F386680

General Info

Members Datasets Scaffolds Average Seq Length
285 187 570 327

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100218174|Ga0068857_1002181742
Length 369
Sequence MNAEPSPDRGESTNMDAPNATTSAPVSAVMAGHGHRPVTAGMATMQAIVQDRYGSADVLELADIDRPVPAGDEVLIQVQAAGLHRGDWHVMTGLPYLIRIVVPALGLRKPKTPVLGMDVAGRVEAVGSKVTRFQPGDEVFGWCDGSFAEYASAPEDQLAAKPANLSLEQAAAVPISGFAALQALRDAGQIQAGQKVLVIGAAGAVGSFGVQLAKAFGAQVTGVASTTQAGLVRSAGADEVIDYTRADVTGGSRHWDLIIDTAGRRPLSQLRRALTPNGTLVIVGGEGGGRWTGGFLRNLRAPVLSRFTGQRLRMLASKENQEDLQTLAELLKTGKLTPHIGRTYPLGEVPQAMRALEAGNTRGKIIITI

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
102 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
103 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
108 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
114 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
115 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
116 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
117 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
118 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
167 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
168 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
172 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
176 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
177 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
178 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
179 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
180 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
181 2547132374 Acidovorax radicis N35 Isolate Unclassified
182 2643221575 Microbacterium sp. Root61 Isolate Unclassified
183 2643221717 Acidovorax sp. Root267 Isolate Unclassified
184 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
185 2808606372 Agromyces sp. 23-23 Isolate Unclassified
186 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
187 2919443155 Agromyces sp. 3263 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.33
Metatranscriptomes 1.4
Isolates 5.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.4
Nodule 0
Rhizoplane 7.37
Rhizosphere 87.37
Stem 0
Stem Tuber 0
Unclassified 7.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100218174 3300005577 Bacteria 1742
2 JGI25406J46586_10010201 3300003203 Bacteria 4176
3 rootH1_10066067 3300003316 Bacteria 2823
4 Ga0070683_100396047 3300005329 Unclassified 1317
5 Ga0068869_100017198 3300005334 Bacteria 4895
6 Ga0070682_100212613 3300005337 Unclassified 1371
7 Ga0068868_100286748 3300005338 Bacteria 1395
8 Ga0070668_100210047 3300005347 Bacteria 1601
9 Ga0070709_10131228 3300005434 Bacteria 1711
10 Ga0070713_100131580 3300005436 Bacteria 2207
11 Ga0070713_100168683 3300005436 Bacteria 1959
12 Ga0070701_10115267 3300005438 Bacteria 1507
13 Ga0070705_100022652 3300005440 Bacteria 3360
14 Ga0070694_100010255 3300005444 Bacteria 5771
15 Ga0070663_100048990 3300005455 Bacteria 2998
16 Ga0070663_100316067 3300005455 Unclassified 1254
17 Ga0070707_100005472 3300005468 Bacteria 11872
18 Ga0070697_100030392 3300005536 Unclassified 4340
19 Ga0070672_100164366 3300005543 Bacteria 1843
20 Ga0070695_100101101 3300005545 Bacteria 1942
