F386572

General Info

Members Datasets Scaffolds Average Seq Length
285 167 570 298

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10020551|Ga0070658_100205514
Length 321
Sequence MKFRIAAILAAWVLLGGMTHFAFGQSSVLPSSAGQPAVGQPPPDGTAREFTECPDCPLMVGIPAGKFLMGSPAHEPGRFDSEGPQHAVTLKAFALSKYPVTSMEFLTFLNATGYQPQPCNPLLGLGWRQLHRGQAATPTDVEPPRWPAVCLDWKDAEAYIAWINGRARAARPQLGPRNPYRLPSEAEWEYAARAGTRTARWWGEEVGGGHANCNGCGSEWDNKLLGPVEAFERNPFGLSGMLGNAWEWTADCWHPSYVGAPADGRAWTDNFCIRHAIRGGAWNNVPIFVRSAARVAAAENGADQDYDYSTLTGFRVARDLP

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
103 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
130 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
161 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
162 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
163 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
164 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
165 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.51
Nodule 0
Rhizoplane 1.4
Rhizosphere 92.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10020551 3300005327 Bacteria 5292
2 JGI25165J46597_1000013 3300003214 Bacteria 402100
3 Ga0070658_10002358 3300005327 Bacteria 15835
4 Ga0070658_10171062 3300005327 Bacteria 1825
5 Ga0070683_100413179 3300005329 Bacteria 1287
6 Ga0068869_100039912 3300005334 Bacteria 3354
7 Ga0070666_10028849 3300005335 Bacteria 3644
8 Ga0070666_10038453 3300005335 Bacteria 3184
9 Ga0070666_10042682 3300005335 Bacteria 3035
10 Ga0070666_10079281 3300005335 Bacteria 2243
11 Ga0070680_100000100 3300005336 Bacteria 49540
12 Ga0068868_100054858 3300005338 Bacteria 3143
13 Ga0068868_100179553 3300005338 Bacteria 1755
14 Ga0070660_100036654 3300005339 Bacteria 3716
15 Ga0070660_100050835 3300005339 Bacteria 3190
16 Ga0070689_100323693 3300005340 Bacteria 1288
17 Ga0070661_100300099 3300005344 Bacteria 1250
18 Ga0070673_100029135 3300005364 Bacteria 4115
19 Ga0070688_100141877 3300005365 Bacteria 1633
20 Ga0070659_100384791 3300005366 Bacteria 1182
21 Ga0070713_100789455 3300005436 Bacteria 910
22 Ga0070701_10102556 3300005438 Bacteria 1587
23 Ga0070711_100126915 3300005439 Bacteria 1895
24 Ga0070678_100139509 3300005456 Bacteria 1938
25 Ga0070681_10000003 3300005458 Bacteria 252785
26 Ga0070681_10204210 3300005458 Bacteria 1894
27 Ga0068867_100219411 3300005459 Bacteria 1532
28 Ga0070679_100016327 3300005530 Bacteria 7157
29 Ga0070679_100032727 3300005530 Bacteria 5145
30 Ga0070684_100077514 3300005535 Bacteria 2935
31 Ga0068853_100326141 3300005539 Bacteria 1424
32 Ga0068853_100435461 3300005539 Bacteria 1231
33 Ga0070686_100149594 3300005544 Bacteria 1634
34 Ga0070665_100004633 3300005548 Bacteria 14374
35 Ga0070665_100073880 3300005548 Bacteria 3415
36 Ga0070665_100107120 3300005548 Bacteria 2797
37 Ga0070665_100158942 3300005548 Bacteria 2261
38 Ga0070665_100470932 3300005548 Bacteria 1267
