F386510

General Info

Members Datasets Scaffolds Average Seq Length
284 235 568 253

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2990059506|2990067377
Length 283
Sequence KLRKVSAAAATALVLALTATACGGDDSTDSGSDSTSTSGGGDKIKVGIKYDQPGLGLKEPDGSFAGFDVDVATYVAKELGYEPDQIEFVETKSADRENALARGDVKFIAATYSINDERAKKVDFAGPYLLAHQDLLVKADSDITKGTDLNGKKLCSVTGSTSAQNVKDSIAPDAQLRENSGYSECLAGLQSGAVDALTTDDSILAGYAAQEQYKGKFKLAGLKLSNENYGIGVKKGDTATVDKINAALEKMVSDGSWETAVKENFGPADYKNEQAPKIGDIVK

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
26 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
39 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
40 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
41 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
42 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
57 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
58 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
59 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
60 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
61 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
62 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
63 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
64 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
65 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
68 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
69 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
70 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
75 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
76 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
77 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
78 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
79 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
80 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
81 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
82 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
83 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
84 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
97 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
101 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
102 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
103 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
104 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
105 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
106 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
107 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
108 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
109 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
110 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
114 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
115 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
116 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
117 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
128 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
136 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
154 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
175 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
176 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
179 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
180 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
181 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
182 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