21 Ga0070665_100455234 3300005548 Bacteria 1289
22 Ga0070704_100175749 3300005549 Bacteria 1708
23 Ga0068854_100186086 3300005578 Bacteria 1625
24 Ga0068856_100235533 3300005614 Bacteria 1846
25 Ga0070702_100102258 3300005615 Bacteria 1760
26 Ga0068852_100276800 3300005616 Unclassified 1616
27 Ga0068861_100048112 3300005719 Bacteria 3222
28 Ga0068863_100078330 3300005841 Bacteria 3130
29 Ga0068858_100169334 3300005842 Bacteria 2059
30 Ga0068860_100016537 3300005843 Bacteria 7195
31 Ga0081455_10021422 3300005937 Bacteria 6063
32 Ga0081455_10101679 3300005937 Unclassified 2306
33 Ga0081538_10001119 3300005981 Bacteria 28423
34 Ga0081538_10010822 3300005981 Bacteria 7448
35 Ga0081538_10022890 3300005981 Bacteria 4509
36 Ga0081540_1046933 3300005983 Bacteria 2176
37 Ga0070717_10190762 3300006028 Bacteria 1791
38 Ga0075365_10028597 3300006038 Bacteria 3556
39 Ga0075363_100035634 3300006048 Bacteria 2606
40 Ga0075428_100323065 3300006844 Unclassified 1658
41 Ga0075433_10009998 3300006852 Bacteria 7602
42 Ga0075434_100221213 3300006871 Bacteria 1913
43 Ga0105251_10123325 3300009011 Unclassified 1176
44 Ga0105240_10290317 3300009093 Bacteria 1875
45 Ga0111539_10009216 3300009094 Bacteria 12471
46 Ga0111539_10077509 3300009094 Bacteria 3912
47 Ga0111539_10109554 3300009094 Bacteria 3241
48 Ga0105245_10052208 3300009098 Bacteria 3667
49 Ga0105245_10153143 3300009098 Bacteria 2182
50 Ga0114129_10001178 3300009147 Bacteria 34683
51 Ga0114129_10007737 3300009147 Bacteria 15290
52 Ga0114129_10025080 3300009147 Bacteria 8450
53 Ga0114129_10056516 3300009147 Bacteria 5496
54 Ga0114129_10338931 3300009147 Bacteria 1995
55 Ga0105243_10034822 3300009148 Bacteria 3901
56 Ga0105243_10198388 3300009148 Bacteria 1758
57 Ga0105243_10255514 3300009148 Unclassified 1567
58 Ga0105243_10295085 3300009148 Bacteria 1467
59 Ga0105243_10394161 3300009148 Bacteria 1284
60 Ga0105241_10121317 3300009174 Bacteria 2105
61 Ga0105242_10001516 3300009176 Bacteria 18253
62 Ga0105242_10255223 3300009176 Bacteria 1582
63 Ga0105237_10108559 3300009545 Bacteria 2766
64 Ga0105237_10217440 3300009545 Bacteria 1911
65 Ga0105238_10322633 3300009551 Bacteria 1530
66 Ga0105249_10002180 3300009553 Bacteria 16962
67 Ga0105249_10128444 3300009553 Bacteria 2417
68 Ga0157370_10116356 3300013104 Bacteria 2498
69 Ga0157369_10140291 3300013105 Bacteria 2558
70 Ga0157374_10435847 3300013296 Bacteria 1310
71 Ga0157378_10030211 3300013297 Bacteria 4787
72 Ga0157378_10336731 3300013297 Bacteria 1470
73 Ga0163162_10006369 3300013306 Bacteria 11429
74 Ga0163162_10066420 3300013306 Bacteria 3656
75 Ga0157372_10090631 3300013307 Bacteria 3476
76 Ga0157375_10201878 3300013308 Bacteria 2144
77 Ga0163163_10101402 3300014325 Bacteria 2901
78 Ga0157380_10113436 3300014326 Bacteria 2282
79 Ga0157379_10470634 3300014968 Bacteria 1162
80 Ga0206354_11078097 3300020081 Bacteria 2853
81 Ga0209025_1003739 3300025294 Bacteria 13952
82 Ga0207692_10071559 3300025898 Bacteria 1829
83 Ga0207699_10076194 3300025906 Bacteria 2065
84 Ga0207699_10116408 3300025906 Unclassified 1721
85 Ga0207693_10124342 3300025915 Bacteria 2027
86 Ga0207660_10238690 3300025917 Bacteria 1431