39 Ga0068855_100000374 3300005563 Bacteria 55329
40 Ga0068855_100198340 3300005563 Bacteria 2261
41 Ga0070664_100214013 3300005564 Bacteria 1722
42 Ga0068856_100052109 3300005614 Bacteria 4035
43 Ga0068852_100040942 3300005616 Bacteria 3913
44 Ga0068859_100090149 3300005617 Bacteria 3117
45 Ga0068866_10075915 3300005718 Bacteria 1791
46 Ga0068861_100058537 3300005719 Bacteria 2947
47 Ga0068863_100107688 3300005841 Bacteria 2652
48 Ga0068858_100003391 3300005842 Bacteria 15856
49 Ga0068858_100018883 3300005842 Bacteria 6451
50 Ga0068858_100269883 3300005842 Bacteria 1619
51 Ga0068860_100020027 3300005843 Bacteria 6482
52 Ga0068860_100051226 3300005843 Bacteria 3928
53 Ga0068860_100296270 3300005843 Bacteria 1584
54 Ga0068862_100334267 3300005844 Bacteria 1402
55 Ga0070715_10047408 3300006163 Bacteria 1831
56 Ga0097621_100001986 3300006237 Bacteria 13937
57 Ga0097621_100020681 3300006237 Bacteria 5075
58 Ga0097621_100037762 3300006237 Bacteria 3873
59 Ga0097621_100156378 3300006237 Bacteria 1957
60 Ga0097621_100526069 3300006237 Bacteria 1074
61 Ga0068871_100000015 3300006358 Bacteria 97550
62 Ga0068871_100005391 3300006358 Bacteria 8963
63 Ga0068871_100016221 3300006358 Bacteria 5602
64 Ga0068871_100051042 3300006358 Bacteria 3348
65 Ga0068865_100057933 3300006881 Bacteria 2704
66 Ga0097620_100090141 3300006931 Bacteria 3117
67 Ga0105240_10003189 3300009093 Bacteria 25760
68 Ga0105240_10242283 3300009093 Bacteria 2090
69 Ga0105240_10560405 3300009093 Bacteria 1263
70 Ga0105240_10743093 3300009093 Bacteria 1067
71 Ga0105245_10129677 3300009098 Bacteria 2364
72 Ga0105247_10040330 3300009101 Bacteria 2854
73 Ga0105243_10001896 3300009148 Bacteria 17836
74 Ga0105241_10011433 3300009174 Bacteria 6507
75 Ga0105241_10028279 3300009174 Bacteria 4178
76 Ga0105242_10058578 3300009176 Bacteria 3158
77 Ga0105242_10108703 3300009176 Bacteria 2360
78 Ga0105242_10189307 3300009176 Bacteria 1821
79 Ga0105248_10000001 3300009177 Bacteria 1881304
80 Ga0105248_10031525 3300009177 Bacteria 5924
81 Ga0105237_10050097 3300009545 Bacteria 4197
82 Ga0105237_10300294 3300009545 Bacteria 1609
83 Ga0105238_10009423 3300009551 Bacteria 9775
84 Ga0105249_10034930 3300009553 Bacteria 4557
85 Ga0105249_10253971 3300009553 Bacteria 1744
86 Ga0105239_10002986 3300010375 Bacteria 21095
87 Ga0105239_10039762 3300010375 Bacteria 5153
88 Ga0105239_10066060 3300010375 Bacteria 3974
89 Ga0105239_10299828 3300010375 Bacteria 1810
90 Ga0105239_10379355 3300010375 Bacteria 1598
91 Ga0105239_10508115 3300010375 Bacteria 1370
92 Ga0105246_10006542 3300011119 Bacteria 7114
93 Ga0105246_10048881 3300011119 Bacteria 2893
94 Ga0105246_10235802 3300011119 Bacteria 1443
95 Ga0157369_10020687 3300013105 Bacteria 7357
96 Ga0157374_10018703 3300013296 Bacteria 6120
97 Ga0157378_10024486 3300013297 Bacteria 5313
98 Ga0157378_10029572 3300013297 Bacteria 4838