183 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
184 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
185 2643221548 Streptomyces sp. Root55 Isolate Unclassified
186 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
187 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
188 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
189 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
190 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
191 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
192 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
193 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
194 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
195 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
196 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
197 2808606448 Streptomyces sp. 193411 Isolate Unclassified
198 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
199 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
200 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
201 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
202 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
203 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
204 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
205 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
206 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
207 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
208 2867428634 Streptomyces sp. RP5T Isolate Unclassified
209 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
210 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
211 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
212 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
213 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
214 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
215 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
216 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
217 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
218 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
219 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
220 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
221 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
222 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
223 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
224 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
225 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
226 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
227 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
228 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
229 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
230 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
231 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
232 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
233 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
234 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
235 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.3
Metatranscriptomes 5.63
Isolates 20.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.41
Nodule 0.7
Rhizoplane 3.52
Rhizosphere 80.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10074093 3300003316 Bacteria 1164
2 rootL2_10007699 3300003322 Bacteria 1815
3 rootH1_10012365 3300003323 Bacteria 4331
4 Ga0006562J51391_1028230 3300003578 Bacteria 3390
5 Ga0070658_10080712 3300005327 Bacteria 2672
6 Ga0070682_100140516 3300005337 Bacteria 1645
7 Ga0068868_100166383 3300005338 Bacteria 1824
8 Ga0070675_100057798 3300005354 Bacteria 3198
9 Ga0070671_100226364 3300005355 Bacteria 1587
10 Ga0070674_100302706 3300005356 Bacteria 1275
11 Ga0070673_100243040 3300005364 Bacteria 1566
12 Ga0070663_100124115 3300005455 Bacteria 1954
13 Ga0070678_100036569 3300005456 Bacteria 3438
14 Ga0070681_10277202 3300005458 Bacteria 1588
15 Ga0070672_100274939 3300005543 Bacteria 1423
16 Ga0070665_100115571 3300005548 Bacteria 2686
17 Ga0068852_100056856 3300005616 Bacteria 3383
18 Ga0068859_100487415 3300005617 Bacteria 1328
19 Ga0068864_100450447 3300005618 Bacteria 1231
20 Ga0068861_100294748 3300005719 Bacteria 1402
21 Ga0068870_10028848 3300005840 Bacteria 2790
22 Ga0075365_10119669 3300006038 Bacteria 1816
23 Ga0068865_100078342 3300006881 Bacteria 2364
24 Ga0097620_100487465 3300006931 Bacteria 1328
25 Ga0105251_10012538 3300009011 Bacteria 4791
26 Ga0105247_10092418 3300009101 Bacteria 1922
27 Ga0105242_10011129 3300009176 Bacteria 6913
28 Ga0105248_10244012 3300009177 Bacteria 2022
29 Ga0105238_10442376 3300009551 Bacteria 1296
30 Ga0105249_10054148 3300009553 Bacteria 3668
31 Ga0105239_10281509 3300010375 Bacteria 1872
32 Ga0157372_10207790 3300013307 Bacteria 2269
33 Ga0157375_10148076 3300013308 Bacteria 2480
34 Ga0157375_10507491 3300013308 Bacteria 1370
35 Ga0163163_10108629 3300014325 Bacteria 2801
36 Ga0157380_10030734 3300014326 Bacteria 4115
37 Ga0157377_10104637 3300014745 Bacteria 1692
38 Ga0157376_10145123 3300014969 Bacteria 2134
39 Ga0182007_10000101 3300015262 Bacteria 60723
40 Ga0182005_1007953 3300015265 Bacteria 3151
41 Ga0256744_116826 3300023309 Bacteria 2278
42 Ga0209758_1001388 3300025297 Bacteria 28805
43 Ga0207688_10065678 3300025901 Bacteria 2051
44 Ga0207643_10025094 3300025908 Bacteria 3293
45 Ga0207659_10054636 3300025926 Bacteria 2853
46 Ga0207687_10031183 3300025927 Bacteria 3601
47 Ga0207690_10286661 3300025932 Bacteria 1284
48 Ga0207709_10016811 3300025935 Bacteria 4076
49 Ga0207669_10021422 3300025937 Bacteria 3413
50 Ga0207691_10054341 3300025940 Bacteria 3654
51 Ga0207689_10122222 3300025942 Bacteria 2141
52 Ga0207679_10302063 3300025945 Bacteria 1380
53 Ga0207712_10039143 3300025961 Bacteria 3247
54 Ga0207702_10347652 3300026078 Bacteria 1418
55 Ga0207683_10033671 3300026121 Bacteria 4451
56 Ga0268266_10063503 3300028379 Bacteria 3188
57 Ga0307511_10041492 3300030521 Bacteria 3885
58 Ga0307512_10038666 3300030522 Bacteria 4011
59 Ga0307513_10001846 3300031456 Bacteria 30093
60 Ga0307513_10051446 3300031456 Bacteria 4444
61 Ga0307509_10016625 3300031507 Bacteria 8506
62 Ga0307509_10032120 3300031507 Bacteria 5788
63 Ga0307514_10059142 3300031649 Bacteria 2929
64 Ga0316575_10002887 3300031665 Bacteria 5843
65 Ga0316579_10027948 3300031691 Bacteria 2565
66 Ga0316579_10045644 3300031691 Bacteria 2043
67 Ga0316576_10004801 3300031727 Bacteria 8166
68 Ga0316576_10082904 3300031727 Bacteria 2381
69 Ga0316576_10203168 3300031727 Bacteria 1492
70 Ga0316578_10012598 3300031728 Bacteria 4462
71 Ga0316578_10030466 3300031728 Bacteria 3067
72 Ga0316577_10035711 3300031733 Bacteria 2778
73 Ga0316577_10040203 3300031733 Bacteria 2616
74 Ga0307409_100691494 3300031995 Bacteria 1018
75 Ga0316580_10034592 3300032139 Bacteria 1563
76 Ga0316580_10040446 3300032139 Bacteria 1441
77 Ga0316574_0015790 3300035398 Bacteria 4385
78 Ga0316574_0022533 3300035398 Bacteria 3751
