070671_100002494 | Ga0070671_1000024949 | 428 |
| 32 | 3300005367 | Ga0070667_100011574 | Ga0070667_1000115746 | 428 |
| 33 | 3300005434 | Ga0070709_10049739 | Ga0070709_100497394 | 428 |
| 34 | 3300005436 | Ga0070713_100003136 | Ga0070713_1000031362 | 428 |
| 35 | 3300005456 | Ga0070678_100057413 | Ga0070678_1000574133 | 428 |
| 36 | 3300005547 | Ga0070693_100094295 | Ga0070693_1000942952 | 428 |
| 37 | 3300005548 | Ga0070665_100061103 | Ga0070665_1000611034 | 428 |
| 38 | 3300005614 | Ga0068856_100027511 | Ga0068856_1000275114 | 428 |
| 39 | 3300005841 | Ga0068863_100109527 | Ga0068863_1001095272 | 428 |
| 40 | 3300005842 | Ga0068858_100100496 | Ga0068858_1001004963 | 428 |
| 41 | 3300006173 | Ga0070716_100011311 | Ga0070716_1000113114 | 428 |
| 42 | 3300006175 | Ga0070712_100000490 | Ga0070712_1000004903 | 428 |
| 43 | 3300006237 | Ga0097621_100017774 | Ga0097621_1000177745 | 428 |
| 44 | 3300009176 | Ga0105242_10005065 | Ga0105242_100050652 | 428 |
| 45 | 3300009177 | Ga0105248_10120931 | Ga0105248_101209313 | 428 |
| 46 | 3300009545 | Ga0105237_10006398 | Ga0105237_100063988 | 428 |
| 47 | 3300010375 | Ga0105239_10008142 | Ga0105239_100081423 | 428 |
| 48 | 3300013308 | Ga0157375_10107458 | Ga0157375_101074583 | 428 |
| 49 | 3300014968 | Ga0157379_10031794 | Ga0157379_100317942 | 428 |
| 50 | 3300025906 | Ga0207699_10039395 | Ga0207699_100393953 | 428 |
| 51 | 3300025913 | Ga0207695_10055273 | Ga0207695_100552734 | 428 |
| 52 | 3300025915 | Ga0207693_10000007 | Ga0207693_1000000746 | 428 |
| 53 | 3300025927 | Ga0207687_10071200 | Ga0207687_100712002 | 428 |
| 54 | 3300025928 | Ga0207700_10015599 | Ga0207700_100155992 | 428 |
| 55 | 3300025931 | Ga0207644_10076084 | Ga0207644_100760842 | 428 |
| 56 | 3300025938 | Ga0207704_10033607 | Ga0207704_100336071 | 428 |
| 57 | 3300025939 | Ga0207665_10001462 | Ga0207665_100014626 | 428 |
| 58 | 3300025941 | Ga0207711_10070785 | Ga0207711_100707853 | 428 |
| 59 | 3300026035 | Ga0207703_10146036 | Ga0207703_101460362 | 428 |
| 60 | 3300026121 | Ga0207683_10013063 | Ga0207683_100130634 | 428 |
| 61 | 3300035172 | Ga0373955_0014481 | Ga0373955_0014481_534_2036 | 428 |
| 62 | 3300035724 | Ga0373933_0016863 | Ga0373933_0016863_2519_4021 | 428 |
| 63 | 3300036401 | Ga0373937_0037512 | Ga0373937_0037512_1495_2997 | 428 |
| 64 | 3300046536 | Ga0495587_0035757 | Ga0495587_0035757_26_1528 | 428 |
| 65 | 3300046692 | Ga0495671_0044111 | Ga0495671_0044111_557_1969 | 428 |
| 66 | 3300048903 | Ga0496100_0005412 | Ga0496100_0005412_1110_2606 | 428 |
| 67 | 3300048905 | Ga0496102_0007610 | Ga0496102_0007610_5955_7451 | 428 |
| 68 | 3300048915 | Ga0496112_0218330 | Ga0496112_0218330_62_1558 | 428 |
| 69 | 3300048917 | Ga0496114_0011448 | Ga0496114_0011448_56_1552 | 428 |
| 70 | 3300039447 | Ga0436361_0848382 | Ga0436361_0848382_1784_3193 | 429 |
| 71 | 3300049575 | Ga0501039_0042304 | Ga0501039_0042304_1185_2582 | 429 |