87 Ga0207687_10123685 3300025927 Bacteria 1939
88 Ga0207687_10227426 3300025927 Bacteria 1472
89 Ga0207664_10018340 3300025929 Bacteria 5149
90 Ga0207686_10080774 3300025934 Bacteria 2120
91 Ga0207665_10159385 3300025939 Bacteria 1622
92 Ga0207689_10072793 3300025942 Bacteria 2823
93 Ga0207667_10234627 3300025949 Bacteria 1878
94 Ga0207667_10253095 3300025949 Bacteria 1802
95 Ga0207712_10363356 3300025961 Bacteria 1207
96 Ga0207712_10648696 3300025961 Bacteria 917
97 Ga0207677_10289577 3300026023 Bacteria 1348
98 Ga0207703_10204298 3300026035 Bacteria 1757
99 Ga0207678_10267304 3300026067 Unclassified 1466
100 Ga0207708_10308077 3300026075 Bacteria 1289
101 Ga0207702_10103283 3300026078 Bacteria 2521
102 Ga0207641_10428908 3300026088 Bacteria 1274
103 Ga0207674_10223608 3300026116 Bacteria 1831
104 Ga0207675_100023676 3300026118 Bacteria 5712
105 Ga0207683_10051579 3300026121 Bacteria 3604
106 Ga0207428_10031210 3300027907 Unclassified 4401
107 Ga0207428_10094319 3300027907 Bacteria 2320
108 Ga0268265_10028723 3300028380 Bacteria 3985
109 Ga0268264_10251093 3300028381 Bacteria 1643
110 Ga0307515_10164498 3300028794 Bacteria 2244
111 Ga0307512_10013486 3300030522 Bacteria 7654
112 Ga0307408_100021115 3300031548 Bacteria 4403
113 Ga0307408_100082781 3300031548 Bacteria 2403
114 Ga0307508_10137367 3300031616 Bacteria 2047
115 Ga0316575_10001301 3300031665 Bacteria 7973
116 Ga0316576_10201992 3300031727 Bacteria 1497
117 Ga0307516_10166690 3300031730 Bacteria 1947
118 Ga0307405_10006455 3300031731 Bacteria 5770
119 Ga0307405_10107817 3300031731 Bacteria 1881
120 Ga0307413_10157918 3300031824 Bacteria 1589
121 Ga0307410_10019448 3300031852 Bacteria 4131
122 Ga0307410_10101160 3300031852 Bacteria 2066
123 Ga0307406_10042706 3300031901 Bacteria 2831
124 Ga0307407_10006684 3300031903 Bacteria 5156
125 Ga0307407_10032721 3300031903 Bacteria 2830
126 Ga0307409_100001831 3300031995 Bacteria 10800
127 Ga0307409_100005296 3300031995 Bacteria 7401
128 Ga0307409_100114495 3300031995 Bacteria 2269
129 Ga0307416_100000496 3300032002 Bacteria 19996
130 Ga0307416_100001727 3300032002 Bacteria 12093
131 Ga0307416_100019730 3300032002 Bacteria 4788
132 Ga0307416_100020446 3300032002 Bacteria 4724
133 Ga0307416_100185265 3300032002 Bacteria 1956
134 Ga0307414_10011295 3300032004 Bacteria 5232
135 Ga0307414_10399773 3300032004 Bacteria 1193
136 Ga0307411_10203005 3300032005 Bacteria 1524
137 Ga0307415_100000271 3300032126 Bacteria 22356
138 Ga0307415_100003639 3300032126 Bacteria 7882
139 Ga0307415_100037194 3300032126 Bacteria 3197
140 Ga0307415_100102672 3300032126 Bacteria 2101
141 Ga0373941_0025734 3300035115 Unclassified 1703
142 Ga0373960_0041741 3300035121 Unclassified 1330
143 Ga0316574_0017957 3300035398 Bacteria 4148
144 Ga0373931_0165183 3300035691 Bacteria 1300
145 Ga0373937_0094197 3300036401 Bacteria 2777
146 Ga0265778_007481 3300036457 Bacteria 1198
147 Ga0316582_0042789 3300036647 Bacteria 2839
148 Ga0316582_0063176 3300036647 Unclassified 2379
149 Ga0316584_0047305 3300036712 Bacteria 3213
150 Ga0395900_0015974 3300037418 Bacteria 7650
151 Ga0395900_0023443 3300037418 Bacteria 6317
152 Ga0395900_0148499 3300037418 Bacteria 2396