79 Ga0316582_0003584 3300036647 Bacteria 7649
80 Ga0316582_0150991 3300036647 Bacteria 1570
81 Ga0316584_0005984 3300036712 Bacteria 8216
82 Ga0316584_0032006 3300036712 Bacteria 3890
83 Ga0395900_0203788 3300037418 Bacteria 2000
84 Ga0395898_0002082 3300037466 Bacteria 24886
85 Ga0395898_0010040 3300037466 Bacteria 9912
86 Ga0395898_0091532 3300037466 Bacteria 2926
87 Ga0395901_0009564 3300038443 Bacteria 9836
88 Ga0439436_0003651 3300041404 Bacteria 4691
89 Ga0451849_0523916 3300041505 Bacteria 1237
90 Ga0451853_2102678 3300041512 Bacteria 1238
91 Ga0451853_3534725 3300041512 Bacteria 1254
92 Ga0439449_0012635 3300042007 Bacteria 3176
93 Ga0439449_0016124 3300042007 Bacteria 2809
94 Ga0439457_000048 3300042014 Bacteria 25562
95 Ga0439457_015809 3300042014 Bacteria 1684
96 Ga0450894_000141 3300042131 Bacteria 12707
97 Ga0450895_005620 3300042132 Bacteria 1015
98 Ga0450906_000074 3300042145 Bacteria 16060
99 Ga0450908_010635 3300042184 Bacteria 1695
100 Ga0466972_0002269 3300044658 Bacteria 9453
101 Ga0466965_0002388 3300044683 Bacteria 7957
102 Ga0466966_0001585 3300044684 Bacteria 14619
103 Ga0466961_0001910 3300044693 Bacteria 12987
104 Ga0466963_0000490 3300044694 Bacteria 18414
105 Ga0466964_0002925 3300044706 Bacteria 6164
106 Ga0466971_0005827 3300044719 Bacteria 5363
107 Ga0466970_0000076 3300044765 Bacteria 40216
108 Ga0466957_0002290 3300044842 Bacteria 10257
109 Ga0466960_0013772 3300044901 Bacteria 3445
110 Ga0466959_0001263 3300045049 Bacteria 15278
111 Ga0466958_0000368 3300045836 Bacteria 18229
112 Ga0466967_0001563 3300045976 Bacteria 13427
113 Ga0466967_0024355 3300045976 Bacteria 4975
114 Ga0495617_005537 3300046452 Bacteria 4472
115 Ga0495603_0001641 3300046455 Bacteria 13136
116 Ga0495603_0003469 3300046455 Bacteria 9377
117 Ga0495603_0099212 3300046455 Bacteria 1701
118 Ga0495629_0000981 3300046459 Bacteria 22904
119 Ga0495629_0009848 3300046459 Bacteria 6975
120 Ga0495629_0038624 3300046459 Bacteria 3361
121 Ga0495580_0027859 3300046472 Bacteria 4109
122 Ga0495639_0021296 3300046475 Bacteria 2837
123 Ga0495662_0086319 3300046476 Bacteria 1528
124 Ga0495584_0071154 3300046491 Bacteria 1748
125 Ga0495594_0081180 3300046499 Bacteria 1810
126 Ga0495594_0191090 3300046499 Bacteria 1166
127 Ga0495607_0033529 3300046501 Bacteria 3123
128 Ga0495583_0093614 3300046506 Bacteria 1290
129 Ga0495606_0048376 3300046507 Bacteria 2797
130 Ga0495610_0045101 3300046512 Bacteria 2183
131 Ga0495616_0005232 3300046513 Bacteria 8016
132 Ga0495618_0034273 3300046514 Bacteria 3183
133 Ga0495620_0015721 3300046515 Bacteria 3812
134 Ga0495628_0046012 3300046516 Bacteria 3467
135 Ga0495631_0022526 3300046518 Bacteria 2929
136 Ga0495643_0004965 3300046522 Bacteria 9134
137 Ga0495654_0017574 3300046530 Bacteria 3756
138 Ga0495665_0121984 3300046531 Bacteria 1365
139 Ga0495640_0059926 3300046533 Bacteria 2591
140 Ga0495640_0253087 3300046533 Bacteria 1102
141 Ga0495586_0070961 3300046535 Bacteria 1903
142 Ga0495667_0065002 3300046559 Bacteria 2386
143 Ga0495668_0024858 3300046616 Bacteria 3405
144 Ga0495634_0123721 3300046642 Bacteria 1654
145 Ga0495625_0026971 3300046660 Bacteria 4331
146 Ga0495635_0082942 3300046663 Bacteria 2194
147 Ga0495588_0006608 3300046674 Bacteria 5232
148 Ga0495588_0017674 3300046674 Bacteria 3467
149 Ga0495588_0124346 3300046674 Bacteria 1360
150 Ga0495588_0229719 3300046674 Bacteria 979
151 Ga0495646_0074795 3300046680 Bacteria 1987
152 Ga0495658_0409696 3300046683 Bacteria 864