99 Ga0163162_10007474 3300013306 Bacteria 10630
100 Ga0163162_10057244 3300013306 Bacteria 3926
101 Ga0163162_10440567 3300013306 Bacteria 1435
102 Ga0163163_10001131 3300014325 Bacteria 22661
103 Ga0163163_10031603 3300014325 Bacteria 5111
104 Ga0157377_10146790 3300014745 Bacteria 1455
105 Ga0157379_10006585 3300014968 Bacteria 10026
106 Ga0157379_10019029 3300014968 Bacteria 6063
107 Ga0157379_10060573 3300014968 Bacteria 3384
108 Ga0157376_10069335 3300014969 Bacteria 2989
109 Ga0209233_1000013 3300025261 Bacteria 1013785
110 Ga0209758_1000036 3300025297 Bacteria 441671
111 Ga0207710_10046625 3300025900 Bacteria 1935
112 Ga0207688_10048084 3300025901 Bacteria 2383
113 Ga0207680_10013224 3300025903 Bacteria 4232
114 Ga0207680_10028852 3300025903 Bacteria 3109
115 Ga0207680_10050858 3300025903 Bacteria 2475
116 Ga0207685_10069036 3300025905 Bacteria 1426
117 Ga0207645_10146054 3300025907 Bacteria 1542
118 Ga0207643_10122770 3300025908 Bacteria 1540
119 Ga0207705_10000390 3300025909 Bacteria 38824
120 Ga0207705_10308623 3300025909 Bacteria 1214
121 Ga0207654_10020561 3300025911 Bacteria 3501
122 Ga0207654_10145552 3300025911 Bacteria 1516
123 Ga0207654_10316711 3300025911 Bacteria 1065
124 Ga0207707_10000001 3300025912 Bacteria 1212482
125 Ga0207695_10000004 3300025913 Bacteria 1288665
126 Ga0207695_10117135 3300025913 Bacteria 2637
127 Ga0207695_10157118 3300025913 Bacteria 2208
128 Ga0207695_10257704 3300025913 Bacteria 1642
129 Ga0207671_10208061 3300025914 Bacteria 1530
130 Ga0207663_10162524 3300025916 Bacteria 1578
131 Ga0207660_10000077 3300025917 Bacteria 51381
132 Ga0207657_10137041 3300025919 Bacteria 2002
133 Ga0207657_10148024 3300025919 Bacteria 1914
134 Ga0207649_10151215 3300025920 Bacteria 1599
135 Ga0207652_10000413 3300025921 Bacteria 44358
136 Ga0207652_10010655 3300025921 Bacteria 7404
137 Ga0207694_10000044 3300025924 Bacteria 169595
138 Ga0207694_10031490 3300025924 Bacteria 4052
139 Ga0207687_10016053 3300025927 Bacteria 4914
140 Ga0207687_10268678 3300025927 Bacteria 1362
141 Ga0207687_10270552 3300025927 Bacteria 1358
142 Ga0207644_10340522 3300025931 Bacteria 1216
143 Ga0207686_10003116 3300025934 Bacteria 8924
144 Ga0207686_10071506 3300025934 Bacteria 2233
145 Ga0207709_10012978 3300025935 Bacteria 4593
146 Ga0207691_10092363 3300025940 Bacteria 2710
147 Ga0207711_10000001 3300025941 Bacteria 1325674
148 Ga0207711_10040625 3300025941 Bacteria 3958
149 Ga0207689_10016985 3300025942 Bacteria 6158
150 Ga0207689_10038743 3300025942 Bacteria 3946
151 Ga0207679_10067087 3300025945 Bacteria 2691
152 Ga0207667_10000012 3300025949 Bacteria 445492
153 Ga0207651_10071757 3300025960 Bacteria 2456
154 Ga0207712_10112730 3300025961 Bacteria 2043
155 Ga0207712_10200552 3300025961 Bacteria 1582
156 Ga0207677_10032541 3300026023 Bacteria 3354
157 Ga0207703_10037113 3300026035 Bacteria 3881
158 Ga0207703_10071355 3300026035 Bacteria 2869