153 Ga0395900_0380983 3300037418 Bacteria 1378
154 Ga0395900_0554621 3300037418 Bacteria 1093
155 Ga0395898_0095267 3300037466 Bacteria 2860
156 Ga0395898_0207417 3300037466 Bacteria 1870
157 Ga0395898_0240167 3300037466 Bacteria 1728
158 Ga0395898_0254992 3300037466 Bacteria 1673
159 Ga0395905_0158090 3300037471 Bacteria 2131
160 Ga0395901_0044531 3300038443 Bacteria 4603
161 Ga0395901_0072613 3300038443 Bacteria 3587
162 Ga0400483_009996 3300039062 Bacteria 3510
163 Ga0400483_162689 3300039062 Bacteria 1577
164 Ga0439448_0014546 3300042005 Bacteria 2375
165 Ga0439457_014314 3300042014 Bacteria 1777
166 Ga0439462_0004836 3300042015 Bacteria 3305
167 Ga0439434_0004237 3300042435 Bacteria 4189
168 Ga0439460_0038972 3300042461 Bacteria 1387
169 Ga0451577_0506187 3300042876 Unclassified 1096
170 Ga0453684_0087842 3300044712 Bacteria 3852
171 Ga0453684_0182730 3300044712 Bacteria 2460
172 Ga0466970_0055182 3300044765 Bacteria 2122
173 Ga0451576_0105890 3300045051 Bacteria 2926
174 Ga0495608_0191174 3300046511 Bacteria 1292
175 Ga0495642_0056121 3300046528 Bacteria 1627
176 Ga0495652_0450123 3300046529 Bacteria 902
177 Ga0495656_0015982 3300046615 Bacteria 2842
178 Ga0495613_0080969 3300046689 Bacteria 2360
179 Ga0495674_0263306 3300047319 Bacteria 1416
180 Ga0496100_0103043 3300048903 Bacteria 1970
181 Ga0496100_0155047 3300048903 Bacteria 1637
182 Ga0496102_0054660 3300048905 Bacteria 3641
183 Ga0496102_0473009 3300048905 Bacteria 1174
184 Ga0496102_0534204 3300048905 Bacteria 1095
185 Ga0496104_0115952 3300048907 Bacteria 2570
186 Ga0496104_0207021 3300048907 Unclassified 1873
187 Ga0496104_0303982 3300048907 Unclassified 1507
188 Ga0496105_0063321 3300048908 Bacteria 3051
189 Ga0496105_0164414 3300048908 Bacteria 1821
190 Ga0496105_0312340 3300048908 Bacteria 1261
191 Ga0496106_0010116 3300048909 Bacteria 6966
192 Ga0496106_0161100 3300048909 Bacteria 1774
193 Ga0496108_0145330 3300048911 Bacteria 2044
194 Ga0496108_0261336 3300048911 Unclassified 1506
195 Ga0496109_0032962 3300048912 Bacteria 4660
196 Ga0496109_0188564 3300048912 Bacteria 1937
197 Ga0496110_0348257 3300048913 Unclassified 1349
198 Ga0496111_0185558 3300048914 Bacteria 1546
199 Ga0496112_0098082 3300048915 Bacteria 2900
200 Ga0496115_0116116 3300048918 Bacteria 2201
201 Ga0501031_0006905 3300049568 Bacteria 7409
202 Ga0501031_0080728 3300049568 Bacteria 2120
203 Ga0501034_0000555 3300049571 Bacteria 59252
204 Ga0501034_0347950 3300049571 Bacteria 1411
205 Ga0501036_0004842 3300049572 Bacteria 10874
206 Ga0501038_0121928 3300049574 Bacteria 2149
207 Ga0501038_0181229 3300049574 Bacteria 1699
208 Ga0501039_0009208 3300049575 Bacteria 7525
209 Ga0501039_0159046 3300049575 Bacteria 1775
210 Ga0501039_0215963 3300049575 Bacteria 1508
211 Ga0501040_0016809 3300049576 Bacteria 4851
212 Ga0501040_0043038 3300049576 Bacteria 3077
213 Ga0501041_0025877 3300049577 Bacteria 3528
214 Ga0501041_0042466 3300049577 Bacteria 2763
215 Ga0501041_0056392 3300049577 Bacteria 2400
216 Ga0501042_0012235 3300049578 Bacteria 5806
217 Ga0501042_0166320 3300049578 Bacteria 1591
218 Ga0501046_0057588 3300049580 Bacteria 3048
219 Ga0501048_0093125 3300049582 Bacteria 2125