153 Ga0495613_0004441 3300046689 Bacteria 10508
154 Ga0495613_0008044 3300046689 Bacteria 7841
155 Ga0495671_0005359 3300046692 Bacteria 7528
156 Ga0495649_0054052 3300046694 Bacteria 2172
157 Ga0495581_0110408 3300047315 Bacteria 1599
158 Ga0495604_0153781 3300047317 Bacteria 1632
159 Ga0495636_0079983 3300047318 Bacteria 1406
160 Ga0495674_0369278 3300047319 Bacteria 1162
161 Ga0495676_0005917 3300047321 Bacteria 11228
162 Ga0495676_0029930 3300047321 Bacteria 4628
163 Ga0495676_0248335 3300047321 Bacteria 1215
164 Ga0495676_0256976 3300047321 Bacteria 1190
165 Ga0495680_0008687 3300047322 Bacteria 9212
166 Ga0495680_0141340 3300047322 Bacteria 1761
167 Ga0495683_0091573 3300047323 Bacteria 1472
168 Ga0495683_0132098 3300047323 Bacteria 1176
169 Ga0495687_074111 3300047443 Bacteria 1354
170 Ga0495675_0143341 3300047444 Bacteria 1480
171 Ga0495681_0002307 3300047470 Bacteria 13723
172 Ga0495681_0107333 3300047470 Bacteria 1213
173 Ga0495684_0140746 3300047471 Bacteria 1809
174 Ga0495684_0369384 3300047471 Bacteria 1014
175 Ga0495614_0004766 3300048089 Bacteria 6121
176 Ga0495614_0009263 3300048089 Bacteria 4357
177 Ga0496101_0069680 3300048904 Bacteria 2574
178 Ga0496102_0052635 3300048905 Bacteria 3710
179 Ga0496102_0148553 3300048905 Bacteria 2201
180 Ga0496105_0166150 3300048908 Bacteria 1810
181 Ga0496106_0179530 3300048909 Bacteria 1680
182 Ga0496107_0091288 3300048910 Bacteria 2226
183 Ga0496108_0122155 3300048911 Bacteria 2234
184 Ga0496109_0166738 3300048912 Bacteria 2065
185 Ga0496109_0494231 3300048912 Bacteria 1155
186 Ga0496114_0015250 3300048917 Bacteria 6178
187 Ga0501306_000726 3300049127 Bacteria 2722
188 Ga0501308_000251 3300049128 Bacteria 3146
189 Ga0501309_002317 3300049129 Bacteria 2034
190 Ga0501304_000918 3300049160 Bacteria 1739
191 Ga0495678_010858 3300049459 Bacteria 4394
192 Ga0501313_005940 3300049529 Bacteria 1307
193 Ga0501315_000423 3300049531 Bacteria 2881
194 Ga0501315_007067 3300049531 Bacteria 1269
195 Ga0501316_000989 3300049532 Bacteria 2253
196 Ga0501317_000372 3300049533 Bacteria 3034
197 Ga0501318_000283 3300049534 Bacteria 2944
198 Ga0501320_000510 3300049536 Bacteria 2310
199 Ga0501323_000268 3300049539 Bacteria 3524
200 Ga0501033_0005240 3300049570 Bacteria 10293
201 Ga0501033_0049005 3300049570 Bacteria 3136
202 Ga0501033_0283763 3300049570 Bacteria 1168
203 Ga0501034_0004206 3300049571 Bacteria 16072
204 Ga0501036_0000864 3300049572 Bacteria 22539
205 Ga0501036_0046763 3300049572 Bacteria 3664
206 Ga0501037_0070676 3300049573 Bacteria 2540
207 Ga0501038_0009999 3300049574 Bacteria 8685
208 Ga0501038_0018786 3300049574 Bacteria 6238
209 Ga0501039_0068405 3300049575 Bacteria 2757
210 Ga0501043_0001337 3300049579 Bacteria 21589
211 Ga0501043_0096696 3300049579 Bacteria 2321
212 Ga0501073_0136408 3300049589 Bacteria 1701
213 Ga0501074_0005499 3300049590 Bacteria 9114
214 Ga0501035_0012940 3300049822 Bacteria 7701
215 Ga0501035_0049983 3300049822 Bacteria 3748
216 Ga0501044_0000477 3300049823 Bacteria 48715
217 Ga0501044_0009830 3300049823 Bacteria 10398
218 Ga0501044_0015148 3300049823 Bacteria 8309
219 Ga0501044_0097363 3300049823 Bacteria 2963
220 Ga0495595_0049451 3300053084 Bacteria 1945
221 Ga0495619_0038296 3300053085 Bacteria 3128
222 Ga0500560_010339 3300053107 Bacteria 2332
223 Ga0500633_0135529 3300053160 Bacteria 920
224 Ga0587083_0014587 3300059505 Bacteria 1357
225 Ga0587067_021231 3300059640 Bacteria 1119
226 Ga0466962_0000129 3300061719 Bacteria 31015