| 72 | 3300049576 | Ga0501040_0032885 | Ga0501040_0032885_1544_2941 | 429 |
| 73 | 3300049578 | Ga0501042_0016423 | Ga0501042_0016423_2053_3450 | 429 |
| 74 | 3300049580 | Ga0501046_0037587 | Ga0501046_0037587_1833_3230 | 429 |
| 75 | 3300049584 | Ga0501068_0048254 | Ga0501068_0048254_312_1709 | 429 |
| 76 | 3300049591 | Ga0501075_0014639 | Ga0501075_0014639_1370_2767 | 429 |
| 77 | 3300049592 | Ga0501076_0010585 | Ga0501076_0010585_2581_3978 | 429 |
| 78 | 3300049741 | Ga0501079_0027680 | Ga0501079_0027680_899_2296 | 429 |
| 79 | 3300049742 | Ga0501080_0048703 | Ga0501080_0048703_1818_3215 | 429 |
| 80 | 3300049743 | Ga0501081_0018688 | Ga0501081_0018688_1373_2770 | 429 |
| 81 | 3300053092 | Ga0500583_0003753 | Ga0500583_0003753_2902_4356 | 429 |
| 82 | 3300054114 | Ga0501084_0043184 | Ga0501084_0043184_658_2055 | 429 |
| 83 | 3300060353 | Ga0501082_0039079 | Ga0501082_0039079_765_2162 | 429 |
| 84 | 3300061734 | Ga0530510_0019793 | Ga0530510_0019793_1999_3396 | 429 |
| 85 | 3300005355 | Ga0070671_100010633 | Ga0070671_1000106331 | 430 |
| 86 | 3300005367 | Ga0070667_100006632 | Ga0070667_1000066325 | 430 |
| 87 | 3300005544 | Ga0070686_100083329 | Ga0070686_1000833291 | 430 |
| 88 | 3300005617 | Ga0068859_100042084 | Ga0068859_1000420845 | 430 |
| 89 | 3300005841 | Ga0068863_100020173 | Ga0068863_1000201737 | 430 |
| 90 | 3300005842 | Ga0068858_100006661 | Ga0068858_1000066617 | 430 |
| 91 | 3300006931 | Ga0097620_100042084 | Ga0097620_1000420845 | 430 |
| 92 | 3300009092 | Ga0105250_10015456 | Ga0105250_100154564 | 430 |
| 93 | 3300009101 | Ga0105247_10000295 | Ga0105247_1000029535 | 430 |
| 94 | 3300009177 | Ga0105248_10043926 | Ga0105248_100439265 | 430 |
| 95 | 3300014325 | Ga0163163_10029144 | Ga0163163_100291444 | 430 |
| 96 | 3300014968 | Ga0157379_10123367 | Ga0157379_101233673 | 430 |
| 97 | 3300025900 | Ga0207710_10000497 | Ga0207710_1000049724 | 430 |
| 98 | 3300025931 | Ga0207644_10143765 | Ga0207644_101437651 | 430 |
| 99 | 3300025986 | Ga0207658_10003370 | Ga0207658_100033707 | 430 |
| 100 | 3300026035 | Ga0207703_10004333 | Ga0207703_100043335 | 430 |
| 101 | 3300026088 | Ga0207641_10039721 | Ga0207641_100397216 | 430 |
| 102 | 3300028381 | Ga0268264_10003439 | Ga0268264_1000343914 | 430 |
| 103 | 3300031344 | Ga0265316_10048924 | Ga0265316_100489242 | 430 |
| 104 | 3300039110 | Ga0400487_17400 | Ga0400487_17400_1343_2770 | 430 |
| 105 | 3300039437 | Ga0436365_1466533 | Ga0436365_1466533_6568_7923 | 430 |
| 106 | 3300039450 | Ga0436363_1663288 | Ga0436363_1663288_480_1835 | 430 |
| 107 | 3300048903 | Ga0496100_0138477 | Ga0496100_0138477_152_1546 | 430 |
| 108 | 3300048907 | Ga0496104_0005588 | Ga0496104_0005588_5181_6575 | 430 |
| 109 | 3300048918 | Ga0496115_0040910 | Ga0496115_0040910_478_1872 | 430 |
| 110 | 3300048924 | Ga0496121_0008161 | Ga0496121_0008161_176_1579 | 430 |
| 111 | 3300048928 | Ga0496125_0129060 | Ga0496125_0129060_88_1491 | 430 |