220 Ga0501048_0111105 3300049582 Bacteria 1935
221 Ga0501070_0091095 3300049586 Bacteria 2524
222 Ga0501070_0192250 3300049586 Bacteria 1677
223 Ga0501070_0361115 3300049586 Bacteria 1178
224 Ga0501071_0154975 3300049587 Bacteria 1710
225 Ga0501072_0022514 3300049588 Bacteria 4887
226 Ga0501072_0141051 3300049588 Bacteria 1921
227 Ga0501074_0013648 3300049590 Bacteria 5905
228 Ga0501075_0005148 3300049591 Bacteria 8942
229 Ga0501075_0005917 3300049591 Bacteria 8367
230 Ga0501076_0004673 3300049592 Bacteria 9764
231 Ga0501076_0005007 3300049592 Bacteria 9483
232 Ga0501076_0063032 3300049592 Bacteria 2953
233 Ga0501076_0146438 3300049592 Bacteria 1920
234 Ga0501077_0026821 3300049593 Bacteria 3657
235 Ga0501079_0015951 3300049741 Bacteria 5741
236 Ga0501081_0019196 3300049743 Bacteria 4549
237 Ga0501081_0116320 3300049743 Bacteria 1901
238 Ga0501083_0035289 3300049744 Bacteria 3417
239 Ga0501035_0025486 3300049822 Bacteria 5421
240 Ga0501035_0177656 3300049822 Bacteria 1836
241 Ga0501045_0001865 3300049824 Bacteria 14267
242 Ga0501045_0003599 3300049824 Bacteria 10646
243 Ga0501045_0022406 3300049824 Bacteria 4523
244 nmdc:mga05p37_108503_c1 3300050507 Bacteria 3415
245 nmdc:mga05p37_1842_c1 3300050507 Bacteria 24712
246 nmdc:mga05p37_367354_c1 3300050507 Bacteria 1690
247 nmdc:mga05p37_69449_c1 3300050507 Bacteria 4333
248 nmdc:mga05p37_90166_c1 3300050507 Bacteria 3779
249 nmdc:mga06r32_319382_c1 3300050510 Bacteria 1538
250 nmdc:mga08y16_273888_c1 3300050511 Bacteria 1742
251 nmdc:mga0n895_21418_c1 3300050512 Bacteria 6045
252 nmdc:mga0n895_251244_c1 3300050512 Bacteria 1794
253 Ga0495612_0006706 3300053078 Bacteria 4718
254 Ga0495619_0040552 3300053085 Bacteria 3044
255 Ga0495619_0117134 3300053085 Bacteria 1824
256 Ga0500594_0006606 3300053118 Bacteria 2610
257 Ga0501084_0010387 3300054114 Bacteria 7699
258 Ga0501084_0270930 3300054114 Bacteria 1433
259 Ga0590071_013531 3300059421 Bacteria 1910
260 Ga0590075_002516 3300059424 Bacteria 4379
261 Ga0587091_018461 3300059511 Bacteria 1187
262 Ga0587114_003915 3300059655 Bacteria 1516
263 Ga0501082_0041976 3300060353 Bacteria 3943
264 Ga0501082_0276226 3300060353 Bacteria 1463
265 Ga0501082_0411362 3300060353 Bacteria 1181
266 Ga0530510_0011512 3300061734 Bacteria 6205
267 Ga0530510_0012301 3300061734 Bacteria 6010
268 Ga0530510_0138246 3300061734 Bacteria 1794
269 Ga0530510_0144921 3300061734 Bacteria 1752
270 Ga0530510_0190607 3300061734 Bacteria 1522
271 2515495783 2515154088 Bacteria 5526283
272 2515497314 2515154088 Bacteria 5526283
273 2515720853 2515154129 Bacteria 5584369
274 2515755599 2515154137 Bacteria 5711575
275 2515758355 2515154137 Bacteria 5711575
276 2516082599 2515154202 Bacteria 5471270
277 2516088045 2515154203 Bacteria 5458536
278 2516091762 2515154203 Bacteria 5458536
279 2548498538 2547132374 Bacteria 5530232
280 2643886932 2643221575 Bacteria 4022601
281 2644649273 2643221717 Bacteria 5676132
282 2676485295 2675903059 Bacteria 8644972
283 2808901323 2808606372 Bacteria 4649509
284 2870722700 2870721527 Bacteria 9689237
285 2919446949 2919443155 Bacteria 4072969
286 Ga0068857_100218174
287 JGI25406J46586_10010201
288 rootH1_10066067