227 Ga0466962_0010045 3300061719 Bacteria 4542
228 2990067377 2990059506 Bacteria 9321252
229 2547407263 2547132111 Bacteria 8013147
230 2554255885 2554235005 Bacteria 6457341
231 2585297354 2582581312 Bacteria 7308206
232 2616699338 2616644814 Bacteria 11555299
233 2616905076 2616644941 Bacteria 8510691
234 2643761428 2643221548 Bacteria 8053412
235 2643943129 2643221587 Bacteria 7586415
236 2644015470 2643221601 Bacteria 7493239
237 2644177990 2643221631 Bacteria 8168043
238 2644430588 2643221677 Bacteria 7584031
239 2644459170 2643221682 Bacteria 6743283
240 2768646453 2767802112 Bacteria 6465194
241 2784590755 2784132148 Bacteria 8627943
242 2785340800 2784746763 Bacteria 9783172
243 2795787399 2795385470 Bacteria 8317180
244 2804848302 2802429296 Bacteria 7227771
245 2808914046 2808606375 Bacteria 9466072
246 2809234462 2808606448 Bacteria 8656184
247 2811844015 2808606982 Bacteria 7791042
248 2812355557 2811994879 Bacteria 9313447
249 2812478398 2811994917 Bacteria 7761064
250 2819697744 2818991463 Bacteria 7948711
251 2862284217 2862281513 Bacteria 9621493
252 2862387054 2862382967 Bacteria 10317375
253 2862510555 2862507626 Bacteria 9425308
254 2862705914 2862705112 Bacteria 6563286
255 2863409035 2863404153 Bacteria 9672205
256 2867350738 2867346516 Bacteria 7608576
257 2867434476 2867428634 Bacteria 9590268
258 2912717193 2912715099 Bacteria 9460473
259 2912729785 2912723979 Bacteria 8557534
260 2918508087 2918501144 Bacteria 8668083
261 2935391351 2935390628 Bacteria 7043367
262 2946070250 2946064051 Bacteria 8957905
263 2954383583 2954380949 Bacteria 10050426
264 2954694374 2954691527 Bacteria 10720516
265 2954709577 2954701450 Bacteria 10834262
266 2954713880 2954711539 Bacteria 10867210
267 2954723848 2954721474 Bacteria 10456478
268 2954737987 2954731030 Bacteria 10243860
269 2954742748 2954740390 Bacteria 10229294
270 2954756847 2954749733 Bacteria 10366972
271 2954761710 2954759201 Bacteria 9358192
272 2966600475 2966598605 Bacteria 7676064
273 2990049310 2990044586 Bacteria 6603797
274 3001889609 3001889506 Bacteria 2975194
275 3006426160 3006425503 Bacteria 6491253
276 3006493799 3006486233 Bacteria 8157040
277 3006494111 3006493962 Bacteria 8825450
278 8008490174 8008485437 Bacteria 7198341
279 8008563189 8008558824 Bacteria 10610750
280 8008576768 8008574985 Bacteria 7815457
281 8023627642 8023623736 Bacteria 8593882
282 8025419700 8025413630 Bacteria 7014048
283 8025529093 8025524527 Bacteria 7197316
284 8056830109 8056829672 Bacteria 9045328
285 rootH1_10074093
286 rootL2_10007699
287 rootH1_10012365
288 Ga0006562J51391_1028230
289 Ga0070658_10080712
290 Ga0070682_100140516
291 Ga0068868_100166383
292 Ga0070675_100057798
293 Ga0070671_100226364
294 Ga0070674_100302706
295 Ga0070673_100243040
296 Ga0070663_100124115
297 Ga0070678_100036569
298 Ga0070681_10277202
299 Ga0070672_100274939
300 Ga0070665_100115571
301 Ga0068852_100056856
302 Ga0068859_100487415
303 Ga0068864_100450447
304 Ga0068861_100294748
305 Ga0068870_10028848
306 Ga0075365_10119669
307 Ga0068865_100078342
308 Ga0097620_100487465
309 Ga0105251_10012538
310 Ga0105247_10092418
311 Ga0105242_10011129
312 Ga0105248_10244012
313 Ga0105238_10442376
314 Ga0105249_10054148
315 Ga0105239_10281509
316 Ga0157372_10207790
317 Ga0157375_10148076
318 Ga0157375_10507491
319 Ga0163163_10108629
320 Ga0157380_10030734
321 Ga0157377_10104637
322 Ga0157376_10145123
323 Ga0182007_10000101
324 Ga0182005_1007953
325 Ga0256744_116826