159 Ga0207703_10140884 3300026035 Bacteria 2092
160 Ga0207639_10444722 3300026041 Bacteria 1176
161 Ga0207702_10071692 3300026078 Bacteria 2984
162 Ga0207702_10105746 3300026078 Bacteria 2493
163 Ga0207648_10014123 3300026089 Bacteria 7385
164 Ga0207674_10054705 3300026116 Bacteria 4062
165 Ga0207675_100177365 3300026118 Bacteria 2039
166 Ga0207683_10002266 3300026121 Bacteria 16865
167 Ga0207698_10001400 3300026142 Bacteria 14007
168 Ga0207698_10012198 3300026142 Bacteria 5612
169 Ga0207698_10030324 3300026142 Bacteria 3887
170 Ga0268266_10002956 3300028379 Bacteria 17530
171 Ga0268266_10004463 3300028379 Bacteria 13380
172 Ga0268266_10030077 3300028379 Bacteria 4614
173 Ga0268266_10148687 3300028379 Bacteria 2109
174 Ga0268264_10045528 3300028381 Bacteria 3642
175 Ga0268264_10062525 3300028381 Bacteria 3126
176 Ga0268264_10101785 3300028381 Bacteria 2498
177 Ga0265334_10028788 3300028573 Bacteria 2229
178 Ga0265318_10000366 3300028577 Bacteria 35708
179 Ga0265338_10001143 3300028800 Bacteria 43898
180 Ga0265330_10039219 3300031235 Bacteria 2105
181 Ga0265325_10000003 3300031241 Bacteria 370490
182 Ga0265325_10005575 3300031241 Bacteria 7764
183 Ga0265329_10004613 3300031242 Bacteria 5698
184 Ga0265340_10005218 3300031247 Bacteria 7214
185 Ga0265340_10032110 3300031247 Bacteria 2623
186 Ga0265339_10001445 3300031249 Bacteria 17619
187 Ga0265339_10001877 3300031249 Bacteria 15427
188 Ga0265331_10004643 3300031250 Bacteria 8517
189 Ga0265331_10012717 3300031250 Bacteria 4549
190 Ga0265316_10155966 3300031344 Bacteria 1708
191 Ga0265316_10156113 3300031344 Bacteria 1708
192 Ga0265316_10235923 3300031344 Bacteria 1346
193 Ga0265313_10002034 3300031595 Bacteria 18144
194 Ga0265313_10008493 3300031595 Bacteria 6809
195 Ga0265314_10000125 3300031711 Bacteria 118671
196 Ga0265314_10010395 3300031711 Bacteria 7766
197 Ga0265314_10019541 3300031711 Bacteria 5247
198 Ga0265314_10082187 3300031711 Bacteria 2120
199 Ga0265314_10157543 3300031711 Bacteria 1385
200 Ga0265342_10005027 3300031712 Bacteria 10200
201 Ga0265342_10041379 3300031712 Bacteria 2791
202 Ga0265342_10057501 3300031712 Bacteria 2302
203 Ga0265342_10107578 3300031712 Bacteria 1582
204 Ga0307516_10036768 3300031730 Bacteria 4899
205 Ga0307516_10139549 3300031730 Bacteria 2195
206 Ga0373933_0053759 3300035724 Bacteria 2412
207 Ga0373937_0086864 3300036401 Bacteria 2894
208 Ga0395900_0149788 3300037418 Bacteria 2384
209 Ga0395898_0023079 3300037466 Bacteria 6292
210 Ga0395901_0138095 3300038443 Bacteria 2562
211 Ga0436365_0002973 3300039437 Bacteria 4853
212 Ga0436365_0834980 3300039437 Bacteria 1206
213 Ga0436361_0882404 3300039447 Bacteria 1356
214 Ga0466963_0188563 3300044694 Bacteria 1441
215 Ga0495628_0242067 3300046516 Bacteria 1349
216 Ga0495628_0511339 3300046516 Bacteria 866
217 Ga0495587_0092264 3300046536 Bacteria 1749