| 112 | 3300005458 | Ga0070681_10014618 | Ga0070681_100146181 | 431 |
| 113 | 3300005937 | Ga0081455_10000127 | Ga0081455_1000012758 | 431 |
| 114 | 3300025924 | Ga0207694_10208572 | Ga0207694_102085721 | 431 |
| 115 | 3300028380 | Ga0268265_10136546 | Ga0268265_101365462 | 431 |
| 116 | 3300031730 | Ga0307516_10005969 | Ga0307516_100059696 | 431 |
| 117 | 3300039453 | Ga0436362_0078389 | Ga0436362_0078389_30_1439 | 431 |
| 118 | 3300044693 | Ga0466961_0081913 | Ga0466961_0081913_38_1420 | 431 |
| 119 | 3300044706 | Ga0466964_0010618 | Ga0466964_0010618_1245_2627 | 431 |
| 120 | 3300044765 | Ga0466970_0005809 | Ga0466970_0005809_3757_5139 | 431 |
| 121 | 3300044901 | Ga0466960_0092129 | Ga0466960_0092129_10_1434 | 431 |
| 122 | 3300045049 | Ga0466959_0095516 | Ga0466959_0095516_252_1634 | 431 |
| 123 | 3300045836 | Ga0466958_0032256 | Ga0466958_0032256_415_1797 | 431 |
| 124 | 3300053153 | Ga0500616_0052424 | Ga0500616_0052424_540_1976 | 431 |
| 125 | 3300061719 | Ga0466962_0001377 | Ga0466962_0001377_6519_7901 | 431 |
| 126 | 3300005329 | Ga0070683_100279670 | Ga0070683_1002796701 | 432 |
| 127 | 3300005335 | Ga0070666_10014409 | Ga0070666_100144096 | 432 |
| 128 | 3300005336 | Ga0070680_100020167 | Ga0070680_1000201672 | 432 |
| 129 | 3300005436 | Ga0070713_100192638 | Ga0070713_1001926382 | 432 |
| 130 | 3300005530 | Ga0070679_100169881 | Ga0070679_1001698812 | 432 |
| 131 | 3300005548 | Ga0070665_100002916 | Ga0070665_1000029167 | 432 |
| 132 | 3300005548 | Ga0070665_100050511 | Ga0070665_1000505116 | 432 |
| 133 | 3300005563 | Ga0068855_100008768 | Ga0068855_1000087686 | 432 |
| 134 | 3300006852 | Ga0075433_10001231 | Ga0075433_100012317 | 432 |
| 135 | 3300006871 | Ga0075434_100005042 | Ga0075434_1000050428 | 432 |
| 136 | 3300009093 | Ga0105240_10004778 | Ga0105240_1000477810 | 432 |
| 137 | 3300009093 | Ga0105240_10022423 | Ga0105240_100224236 | 432 |
| 138 | 3300009093 | Ga0105240_10050372 | Ga0105240_100503722 | 432 |
| 139 | 3300009093 | Ga0105240_10058672 | Ga0105240_100586725 | 432 |
| 140 | 3300009093 | Ga0105240_10078088 | Ga0105240_100780884 | 432 |
| 141 | 3300009093 | Ga0105240_10095911 | Ga0105240_100959111 | 432 |
| 142 | 3300009545 | Ga0105237_10130923 | Ga0105237_101309233 | 432 |
| 143 | 3300009545 | Ga0105237_10198341 | Ga0105237_101983411 | 432 |
| 144 | 3300010375 | Ga0105239_10209286 | Ga0105239_102092862 | 432 |
| 145 | 3300013306 | Ga0163162_10126836 | Ga0163162_101268363 | 432 |
| 146 | 3300013307 | Ga0157372_10039309 | Ga0157372_100393093 | 432 |
| 147 | 3300014325 | Ga0163163_10099018 | Ga0163163_100990182 | 432 |
| 148 | 3300014326 | Ga0157380_10003065 | Ga0157380_100030658 | 432 |
| 149 | 3300014968 | Ga0157379_10016147 | Ga0157379_100161475 | 432 |
| 150 | 3300014968 | Ga0157379_10021791 | Ga0157379_100217915 | 432 |
| 151 | 3300014969 | Ga0157376_10184646 | Ga0157376_101846462 | 432 |