289 Ga0070683_100396047
290 Ga0068869_100017198
291 Ga0070682_100212613
292 Ga0068868_100286748
293 Ga0070668_100210047
294 Ga0070709_10131228
295 Ga0070713_100131580
296 Ga0070713_100168683
297 Ga0070701_10115267
298 Ga0070705_100022652
299 Ga0070694_100010255
300 Ga0070663_100048990
301 Ga0070663_100316067
302 Ga0070707_100005472
303 Ga0070697_100030392
304 Ga0070672_100164366
305 Ga0070695_100101101
306 Ga0070665_100455234
307 Ga0070704_100175749
308 Ga0068854_100186086
309 Ga0068856_100235533
310 Ga0070702_100102258
311 Ga0068852_100276800
312 Ga0068861_100048112
313 Ga0068863_100078330
314 Ga0068858_100169334
315 Ga0068860_100016537
316 Ga0081455_10021422
317 Ga0081455_10101679
318 Ga0081538_10001119
319 Ga0081538_10010822
320 Ga0081538_10022890
321 Ga0081540_1046933
322 Ga0070717_10190762
323 Ga0075365_10028597
324 Ga0075363_100035634
325 Ga0075428_100323065
326 Ga0075433_10009998
327 Ga0075434_100221213
328 Ga0105251_10123325
329 Ga0105240_10290317
330 Ga0111539_10009216
331 Ga0111539_10077509
332 Ga0111539_10109554
333 Ga0105245_10052208
334 Ga0105245_10153143
335 Ga0114129_10001178
336 Ga0114129_10007737
337 Ga0114129_10025080
338 Ga0114129_10056516
339 Ga0114129_10338931
340 Ga0105243_10034822
341 Ga0105243_10198388
342 Ga0105243_10255514
343 Ga0105243_10295085
344 Ga0105243_10394161
345 Ga0105241_10121317
346 Ga0105242_10001516
347 Ga0105242_10255223
348 Ga0105237_10108559
349 Ga0105237_10217440
350 Ga0105238_10322633
351 Ga0105249_10002180
352 Ga0105249_10128444
353 Ga0157370_10116356
354 Ga0157369_10140291
355 Ga0157374_10435847
356 Ga0157378_10030211
357 Ga0157378_10336731
358 Ga0163162_10006369
359 Ga0163162_10066420
360 Ga0157372_10090631
361 Ga0157375_10201878
362 Ga0163163_10101402
363 Ga0157380_10113436
364 Ga0157379_10470634
365 Ga0206354_11078097
366 Ga0209025_1003739
367 Ga0207692_10071559
368 Ga0207699_10076194
369 Ga0207699_10116408
370 Ga0207693_10124342
371 Ga0207660_10238690
372 Ga0207687_10123685
373 Ga0207687_10227426
374 Ga0207664_10018340
375 Ga0207686_10080774
376 Ga0207665_10159385
377 Ga0207689_10072793
378 Ga0207667_10234627
379 Ga0207667_10253095
380 Ga0207712_10363356
381 Ga0207712_10648696
382 Ga0207677_10289577
383 Ga0207703_10204298
384 Ga0207678_10267304
385 Ga0207708_10308077
386 Ga0207702_10103283
387 Ga0207641_10428908
388 Ga0207674_10223608
389 Ga0207675_100023676
390 Ga0207683_10051579
391 Ga0207428_10031210
392 Ga0207428_10094319
393 Ga0268265_10028723
394 Ga0268264_10251093
395 Ga0307515_10164498
396 Ga0307512_10013486
397 Ga0307408_100021115
398 Ga0307408_100082781
399 Ga0307508_10137367
400 Ga0316575_10001301
401 Ga0316576_10201992
402 Ga0307516_10166690
403 Ga0307405_10006455
404 Ga0307405_10107817
405 Ga0307413_10157918
406 Ga0307410_10019448
407 Ga0307410_10101160
408 Ga0307406_10042706
409 Ga0307407_10006684
410 Ga0307407_10032721
411 Ga0307409_100001831
412 Ga0307409_100005296
413 Ga0307409_100114495
414 Ga0307416_100000496
415 Ga0307416_100001727
416 Ga0307416_100019730
417 Ga0307416_100020446
418 Ga0307416_100185265
419 Ga0307414_10011295
420 Ga0307414_10399773
421 Ga0307411_10203005
422 Ga0307415_100000271
423 Ga0307415_100003639
424 Ga0307415_100037194