218 Ga0495587_0158599 3300046536 Bacteria 1288
219 Ga0495645_0166935 3300046543 Bacteria 1517
220 Ga0495622_0001953 3300046557 Bacteria 10115
221 Ga0495667_0065746 3300046559 Bacteria 2372
222 Ga0495669_0143687 3300046684 Bacteria 1127
223 Ga0495671_0116073 3300046692 Bacteria 1307
224 Ga0496106_0358494 3300048909 Bacteria 1171
225 Ga0496112_0155831 3300048915 Bacteria 2251
226 Ga0496115_0250057 3300048918 Bacteria 1460
227 Ga0496115_0360964 3300048918 Bacteria 1184
228 Ga0496121_0005260 3300048924 Bacteria 16719
229 Ga0496126_0028151 3300048929 Bacteria 5359
230 Ga0495682_0035295 3300049460 Bacteria 1842
231 Ga0501032_0031010 3300049569 Bacteria 3666
232 Ga0501033_0046984 3300049570 Bacteria 3210
233 Ga0501036_0005174 3300049572 Bacteria 10546
234 Ga0501036_0190470 3300049572 Bacteria 1726
235 Ga0501037_0012993 3300049573 Bacteria 6137
236 Ga0501038_0002891 3300049574 Bacteria 16020
237 Ga0501038_0153771 3300049574 Bacteria 1874
238 Ga0501041_0232957 3300049577 Bacteria 1157
239 Ga0501043_0012341 3300049579 Bacteria 6679
240 Ga0501043_0104600 3300049579 Bacteria 2225
241 Ga0501043_0190414 3300049579 Bacteria 1595
242 Ga0501046_0000911 3300049580 Bacteria 28909
243 Ga0501046_0093367 3300049580 Bacteria 2313
244 Ga0501046_0105594 3300049580 Bacteria 2157
245 Ga0501047_0001266 3300049581 Bacteria 24998
246 Ga0501047_0038539 3300049581 Bacteria 4624
247 Ga0501047_0070932 3300049581 Bacteria 3354
248 Ga0501047_0174133 3300049581 Bacteria 2020
249 Ga0501047_0414248 3300049581 Bacteria 1179
250 Ga0501047_0458334 3300049581 Bacteria 1104
251 Ga0501048_0010119 3300049582 Bacteria 7053
252 Ga0501048_0094364 3300049582 Bacteria 2110
253 Ga0501067_0001068 3300049583 Bacteria 14777
254 Ga0501068_0061777 3300049584 Bacteria 2277
255 Ga0501070_0003063 3300049586 Bacteria 14557
256 Ga0501070_0166698 3300049586 Bacteria 1815
257 Ga0501070_0262607 3300049586 Bacteria 1411
258 Ga0501070_0379020 3300049586 Bacteria 1146
259 Ga0501071_0105686 3300049587 Bacteria 2078
260 Ga0501072_0108736 3300049588 Bacteria 2206
261 Ga0501072_0166873 3300049588 Bacteria 1756
262 Ga0501073_0024808 3300049589 Bacteria 4303
263 Ga0501074_0014452 3300049590 Bacteria 5743
264 Ga0501075_0109084 3300049591 Bacteria 2104
265 Ga0501079_0007469 3300049741 Bacteria 8268
266 Ga0501079_0071384 3300049741 Bacteria 2683
267 Ga0501080_0054967 3300049742 Bacteria 3708
268 Ga0501080_0125578 3300049742 Bacteria 2376
269 Ga0501080_0302409 3300049742 Bacteria 1450
270 Ga0501083_0018792 3300049744 Bacteria 4814
271 Ga0501035_0030502 3300049822 Bacteria 4914
272 Ga0501035_0210683 3300049822 Bacteria 1663
273 Ga0501044_0030817 3300049823 Bacteria 5649
274 Ga0501044_0142050 3300049823 Bacteria 2389
275 Ga0500643_000021 3300053087 Bacteria 284326
276 Ga0500595_000559 3300053119 Bacteria 22205
277 Ga0500595_023943 3300053119 Bacteria 2138
278 Ga0500568_0069351 3300053139 Bacteria 1352