326 Ga0209758_1001388
327 Ga0207688_10065678
328 Ga0207643_10025094
329 Ga0207659_10054636
330 Ga0207687_10031183
331 Ga0207690_10286661
332 Ga0207709_10016811
333 Ga0207669_10021422
334 Ga0207691_10054341
335 Ga0207689_10122222
336 Ga0207679_10302063
337 Ga0207712_10039143
338 Ga0207702_10347652
339 Ga0207683_10033671
340 Ga0268266_10063503
341 Ga0307511_10041492
342 Ga0307512_10038666
343 Ga0307513_10001846
344 Ga0307513_10051446
345 Ga0307509_10016625
346 Ga0307509_10032120
347 Ga0307514_10059142
348 Ga0316575_10002887
349 Ga0316579_10027948
350 Ga0316579_10045644
351 Ga0316576_10004801
352 Ga0316576_10082904
353 Ga0316576_10203168
354 Ga0316578_10012598
355 Ga0316578_10030466
356 Ga0316577_10035711
357 Ga0316577_10040203
358 Ga0307409_100691494
359 Ga0316580_10034592
360 Ga0316580_10040446
361 Ga0316574_0015790
362 Ga0316574_0022533
363 Ga0316582_0003584
364 Ga0316582_0150991
365 Ga0316584_0005984
366 Ga0316584_0032006
367 Ga0395900_0203788
368 Ga0395898_0002082
369 Ga0395898_0010040
370 Ga0395898_0091532
371 Ga0395901_0009564
372 Ga0439436_0003651
373 Ga0451849_0523916
374 Ga0451853_2102678
375 Ga0451853_3534725
376 Ga0439449_0012635
377 Ga0439449_0016124
378 Ga0439457_000048
379 Ga0439457_015809
380 Ga0450894_000141
381 Ga0450895_005620
382 Ga0450906_000074
383 Ga0450908_010635
384 Ga0466972_0002269
385 Ga0466965_0002388
386 Ga0466966_0001585
387 Ga0466961_0001910
388 Ga0466963_0000490
389 Ga0466964_0002925
390 Ga0466971_0005827
391 Ga0466970_0000076
392 Ga0466957_0002290
393 Ga0466960_0013772
394 Ga0466959_0001263
395 Ga0466958_0000368
396 Ga0466967_0001563
397 Ga0466967_0024355
398 Ga0495617_005537
399 Ga0495603_0001641
400 Ga0495603_0003469
401 Ga0495603_0099212
402 Ga0495629_0000981
403 Ga0495629_0009848
404 Ga0495629_0038624
405 Ga0495580_0027859
406 Ga0495639_0021296
407 Ga0495662_0086319
408 Ga0495584_0071154
409 Ga0495594_0081180
410 Ga0495594_0191090
411 Ga0495607_0033529
412 Ga0495583_0093614
413 Ga0495606_0048376
414 Ga0495610_0045101
415 Ga0495616_0005232
416 Ga0495618_0034273
417 Ga0495620_0015721
418 Ga0495628_0046012
419 Ga0495631_0022526
420 Ga0495643_0004965
421 Ga0495654_0017574
422 Ga0495665_0121984
423 Ga0495640_0059926
424 Ga0495640_0253087
425 Ga0495586_0070961
426 Ga0495667_0065002
427 Ga0495668_0024858
428 Ga0495634_0123721
429 Ga0495625_0026971
430 Ga0495635_0082942
431 Ga0495588_0006608
432 Ga0495588_0017674
433 Ga0495588_0124346
434 Ga0495588_0229719
435 Ga0495646_0074795
436 Ga0495658_0409696
437 Ga0495613_0004441
438 Ga0495613_0008044
439 Ga0495671_0005359
440 Ga0495649_0054052
441 Ga0495581_0110408
442 Ga0495604_0153781
443 Ga0495636_0079983
444 Ga0495674_0369278
445 Ga0495676_0005917
446 Ga0495676_0029930
447 Ga0495676_0248335
448 Ga0495676_0256976
449 Ga0495680_0008687
450 Ga0495680_0141340
451 Ga0495683_0091573
452 Ga0495683_0132098
453 Ga0495687_074111
454 Ga0495675_0143341
455 Ga0495681_0002307
456 Ga0495681_0107333
457 Ga0495684_0140746
458 Ga0495684_0369384
459 Ga0495614_0004766
460 Ga0495614_0009263
461 Ga0496101_0069680
462 Ga0496102_0052635
463 Ga0496102_0148553
464 Ga0496105_0166150
465 Ga0496106_0179530
466 Ga0496107_0091288
467 Ga0496108_0122155
468 Ga0496109_0166738
469 Ga0496109_0494231
470 Ga0496114_0015250
471 Ga0501306_000726
472 Ga0501308_000251
473 Ga0501309_002317
474 Ga0501304_000918
475 Ga0495678_010858
476 Ga0501313_005940
477 Ga0501315_000423
478 Ga0501315_007067
479 Ga0501316_000989
480 Ga0501317_000372
481 Ga0501318_000283
482 Ga0501320_000510