| 152 | 3300025903 | Ga0207680_10112008 | Ga0207680_101120082 | 432 |
| 153 | 3300025913 | Ga0207695_10007935 | Ga0207695_100079357 | 432 |
| 154 | 3300025913 | Ga0207695_10028463 | Ga0207695_100284632 | 432 |
| 155 | 3300025913 | Ga0207695_10047587 | Ga0207695_100475873 | 432 |
| 156 | 3300025913 | Ga0207695_10066598 | Ga0207695_100665982 | 432 |
| 157 | 3300025914 | Ga0207671_10083097 | Ga0207671_100830972 | 432 |
| 158 | 3300025917 | Ga0207660_10054744 | Ga0207660_100547442 | 432 |
| 159 | 3300025921 | Ga0207652_10097554 | Ga0207652_100975543 | 432 |
| 160 | 3300025924 | Ga0207694_10157336 | Ga0207694_101573362 | 432 |
| 161 | 3300025928 | Ga0207700_10185809 | Ga0207700_101858092 | 432 |
| 162 | 3300025944 | Ga0207661_10183200 | Ga0207661_101832002 | 432 |
| 163 | 3300025949 | Ga0207667_10010532 | Ga0207667_100105329 | 432 |
| 164 | 3300026035 | Ga0207703_10000518 | Ga0207703_1000051817 | 432 |
| 165 | 3300026067 | Ga0207678_10156991 | Ga0207678_101569911 | 432 |
| 166 | 3300026088 | Ga0207641_10001792 | Ga0207641_1000179213 | 432 |
| 167 | 3300028016 | Ga0265354_1000425 | Ga0265354_10004255 | 432 |
| 168 | 3300028017 | Ga0265356_1000365 | Ga0265356_10003657 | 432 |
| 169 | 3300028379 | Ga0268266_10001576 | Ga0268266_1000157619 | 432 |
| 170 | 3300028379 | Ga0268266_10010029 | Ga0268266_100100295 | 432 |
| 171 | 3300028381 | Ga0268264_10000034 | Ga0268264_10000034268 | 432 |
| 172 | 3300030878 | Ga0265770_1000093 | Ga0265770_10000934 | 432 |
| 173 | 3300030879 | Ga0265765_1001646 | Ga0265765_10016462 | 432 |
| 174 | 3300031090 | Ga0265760_10000085 | Ga0265760_1000008513 | 432 |
| 175 | 3300031507 | Ga0307509_10000021 | Ga0307509_100000219 | 432 |
| 176 | 3300033180 | Ga0307510_10000005 | Ga0307510_10000005122 | 432 |
| 177 | 3300033180 | Ga0307510_10001400 | Ga0307510_100014002 | 432 |
| 178 | 3300035113 | Ga0373936_0002132 | Ga0373936_0002132_4061_5425 | 432 |
| 179 | 3300042132 | Ga0450895_001638 | Ga0450895_001638_96_1415 | 432 |
| 180 | 3300042146 | Ga0450907_010983 | Ga0450907_010983_81_1400 | 432 |
| 181 | 3300042184 | Ga0450908_003816 | Ga0450908_003816_881_2200 | 432 |
| 182 | 3300044656 | Ga0466969_0001998 | Ga0466969_0001998_7551_8912 | 432 |
| 183 | 3300044684 | Ga0466966_0094066 | Ga0466966_0094066_225_1586 | 432 |
| 184 | 3300045049 | Ga0466959_0015956 | Ga0466959_0015956_3237_4598 | 432 |
| 185 | 3300045049 | Ga0466959_0015961 | Ga0466959_0015961_1414_2775 | 432 |
| 186 | 3300048919 | Ga0496116_0006071 | Ga0496116_0006071_9093_10571 | 432 |
| 187 | 3300048920 | Ga0496117_0000012 | Ga0496117_0000012_492726_494204 | 432 |
| 188 | 3300048921 | Ga0496118_0000051 | Ga0496118_0000051_123842_125320 | 432 |
| 189 | 3300048923 | Ga0496120_0000191 | Ga0496120_0000191_44728_46137 | 432 |
| 190 | 3300048923 | Ga0496120_0001464 | Ga0496120_0001464_786_2264 | 432 |
| 191 | 3300048924 | Ga0496121_0067514 | Ga0496121_0067514_561_1970 | 432 |
| 192 | 3300048928 | Ga0496125_0001779 | Ga0496125_0001779_25183_26661 | 432 |