279 Ga0500573_0000033 3300053140 Bacteria 117720
280 Ga0500619_019862 3300053154 Bacteria 1911
281 Ga0500611_014164 3300053727 Bacteria 1385
282 Ga0501084_0000081 3300054114 Bacteria 70009
283 Ga0501084_0101076 3300054114 Bacteria 2421
284 Ga0501084_0158219 3300054114 Bacteria 1911
285 Ga0501082_0018548 3300060353 Bacteria 5996
286 Ga0070658_10020551
287 JGI25165J46597_1000013
288 Ga0070658_10002358
289 Ga0070658_10171062
290 Ga0070683_100413179
291 Ga0068869_100039912
292 Ga0070666_10028849
293 Ga0070666_10038453
294 Ga0070666_10042682
295 Ga0070666_10079281
296 Ga0070680_100000100
297 Ga0068868_100054858
298 Ga0068868_100179553
299 Ga0070660_100036654
300 Ga0070660_100050835
301 Ga0070689_100323693
302 Ga0070661_100300099
303 Ga0070673_100029135
304 Ga0070688_100141877
305 Ga0070659_100384791
306 Ga0070713_100789455
307 Ga0070701_10102556
308 Ga0070711_100126915
309 Ga0070678_100139509
310 Ga0070681_10000003
311 Ga0070681_10204210
312 Ga0068867_100219411
313 Ga0070679_100016327
314 Ga0070679_100032727
315 Ga0070684_100077514
316 Ga0068853_100326141
317 Ga0068853_100435461
318 Ga0070686_100149594
319 Ga0070665_100004633
320 Ga0070665_100073880
321 Ga0070665_100107120
322 Ga0070665_100158942
323 Ga0070665_100470932
324 Ga0068855_100000374
325 Ga0068855_100198340
326 Ga0070664_100214013
327 Ga0068856_100052109
328 Ga0068852_100040942
329 Ga0068859_100090149
330 Ga0068866_10075915
331 Ga0068861_100058537
332 Ga0068863_100107688
333 Ga0068858_100003391
334 Ga0068858_100018883
335 Ga0068858_100269883
336 Ga0068860_100020027
337 Ga0068860_100051226
338 Ga0068860_100296270
339 Ga0068862_100334267
340 Ga0070715_10047408
341 Ga0097621_100001986
342 Ga0097621_100020681
343 Ga0097621_100037762
344 Ga0097621_100156378
345 Ga0097621_100526069
346 Ga0068871_100000015
347 Ga0068871_100005391
348 Ga0068871_100016221
349 Ga0068871_100051042
350 Ga0068865_100057933
351 Ga0097620_100090141
352 Ga0105240_10003189
353 Ga0105240_10242283
354 Ga0105240_10560405
355 Ga0105240_10743093
356 Ga0105245_10129677
357 Ga0105247_10040330
358 Ga0105243_10001896
359 Ga0105241_10011433
360 Ga0105241_10028279
361 Ga0105242_10058578
362 Ga0105242_10108703
363 Ga0105242_10189307
364 Ga0105248_10000001
365 Ga0105248_10031525
366 Ga0105237_10050097
367 Ga0105237_10300294
368 Ga0105238_10009423
369 Ga0105249_10034930
370 Ga0105249_10253971
371 Ga0105239_10002986
372 Ga0105239_10039762
373 Ga0105239_10066060
374 Ga0105239_10299828
375 Ga0105239_10379355
376 Ga0105239_10508115
377 Ga0105246_10006542
378 Ga0105246_10048881
379 Ga0105246_10235802
380 Ga0157369_10020687
381 Ga0157374_10018703
382 Ga0157378_10024486
383 Ga0157378_10029572
384 Ga0163162_10007474
385 Ga0163162_10057244
386 Ga0163162_10440567
387 Ga0163163_10001131
388 Ga0163163_10031603
389 Ga0157377_10146790
390 Ga0157379_10006585
391 Ga0157379_10019029
392 Ga0157379_10060573
393 Ga0157376_10069335