425 Ga0307415_100102672
426 Ga0373941_0025734
427 Ga0373960_0041741
428 Ga0316574_0017957
429 Ga0373931_0165183
430 Ga0373937_0094197
431 Ga0265778_007481
432 Ga0316582_0042789
433 Ga0316582_0063176
434 Ga0316584_0047305
435 Ga0395900_0015974
436 Ga0395900_0023443
437 Ga0395900_0148499
438 Ga0395900_0380983
439 Ga0395900_0554621
440 Ga0395898_0095267
441 Ga0395898_0207417
442 Ga0395898_0240167
443 Ga0395898_0254992
444 Ga0395905_0158090
445 Ga0395901_0044531
446 Ga0395901_0072613
447 Ga0400483_009996
448 Ga0400483_162689
449 Ga0439448_0014546
450 Ga0439457_014314
451 Ga0439462_0004836
452 Ga0439434_0004237
453 Ga0439460_0038972
454 Ga0451577_0506187
455 Ga0453684_0087842
456 Ga0453684_0182730
457 Ga0466970_0055182
458 Ga0451576_0105890
459 Ga0495608_0191174
460 Ga0495642_0056121
461 Ga0495652_0450123
462 Ga0495656_0015982
463 Ga0495613_0080969
464 Ga0495674_0263306
465 Ga0496100_0103043
466 Ga0496100_0155047
467 Ga0496102_0054660
468 Ga0496102_0473009
469 Ga0496102_0534204
470 Ga0496104_0115952
471 Ga0496104_0207021
472 Ga0496104_0303982
473 Ga0496105_0063321
474 Ga0496105_0164414
475 Ga0496105_0312340
476 Ga0496106_0010116
477 Ga0496106_0161100
478 Ga0496108_0145330
479 Ga0496108_0261336
480 Ga0496109_0032962
481 Ga0496109_0188564
482 Ga0496110_0348257
483 Ga0496111_0185558
484 Ga0496112_0098082
485 Ga0496115_0116116
486 Ga0501031_0006905
487 Ga0501031_0080728
488 Ga0501034_0000555
489 Ga0501034_0347950
490 Ga0501036_0004842
491 Ga0501038_0121928
492 Ga0501038_0181229
493 Ga0501039_0009208
494 Ga0501039_0159046
495 Ga0501039_0215963
496 Ga0501040_0016809
497 Ga0501040_0043038
498 Ga0501041_0025877
499 Ga0501041_0042466
500 Ga0501041_0056392
501 Ga0501042_0012235
502 Ga0501042_0166320
503 Ga0501046_0057588
504 Ga0501048_0093125
505 Ga0501048_0111105
506 Ga0501070_0091095
507 Ga0501070_0192250
508 Ga0501070_0361115
509 Ga0501071_0154975
510 Ga0501072_0022514
511 Ga0501072_0141051
512 Ga0501074_0013648
513 Ga0501075_0005148
514 Ga0501075_0005917
515 Ga0501076_0004673
516 Ga0501076_0005007
517 Ga0501076_0063032
518 Ga0501076_0146438
519 Ga0501077_0026821
520 Ga0501079_0015951
521 Ga0501081_0019196
522 Ga0501081_0116320
523 Ga0501083_0035289
524 Ga0501035_0025486
525 Ga0501035_0177656
526 Ga0501045_0001865
527 Ga0501045_0003599
528 Ga0501045_0022406
529 nmdc:mga05p37_108503_c1
530 nmdc:mga05p37_1842_c1
531 nmdc:mga05p37_367354_c1
532 nmdc:mga05p37_69449_c1
533 nmdc:mga05p37_90166_c1
534 nmdc:mga06r32_319382_c1
535 nmdc:mga08y16_273888_c1
536 nmdc:mga0n895_21418_c1
537 nmdc:mga0n895_251244_c1
538 Ga0495612_0006706
539 Ga0495619_0040552
540 Ga0495619_0117134
541 Ga0500594_0006606
542 Ga0501084_0010387
543 Ga0501084_0270930
544 Ga0590071_013531
545 Ga0590075_002516
546 Ga0587091_018461
547 Ga0587114_003915
548 Ga0501082_0041976
549 Ga0501082_0276226
550 Ga0501082_0411362
551 Ga0530510_0011512
552 Ga0530510_0012301
553 Ga0530510_0138246
554 Ga0530510_0144921
555 Ga0530510_0190607
556 2515495783
557 2515497314
558 2515720853
559 2515755599
560 2515758355
561 2516082599
562 2516088045
563 2516091762
564 2548498538
565 2643886932
566 2644649273
567 2676485295
568 2808901323
569 2870722700
570 2919446949