| 193 | 3300048928 | Ga0496125_0003243 | Ga0496125_0003243_2307_3716 | 432 |
| 194 | 3300053178 | Ga0500637_0081625 | Ga0500637_0081625_237_1631 | 432 |
| 195 | 3300005336 | Ga0070680_100059486 | Ga0070680_1000594864 | 433 |
| 196 | 3300005336 | Ga0070680_100067283 | Ga0070680_1000672833 | 433 |
| 197 | 3300005339 | Ga0070660_100076168 | Ga0070660_1000761683 | 433 |
| 198 | 3300005434 | Ga0070709_10003890 | Ga0070709_100038904 | 433 |
| 199 | 3300005458 | Ga0070681_10000904 | Ga0070681_100009044 | 433 |
| 200 | 3300005458 | Ga0070681_10097974 | Ga0070681_100979743 | 433 |
| 201 | 3300005518 | Ga0070699_100142640 | Ga0070699_1001426402 | 433 |
| 202 | 3300005563 | Ga0068855_100054020 | Ga0068855_1000540204 | 433 |
| 203 | 3300005563 | Ga0068855_100123442 | Ga0068855_1001234423 | 433 |
| 204 | 3300005719 | Ga0068861_100013791 | Ga0068861_1000137915 | 433 |
| 205 | 3300009093 | Ga0105240_10014329 | Ga0105240_100143291 | 433 |
| 206 | 3300009093 | Ga0105240_10022583 | Ga0105240_1002258310 | 433 |
| 207 | 3300009093 | Ga0105240_10102565 | Ga0105240_101025652 | 433 |
| 208 | 3300009093 | Ga0105240_10322203 | Ga0105240_103222032 | 433 |
| 209 | 3300009545 | Ga0105237_10136666 | Ga0105237_101366663 | 433 |
| 210 | 3300009545 | Ga0105237_10172848 | Ga0105237_101728482 | 433 |
| 211 | 3300009551 | Ga0105238_10108337 | Ga0105238_101083374 | 433 |
| 212 | 3300009551 | Ga0105238_10336992 | Ga0105238_103369921 | 433 |
| 213 | 3300013104 | Ga0157370_10006510 | Ga0157370_100065103 | 433 |
| 214 | 3300013105 | Ga0157369_10020627 | Ga0157369_100206276 | 433 |
| 215 | 3300013105 | Ga0157369_10069865 | Ga0157369_100698654 | 433 |
| 216 | 3300013105 | Ga0157369_10203046 | Ga0157369_102030462 | 433 |
| 217 | 3300013307 | Ga0157372_10051928 | Ga0157372_100519282 | 433 |
| 218 | 3300025912 | Ga0207707_10034567 | Ga0207707_100345673 | 433 |
| 219 | 3300025913 | Ga0207695_10011584 | Ga0207695_100115842 | 433 |
| 220 | 3300025913 | Ga0207695_10177488 | Ga0207695_101774882 | 433 |
| 221 | 3300025914 | Ga0207671_10080390 | Ga0207671_100803902 | 433 |
| 222 | 3300025917 | Ga0207660_10137075 | Ga0207660_101370752 | 433 |
| 223 | 3300025917 | Ga0207660_10137321 | Ga0207660_101373211 | 433 |
| 224 | 3300025919 | Ga0207657_10129732 | Ga0207657_101297322 | 433 |
| 225 | 3300025921 | Ga0207652_10028996 | Ga0207652_100289962 | 433 |
| 226 | 3300025921 | Ga0207652_10089843 | Ga0207652_100898433 | 433 |
| 227 | 3300025928 | Ga0207700_10061598 | Ga0207700_100615983 | 433 |
| 228 | 3300025949 | Ga0207667_10007376 | Ga0207667_100073763 | 433 |
| 229 | 3300026118 | Ga0207675_100008209 | Ga0207675_1000082097 | 433 |
| 230 | 3300037418 | Ga0395900_0145249 | Ga0395900_0145249_1008_2402 | 433 |
| 231 | 3300039438 | Ga0436360_0440587 | Ga0436360_0440587_411_1829 | 433 |
| 232 | 3300039438 | Ga0436360_0517698 | Ga0436360_0517698_1202_2695 | 433 |