394 Ga0209233_1000013
395 Ga0209758_1000036
396 Ga0207710_10046625
397 Ga0207688_10048084
398 Ga0207680_10013224
399 Ga0207680_10028852
400 Ga0207680_10050858
401 Ga0207685_10069036
402 Ga0207645_10146054
403 Ga0207643_10122770
404 Ga0207705_10000390
405 Ga0207705_10308623
406 Ga0207654_10020561
407 Ga0207654_10145552
408 Ga0207654_10316711
409 Ga0207707_10000001
410 Ga0207695_10000004
411 Ga0207695_10117135
412 Ga0207695_10157118
413 Ga0207695_10257704
414 Ga0207671_10208061
415 Ga0207663_10162524
416 Ga0207660_10000077
417 Ga0207657_10137041
418 Ga0207657_10148024
419 Ga0207649_10151215
420 Ga0207652_10000413
421 Ga0207652_10010655
422 Ga0207694_10000044
423 Ga0207694_10031490
424 Ga0207687_10016053
425 Ga0207687_10268678
426 Ga0207687_10270552
427 Ga0207644_10340522
428 Ga0207686_10003116
429 Ga0207686_10071506
430 Ga0207709_10012978
431 Ga0207691_10092363
432 Ga0207711_10000001
433 Ga0207711_10040625
434 Ga0207689_10016985
435 Ga0207689_10038743
436 Ga0207679_10067087
437 Ga0207667_10000012
438 Ga0207651_10071757
439 Ga0207712_10112730
440 Ga0207712_10200552
441 Ga0207677_10032541
442 Ga0207703_10037113
443 Ga0207703_10071355
444 Ga0207703_10140884
445 Ga0207639_10444722
446 Ga0207702_10071692
447 Ga0207702_10105746
448 Ga0207648_10014123
449 Ga0207674_10054705
450 Ga0207675_100177365
451 Ga0207683_10002266
452 Ga0207698_10001400
453 Ga0207698_10012198
454 Ga0207698_10030324
455 Ga0268266_10002956
456 Ga0268266_10004463
457 Ga0268266_10030077
458 Ga0268266_10148687
459 Ga0268264_10045528
460 Ga0268264_10062525
461 Ga0268264_10101785
462 Ga0265334_10028788
463 Ga0265318_10000366
464 Ga0265338_10001143
465 Ga0265330_10039219
466 Ga0265325_10000003
467 Ga0265325_10005575
468 Ga0265329_10004613
469 Ga0265340_10005218
470 Ga0265340_10032110
471 Ga0265339_10001445
472 Ga0265339_10001877
473 Ga0265331_10004643
474 Ga0265331_10012717
475 Ga0265316_10155966
476 Ga0265316_10156113
477 Ga0265316_10235923
478 Ga0265313_10002034
479 Ga0265313_10008493
480 Ga0265314_10000125
481 Ga0265314_10010395
482 Ga0265314_10019541
483 Ga0265314_10082187
484 Ga0265314_10157543
485 Ga0265342_10005027
486 Ga0265342_10041379
487 Ga0265342_10057501
488 Ga0265342_10107578
489 Ga0307516_10036768
490 Ga0307516_10139549
491 Ga0373933_0053759
492 Ga0373937_0086864
493 Ga0395900_0149788
494 Ga0395898_0023079
495 Ga0395901_0138095
496 Ga0436365_0002973
497 Ga0436365_0834980
498 Ga0436361_0882404
499 Ga0466963_0188563
500 Ga0495628_0242067
501 Ga0495628_0511339
502 Ga0495587_0092264
503 Ga0495587_0158599
504 Ga0495645_0166935
505 Ga0495622_0001953
506 Ga0495667_0065746
507 Ga0495669_0143687
508 Ga0495671_0116073
509 Ga0496106_0358494
510 Ga0496112_0155831
511 Ga0496115_0250057
512 Ga0496115_0360964
513 Ga0496121_0005260
514 Ga0496126_0028151
515 Ga0495682_0035295
516 Ga0501032_0031010
517 Ga0501033_0046984
518 Ga0501036_0005174
519 Ga0501036_0190470