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

235

367

0.87

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

70

163

0.85

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

204

333

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.9027 21 347
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.8974 21 347
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.8883 21 347
5a4d-assembly5.cif.gz_E crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13kote and nadp 0.8851 23 347
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.8829 21 347
ID Description Score Start End Superfamily
af_Q869N3_132_238_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9295 154 221 3.90.180.10
af_M0R3N4_1_117_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9291 23 146 3.90.180.10
af_B6TXY3_219_333_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9281 167 263 3.90.180.10
af_P28304_1_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9181 23 150 3.90.180.10
af_O45496_9_126_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9159 23 150 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A4Q2JFA4-F1-model_v4 NAD(P)-dependent alcohol dehydrogenase 0.9765 23 204 GO:0003723
GO:0008270
GO:0016491
AF-A0A2H6A3K9-F1-model_v4 Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 (EC 2.3.1.41) 0.9739 23 347 GO:0004315
GO:0016491
AF-A0A538GLC4-F1-model_v4 NAD(P)-dependent alcohol dehydrogenase 0.9728 23 347 GO:0008270
GO:0016491
AF-A0A7T5UUE7-F1-model_v4 NAD(P)-dependent alcohol dehydrogenase 0.9721 23 347 GO:0008270
GO:0016491
AF-A0A538GLC4-F1-model_v4 NAD(P)-dependent alcohol dehydrogenase 0.9699 23 347 GO:0008270
GO:0016491

Map