| 233 | 3300039450 | Ga0436363_0686286 | Ga0436363_0686286_1036_2448 | 433 |
| 234 | 3300046472 | Ga0495580_0014852 | Ga0495580_0014852_2866_4368 | 433 |
| 235 | 3300037466 | Ga0395898_0008541 | Ga0395898_0008541_1611_2996 | 434 |
| 236 | 3300044694 | Ga0466963_0064398 | Ga0466963_0064398_116_1510 | 434 |
| 237 | 3300049588 | Ga0501072_0020846 | Ga0501072_0020846_1521_2948 | 434 |
| 238 | 3300042876 | Ga0451577_0012893 | Ga0451577_0012893_233_1633 | 436 |
| 239 | 3300005458 | Ga0070681_10006554 | Ga0070681_100065545 | 438 |
| 240 | 3300005545 | Ga0070695_100021577 | Ga0070695_1000215772 | 438 |
| 241 | 3300025906 | Ga0207699_10001862 | Ga0207699_100018626 | 438 |
| 242 | 3300025912 | Ga0207707_10021857 | Ga0207707_100218571 | 438 |
| 243 | 3300049583 | Ga0501067_0004732 | Ga0501067_0004732_4773_6110 | 438 |
| 244 | 3300049593 | Ga0501077_0004272 | Ga0501077_0004272_7279_8616 | 438 |
| 245 | 3300049742 | Ga0501080_0078328 | Ga0501080_0078328_601_1938 | 438 |
| 246 | 3300005290 | Ga0065712_10103653 | Ga0065712_101036533 | 439 |
| 247 | 3300005354 | Ga0070675_100004438 | Ga0070675_1000044385 | 439 |
| 248 | 3300005617 | Ga0068859_100115354 | Ga0068859_1001153543 | 439 |
| 249 | 3300006844 | Ga0075428_100007903 | Ga0075428_1000079038 | 439 |
| 250 | 3300006931 | Ga0097620_100115351 | Ga0097620_1001153513 | 439 |
| 251 | 3300009094 | Ga0111539_10004441 | Ga0111539_100044418 | 439 |
| 252 | 3300009094 | Ga0111539_10048637 | Ga0111539_100486373 | 439 |
| 253 | 3300025923 | Ga0207681_10066360 | Ga0207681_100663603 | 439 |
| 254 | 3300027907 | Ga0207428_10044530 | Ga0207428_100445303 | 439 |
| 255 | 3300031731 | Ga0307405_10016005 | Ga0307405_100160053 | 439 |
| 256 | 3300031852 | Ga0307410_10069976 | Ga0307410_100699762 | 439 |
| 257 | 3300031901 | Ga0307406_10052241 | Ga0307406_100522412 | 439 |
| 258 | 3300031911 | Ga0307412_10087170 | Ga0307412_100871701 | 439 |
| 259 | 3300031995 | Ga0307409_100056166 | Ga0307409_1000561663 | 439 |
| 260 | 3300032002 | Ga0307416_100001209 | Ga0307416_1000012098 | 439 |
| 261 | 3300032002 | Ga0307416_100131639 | Ga0307416_1001316393 | 439 |
| 262 | 3300042133 | Ga0450896_000489 | Ga0450896_000489_705_2132 | 439 |
| 263 | 3300042156 | Ga0439446_0010587 | Ga0439446_0010587_905_2251 | 439 |
| 264 | 3300042435 | Ga0439434_0004973 | Ga0439434_0004973_940_2367 | 439 |
| 265 | 3300042436 | Ga0439435_0002114 | Ga0439435_0002114_1347_2774 | 439 |
| 266 | 3300042437 | Ga0439444_0000436 | Ga0439444_0000436_515_1942 | 439 |
| 267 | 3300049569 | Ga0501032_0007943 | Ga0501032_0007943_3505_4932 | 439 |
| 268 | 3300049572 | Ga0501036_0013836 | Ga0501036_0013836_312_1739 | 439 |
| 269 | 3300049575 | Ga0501039_0006731 | Ga0501039_0006731_165_1592 | 439 |
| 270 | 3300049575 | Ga0501039_0106683 | Ga0501039_0106683_463_1803 | 439 |
| 271 | 3300049578 | Ga0501042_0001379 | Ga0501042_0001379_159_1586 | 439 |
| 272 | 3300049582 | Ga0501048_0004714 | Ga0501048_0004714_6201_7628 | 439 |