520 Ga0501037_0012993
521 Ga0501038_0002891
522 Ga0501038_0153771
523 Ga0501041_0232957
524 Ga0501043_0012341
525 Ga0501043_0104600
526 Ga0501043_0190414
527 Ga0501046_0000911
528 Ga0501046_0093367
529 Ga0501046_0105594
530 Ga0501047_0001266
531 Ga0501047_0038539
532 Ga0501047_0070932
533 Ga0501047_0174133
534 Ga0501047_0414248
535 Ga0501047_0458334
536 Ga0501048_0010119
537 Ga0501048_0094364
538 Ga0501067_0001068
539 Ga0501068_0061777
540 Ga0501070_0003063
541 Ga0501070_0166698
542 Ga0501070_0262607
543 Ga0501070_0379020
544 Ga0501071_0105686
545 Ga0501072_0108736
546 Ga0501072_0166873
547 Ga0501073_0024808
548 Ga0501074_0014452
549 Ga0501075_0109084
550 Ga0501079_0007469
551 Ga0501079_0071384
552 Ga0501080_0054967
553 Ga0501080_0125578
554 Ga0501080_0302409
555 Ga0501083_0018792
556 Ga0501035_0030502
557 Ga0501035_0210683
558 Ga0501044_0030817
559 Ga0501044_0142050
560 Ga0500643_000021
561 Ga0500595_000559
562 Ga0500595_023943
563 Ga0500568_0069351
564 Ga0500573_0000033
565 Ga0500619_019862
566 Ga0500611_014164
567 Ga0501084_0000081
568 Ga0501084_0101076
569 Ga0501084_0158219
570 Ga0501082_0018548

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03781

FGE-sulfatase

Sulfatase-modifying factor enzyme 1

55

318

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hha-assembly1.cif.gz_A structure of pvdo from pseudomonas aeruginosa 0.7916 23 284
5hha-assembly1.cif.gz_A structure of pvdo from pseudomonas aeruginosa 0.783 23 284
1y1j-assembly1.cif.gz_X human formylglycine generating enzyme, sulfonic acid/desulfurated form 0.7252 37 285
5nyy-assembly1.cif.gz_A formylglycine generating enzyme from t. curvata in complex with cd(ii) 0.7236 37 284
5nxl-assembly1.cif.gz_A formylglycine generating enzyme from t. curvata in complex with ag(i) 0.7204 37 284
ID Description Score Start End Superfamily
af_Q8NBJ7_27_294_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.6555 37 284 3.90.1580.10
af_A0A2R8Q5G7_74_369_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.6526 19 285 3.90.1580.10
af_I6Y8I5_2_297_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.6516 35 285 3.90.1580.10
af_A4I4F2_219_492_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.6428 37 285 3.90.1580.10
2y3cA00 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.64 36 284 3.90.1580.10
ID Description Score Start End GO Terms
AF-A0A7V9MXZ9-F1-model_v4 Formylglycine-generating enzyme family protein 0.9105 17 285 GO:0120147
AF-A0A1Y6C5R8-F1-model_v4 Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain 0.8981 26 285 GO:0120147
AF-A0A846N1T1-F1-model_v4 Formylglycine-generating enzyme required for sulfatase activity 0.8951 17 285 GO:0120147
AF-A0A3D3B3W8-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.8834 18 168 GO:0016020
GO:0120147
AF-A0A357CFP0-F1-model_v4 Formylglycine-generating enzyme family protein 0.8686 17 285 GO:0016020
GO:0120147

Map