483 Ga0501323_000268
484 Ga0501033_0005240
485 Ga0501033_0049005
486 Ga0501033_0283763
487 Ga0501034_0004206
488 Ga0501036_0000864
489 Ga0501036_0046763
490 Ga0501037_0070676
491 Ga0501038_0009999
492 Ga0501038_0018786
493 Ga0501039_0068405
494 Ga0501043_0001337
495 Ga0501043_0096696
496 Ga0501073_0136408
497 Ga0501074_0005499
498 Ga0501035_0012940
499 Ga0501035_0049983
500 Ga0501044_0000477
501 Ga0501044_0009830
502 Ga0501044_0015148
503 Ga0501044_0097363
504 Ga0495595_0049451
505 Ga0495619_0038296
506 Ga0500560_010339
507 Ga0500633_0135529
508 Ga0587083_0014587
509 Ga0587067_021231
510 Ga0466962_0000129
511 Ga0466962_0010045
512 2990067377
513 2547407263
514 2554255885
515 2585297354
516 2616699338
517 2616905076
518 2643761428
519 2643943129
520 2644015470
521 2644177990
522 2644430588
523 2644459170
524 2768646453
525 2784590755
526 2785340800
527 2795787399
528 2804848302
529 2808914046
530 2809234462
531 2811844015
532 2812355557
533 2812478398
534 2819697744
535 2862284217
536 2862387054
537 2862510555
538 2862705914
539 2863409035
540 2867350738
541 2867434476
542 2912717193
543 2912729785
544 2918508087
545 2935391351
546 2946070250
547 2954383583
548 2954694374
549 2954709577
550 2954713880
551 2954723848
552 2954737987
553 2954742748
554 2954756847
555 2954761710
556 2966600475
557 2990049310
558 3001889609
559 3006426160
560 3006493799
561 3006494111
562 8008490174
563 8008563189
564 8008576768
565 8023627642
566 8025419700
567 8025529093
568 8056830109

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

44

267

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tuj-assembly1.cif.gz_C ancestral cationic amino acid solute binding protein (anccdt-1) 0.9005 7 224
7a99-assembly1.cif.gz_A crystal structure of the phe57trp mutant of the arginine-bound form of domain 1 from tmargbp 0.8768 9 212
6gpc-assembly1.cif.gz_A crystal structure of the arginine-bound form of domain 1 from tmargbp 0.8753 12 209
5eyf-assembly1.cif.gz_A crystal structure of solute-binding protein from enterococcus faecium with bound glutamate 0.8535 8 235
8ovn-assembly1.cif.gz_A x-ray structure of the sf-iglusnfr-s72a 0.8529 11 225
ID Description Score Start End Superfamily
5eyfB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9139 90 189 3.40.190.10
2q2aA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9135 14 225 3.40.190.10
af_P96257_184_272_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9132 93 178 3.40.190.10
2pyyC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9008 91 183 3.40.190.10
3zsfD02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8974 90 179 3.40.190.10
ID Description Score Start End GO Terms
AF-W2EQT7-F1-model_v4 Solute-binding protein family 3/N-terminal domain-containing protein 0.9367 8 239 GO:0005576
GO:0006865
GO:0016020
GO:0030288
AF-A0A2W2DGY7-F1-model_v4 Solute-binding protein family 3/N-terminal domain-containing protein 0.934 10 240 GO:0005576
GO:0006865
GO:0030288
AF-A0A401YK88-F1-model_v4 non-specific serine/threonine protein kinase (EC 2.7.11.1) 0.9022 10 239 GO:0004676
GO:0004677
GO:0004679
GO:0004711
GO:0005524
GO:0035175
GO:0035402
GO:0035403
GO:0035979
GO:0044022
GO:0044023
GO:0044024
GO:0044025
GO:0072354
GO:0072371
GO:0072518
GO:0140823
GO:0140855
GO:0140857
GO:1990244
AF-A0A2E0ML93-F1-model_v4 deleted 0.9012 9 239
AF-W2EQT7-F1-model_v4 Solute-binding protein family 3/N-terminal domain-containing protein 0.8846 8 239 GO:0005576
GO:0006865
GO:0016020
GO:0030288

Map