| 273 | 3300049587 | Ga0501071_0001019 | Ga0501071_0001019_876_2303 | 439 |
| 274 | 3300049587 | Ga0501071_0133441 | Ga0501071_0133441_257_1684 | 439 |
| 275 | 3300049588 | Ga0501072_0018290 | Ga0501072_0018290_10_1437 | 439 |
| 276 | 3300049590 | Ga0501074_0030588 | Ga0501074_0030588_2269_3696 | 439 |
| 277 | 3300049592 | Ga0501076_0049226 | Ga0501076_0049226_1700_3127 | 439 |
| 278 | 3300049741 | Ga0501079_0155469 | Ga0501079_0155469_213_1640 | 439 |
| 279 | 3300049743 | Ga0501081_0045484 | Ga0501081_0045484_261_1688 | 439 |
| 280 | 3300049822 | Ga0501035_0035917 | Ga0501035_0035917_134_1561 | 439 |
| 281 | 3300049823 | Ga0501044_0202789 | Ga0501044_0202789_422_1849 | 439 |
| 282 | 3300050511 | nmdc:mga08y16_84028_c1 | nmdc:mga08y16_84028_c1_104_1459 | 439 |
| 283 | 3300050511 | nmdc:mga08y16_85531_c1 | nmdc:mga08y16_85531_c1_961_2388 | 439 |
| 284 | 3300050512 | nmdc:mga0n895_30856_c1 | nmdc:mga0n895_30856_c1_1568_2923 | 439 |
| 285 | 3300050515 | nmdc:mga0a205_188_c1 | nmdc:mga0a205_188_c1_2356_3711 | 439 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5aa1-assembly2.cif.gz_B | crystal structure of mltf from pseudomonas aeruginosa in complex with nag-anhnam-pentapeptide | 0.8863 | 20 | 423 |
| 5aa2-assembly2.cif.gz_B | crystal structure of mltf from pseudomonas aeruginosa in complex with nam-pentapeptide. | 0.8855 | 20 | 423 |
| 5aa3-assembly8.cif.gz_F | crystal structure of mltf from pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide | 0.8843 | 20 | 424 |
| 5aa4-assembly3.cif.gz_C | crystal structure of mltf from pseudomonas aeruginosa in complex with cell-wall tetrapeptide | 0.8826 | 19 | 424 |
| 5aa2-assembly4.cif.gz_D | crystal structure of mltf from pseudomonas aeruginosa in complex with nam-pentapeptide. | 0.8793 | 20 | 422 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AGC5_272_452_1.10.530.10 | Mainly Alpha;Orthogonal Bundle;Lysozyme; | 0.9619 | 239 | 420 | 1.10.530.10 |
| af_P0AGC5_272_452_1.10.530.10 | Mainly Alpha;Orthogonal Bundle;Lysozyme; | 0.9515 | 239 | 420 | 1.10.530.10 |
| 5a5xB02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9494 | 99 | 193 | 3.40.190.10 |
| 5a5xB02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.93 | 99 | 193 | 3.40.190.10 |
| 5uh0B02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9212 | 100 | 189 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J4YBU9-F1-model_v4 | Transglycosylase SLT domain-containing protein | 0.9786 | 276 | 423 |
|
| AF-A0A855HPH7-F1-model_v4 | deleted | 0.9764 | 258 | 335 |
|
| AF-A0A3D3M775-F1-model_v4 | Lytic transglycosylase | 0.9744 | 260 | 335 |
GO:0000270
GO:0008933 GO:0016020 |
| AF-A0A1X7AHV5-F1-model_v4 | Membrane-bound lytic murein transglycosylase F (EC 4.2.2.-) | 0.9661 | 238 | 424 |
GO:0000270
GO:0008933 GO:0016020 |
| AF-A0A353XBQ9-F1-model_v4 | deleted | 0.9645 | 253 | 335 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar