F386359

General Info

Members Datasets Scaffolds Average Seq Length
284 152 568 294

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0038247|Ga0466967_0038247_1362_2324
Length 320
Sequence LNFAPVLRTLAALVAAAGLACAAAPASTPTRAIAPGVSASGVALGGLTSERARARLEHAFGRPVTIARGGERTAIAPPRLGAAADVDGAVTAALEAPPGSAVHVRVTHSAGRLATVVAALAKRYDRAPVDAAVTGATLAGRPVFSPARAGLAVDTRAMRSEVARMLTSGNRTPLRLVTHPLAPKRTAATFGPVVVVTRGANRLQLFDGTRLVATFPVATGQAIYPTPAGLWRIVTKQRDPWWYPPTYDEWAKGLQPVPPGPSNPLGTRWMGLDAPGVGIHGTDAPSSIGYSASHGCIRMQVPDAEWLFDHVDVGTPVVIL

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
67 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
68 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
69 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
75 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
76 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
91 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
95 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
105 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
106 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
107 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
108 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
113 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
121 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
131 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 17.96
Rhizosphere 81.34
Stem 0
Stem Tuber 0
Unclassified 8.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0038247 3300045976 Bacteria 4113
2 Ga0070683_100089712 3300005329 Bacteria 2885
3 Ga0070683_100379753 3300005329 Unclassified 1346
4 Ga0070680_100007887 3300005336 Bacteria 8120
5 Ga0070680_100024961 3300005336 Bacteria 4777
6 Ga0070680_100167529 3300005336 Unclassified 1848
7 Ga0070680_100184849 3300005336 Unclassified 1755
8 Ga0070682_100043229 3300005337 Unclassified 2785
9 Ga0070660_100003462 3300005339 Bacteria 10865
10 Ga0070660_100045839 3300005339 Bacteria 3349
11 Ga0070661_100014269 3300005344 Bacteria 5597
12 Ga0070668_100001762 3300005347 Bacteria 15742
13 Ga0070710_10225907 3300005437 Bacteria 1193
14 Ga0070694_100107708 3300005444 Bacteria 1981
15 Ga0070708_100012021 3300005445 Bacteria 7057
16 Ga0070708_100035205 3300005445 Bacteria 4361
17 Ga0070681_10020294 3300005458 Bacteria 6661
18 Ga0070681_10021377 3300005458 Bacteria 6488
19 Ga0070681_10075961 3300005458 Bacteria 3319
20 Ga0070681_10107811 3300005458 Bacteria 2726
21 Ga0070698_100017306 3300005471 Bacteria 7595
22 Ga0070699_100098093 3300005518 Unclassified 2567
23 Ga0070679_100019319 3300005530 Bacteria 6622
24 Ga0070679_100089173 3300005530 Bacteria 3071
25 Ga0070679_100130944 3300005530 Bacteria 2490
26 Ga0070696_100050326 3300005546 Bacteria 2896
27 Ga0070693_100091000 3300005547 Bacteria 1839
28 Ga0070665_100055853 3300005548 Bacteria 3959
29 Ga0070704_100353146 3300005549 Unclassified 1242
30 Ga0068855_100037145 3300005563 Bacteria 5795
31 Ga0068855_100072519 3300005563 Bacteria 4002
32 Ga0068855_100112068 3300005563 Bacteria 3131
33 Ga0068855_100220228 3300005563 Bacteria 2128
34 Ga0068857_100020906 3300005577 Bacteria 5757
35 Ga0068857_100032287 3300005577 Bacteria 4630
36 Ga0068854_100289258 3300005578 Bacteria 1322
37 Ga0068852_100021248 3300005616 Bacteria 5178
38 Ga0068861_100037755 3300005719 Bacteria 3591
39 Ga0070716_100115149 3300006173 Bacteria 1673
40 Ga0097621_100133395 3300006237 Bacteria 2116
41 Ga0075434_100054617 3300006871 Bacteria 3968
42 Ga0075435_100076858 3300007076 Bacteria 2736
43 Ga0105240_10051834 3300009093 Bacteria 5162
44 Ga0105245_10074924 3300009098 Bacteria 3080
45 Ga0105241_10246050 3300009174 Unclassified 1514
46 Ga0105237_10011065 3300009545 Bacteria 9564
47 Ga0105237_10091807 3300009545 Bacteria 3026
48 Ga0105238_10018908 3300009551 Bacteria 7016
49 Ga0105238_10055911 3300009551 Bacteria 3960
50 Ga0105249_10004322 3300009553 Bacteria 12288
51 Ga0105239_10195022 3300010375 Unclassified 2268
52 Ga0157373_10052586 3300013100 Bacteria 2898
53 Ga0157370_10051647 3300013104 Bacteria 3927
54 Ga0157370_10055541 3300013104 Bacteria 3771
55 Ga0157369_10030077 3300013105 Bacteria 5993
56 Ga0157369_10163550 3300013105 Bacteria 2348
57 Ga0157374_10039517 3300013296 Bacteria 4342
58 Ga0157378_10050325 3300013297 Bacteria 3708
59 Ga0163162_10064997 3300013306 Bacteria 3694
60 Ga0157372_10026969 3300013307 Bacteria 6255
61 Ga0157372_10044422 3300013307 Bacteria 4923
62 Ga0157372_10057837 3300013307 Bacteria 4335
63 Ga0157372_10079843 3300013307 Bacteria 3701
64 Ga0157375_10027950 3300013308 Bacteria 5279
65 Ga0157375_10347110 3300013308 Bacteria 1650
66 Ga0157376_10190753 3300014969 Unclassified 1879
67 Ga0163161_10027988 3300017792 Bacteria 4000
68 Ga0206356_10262733 3300020070 Bacteria 1909
69 Ga0206354_11171552 3300020081 Bacteria 1735
70 Ga0207685_10027301 3300025905 Bacteria 1996
71 Ga0207707_10015712 3300025912 Bacteria 6597
72 Ga0207707_10042549 3300025912 Bacteria 3964
73 Ga0207707_10078848 3300025912 Bacteria 2876
74 Ga0207693_10024538 3300025915 Bacteria 4783
75 Ga0207663_10149426 3300025916 Bacteria 1637
76 Ga0207660_10018051 3300025917 Bacteria 4698
77 Ga0207660_10139098 3300025917 Unclassified 1855
78 Ga0207657_10010889 3300025919 Bacteria 9051
79 Ga0207657_10012021 3300025919 Bacteria 8563
80 Ga0207657_10148783 3300025919 Bacteria 1908
81 Ga0207649_10052892 3300025920 Bacteria 2521
82 Ga0207652_10008133 3300025921 Bacteria 8422
83 Ga0207652_10022233 3300025921 Bacteria 5243
84 Ga0207652_10033425 3300025921 Bacteria 4331
85 Ga0207652_10105169 3300025921 Bacteria 2497
86 Ga0207687_10038181 3300025927 Bacteria 3281
87 Ga0207664_10139496 3300025929 Bacteria 2049
88 Ga0207664_10288949 3300025929 Bacteria 1440
89 Ga0207706_10056799 3300025933 Bacteria 3450
90 Ga0207667_10090232 3300025949 Bacteria 3167
91 Ga0207667_10306500 3300025949 Bacteria 1622
92 Ga0207712_10014920 3300025961 Bacteria 5004
93 Ga0207668_10047818 3300025972 Bacteria 2931
94 Ga0207674_10021117 3300026116 Bacteria 7020
95 Ga0207674_10087299 3300026116 Bacteria 3113
96 Ga0207675_100000145 3300026118 Bacteria 61287
97 Ga0268265_10174095 3300028380 Bacteria 1843
98 Ga0265322_10030514 3300028654 Bacteria 1540
99 Ga0265338_10112828 3300028800 Bacteria 2185
100 Ga0265330_10043651 3300031235 Bacteria 1983
101 Ga0265328_10037394 3300031239 Bacteria 1793
102 Ga0265325_10015889 3300031241 Bacteria 4220
103 Ga0265339_10072696 3300031249 Bacteria 1829
104 Ga0265316_10016150 3300031344 Bacteria 6489
105 Ga0265313_10057455 3300031595 Bacteria 1836
106 Ga0265314_10004995 3300031711 Bacteria 12087
107 Ga0265342_10042644 3300031712 Bacteria 2740
108 Ga0373944_0005376 3300035089 Bacteria 3371
109 Ga0373936_0003286 3300035113 Bacteria 6061
110 Ga0373936_0116469 3300035113 Unclassified 1138
111 Ga0373956_0132461 3300035119 Bacteria 1168
112 Ga0373943_0000048 3300035170 Bacteria 41033
113 Ga0373943_0005381 3300035170 Bacteria 5760
114 Ga0373946_0006643 3300035171 Bacteria 4201
115 Ga0373935_0010962 3300035692 Bacteria 5444
116 Ga0373933_0040130 3300035724 Bacteria 2756
117 Ga0373947_0006567 3300035725 Bacteria 6746
118 Ga0373947_0023315 3300035725 Bacteria 3598
119 Ga0373937_0055548 3300036401 Bacteria 3635
120 Ga0373937_0063840 3300036401 Bacteria 3387
121 Ga0373925_0004043 3300037068 Bacteria 11141
122 Ga0395899_0026901 3300037312 Bacteria 4340
123 Ga0395899_0035495 3300037312 Bacteria 3743
124 Ga0395900_0141367 3300037418 Bacteria 2465
125 Ga0395900_0424677 3300037418 Bacteria 1289
126 Ga0395898_0008258 3300037466 Bacteria 11011
127 Ga0395898_0042259 3300037466 Bacteria 4498
128 Ga0395898_0054213 3300037466 Bacteria 3913
129 Ga0395898_0072657 3300037466 Bacteria 3323
130 Ga0395898_0081816 3300037466 Bacteria 3113
131 Ga0395898_0102862 3300037466 Bacteria 2741
132 Ga0395905_0014438 3300037471 Bacteria 7541
133 Ga0395905_0085601 3300037471 Bacteria 2953
134 Ga0395905_0376199 3300037471 Bacteria 1314
135 Ga0395905_0470023 3300037471 Unclassified 1156
136 Ga0395901_0010703 3300038443 Bacteria 9299
137 Ga0395901_0013240 3300038443 Bacteria 8375
138 Ga0395901_0044798 3300038443 Bacteria 4588
139 Ga0395901_0108196 3300038443 Bacteria 2918
140 Ga0395901_0259209 3300038443 Bacteria 1810
141 Ga0436365_0519522 3300039437 Unclassified 2086
142 Ga0436365_1671594 3300039437 Bacteria 1743
143 Ga0439448_0021144 3300042005 Bacteria 2017
144 Ga0439458_0043661 3300042157 Bacteria 1094
145 Ga0466961_0034333 3300044693 Bacteria 3256
146 Ga0466963_0000037 3300044694 Bacteria 42541
147 Ga0466963_0002629 3300044694 Bacteria 10091
148 Ga0466963_0012598 3300044694 Bacteria 5180
149 Ga0466963_0024188 3300044694 Bacteria 3866
150 Ga0466963_0059679 3300044694 Bacteria 2546
151 Ga0466963_0062267 3300044694 Bacteria 2496
152 Ga0466963_0090892 3300044694 Bacteria 2079
153 Ga0466963_0241913 3300044694 Unclassified 1266
154 Ga0466964_0008661 3300044706 Bacteria 3825
155 Ga0466964_0152289 3300044706 Bacteria 1073
156 Ga0466971_0000254 3300044719 Bacteria 20367
157 Ga0466971_0030832 3300044719 Bacteria 2400
158 Ga0466957_0000448 3300044842 Bacteria 20335
159 Ga0466957_0103343 3300044842 Bacteria 1799
160 Ga0466957_0122873 3300044842 Bacteria 1656
161 Ga0466957_0193556 3300044842 Bacteria 1333
162 Ga0466960_0182659 3300044901 Bacteria 1138
163 Ga0466958_0000148 3300045836 Bacteria 24461
164 Ga0466958_0057875 3300045836 Bacteria 2356
165 Ga0466967_0001347 3300045976 Bacteria 14104
166 Ga0466967_0006287 3300045976 Bacteria 8378
167 Ga0466967_0050526 3300045976 Bacteria 3641
168 Ga0466967_0109672 3300045976 Bacteria 2534
169 Ga0466967_0115775 3300045976 Unclassified 2469
170 Ga0466967_0141575 3300045976 Bacteria 2240
171 Ga0466967_0199471 3300045976 Bacteria 1894
172 Ga0466967_0271903 3300045976 Bacteria 1624
173 Ga0466967_0280565 3300045976 Unclassified 1598
174 Ga0495592_0042056 3300046454 Bacteria 3423
175 Ga0495629_0000159 3300046459 Bacteria 59616
176 Ga0495629_0033665 3300046459 Bacteria 3624
177 Ga0495641_0002695 3300046461 Bacteria 13801
178 Ga0495651_0108157 3300046462 Bacteria 2059
179 Ga0495653_0195808 3300046463 Bacteria 1375
180 Ga0495582_0000036 3300046473 Bacteria 71283
181 Ga0495639_0013005 3300046475 Bacteria 3591
182 Ga0495662_0003844 3300046476 Bacteria 7571
183 Ga0495664_0066013 3300046477 Unclassified 2158
184 Ga0495594_0032535 3300046499 Bacteria 2832
185 Ga0495608_0002074 3300046511 Bacteria 14433
186 Ga0495608_0239373 3300046511 Unclassified 1134
187 Ga0495628_0036080 3300046516 Bacteria 3971
188 Ga0495628_0061306 3300046516 Bacteria 2950
189 Ga0495630_0011214 3300046517 Bacteria 6485
190 Ga0495630_0133297 3300046517 Bacteria 1887
191 Ga0495663_0059523 3300046525 Bacteria 1199
192 Ga0495666_0037845 3300046526 Unclassified 2346
193 Ga0495652_0095002 3300046529 Bacteria 2430
194 Ga0495652_0198974 3300046529 Bacteria 1522
195 Ga0495587_0003372 3300046536 Bacteria 10650
196 Ga0495587_0106142 3300046536 Bacteria 1615
197 Ga0495645_0037027 3300046543 Bacteria 3556
198 Ga0495645_0126731 3300046543 Bacteria 1794
199 Ga0495667_0024019 3300046559 Bacteria 4105
200 Ga0495667_0089953 3300046559 Bacteria 1989
201 Ga0495634_0059568 3300046642 Bacteria 2543
202 Ga0495635_0024261 3300046663 Bacteria 4228
203 Ga0495635_0030247 3300046663 Bacteria 3763
204 Ga0495659_0057097 3300046664 Bacteria 1434
205 Ga0495657_0003990 3300046675 Bacteria 11841
206 Ga0495657_0056515 3300046675 Bacteria 2612
207 Ga0495646_0106282 3300046680 Unclassified 1603
208 Ga0495658_0001382 3300046683 Bacteria 12733
209 Ga0495658_0004867 3300046683 Bacteria 6590
210 Ga0495658_0010192 3300046683 Bacteria 4698
211 Ga0495613_0001777 3300046689 Bacteria 16372
212 Ga0495600_0100826 3300046809 Bacteria 1882
213 Ga0495674_0033122 3300047319 Bacteria 4683
214 Ga0495674_0145061 3300047319 Bacteria 1993
215 Ga0495676_0000361 3300047321 Bacteria 37295
216 Ga0495680_0005394 3300047322 Bacteria 12050
217 Ga0495680_0031078 3300047322 Bacteria 4350
218 Ga0495680_0247593 3300047322 Bacteria 1264
219 Ga0495684_0017925 3300047471 Bacteria 5455
220 Ga0495684_0018124 3300047471 Bacteria 5427
221 Ga0495684_0074126 3300047471 Bacteria 2586
222 Ga0495593_0018610 3300047673 Bacteria 3901
223 Ga0495614_0038741 3300048089 Bacteria 2045
224 Ga0496100_0004629 3300048903 Bacteria 7318
225 Ga0496100_0008150 3300048903 Bacteria 5832
226 Ga0496100_0024953 3300048903 Bacteria 3651
227 Ga0496100_0076582 3300048903 Bacteria 2246
228 Ga0496100_0188549 3300048903 Bacteria 1496
229 Ga0496101_0003811 3300048904 Bacteria 9420
230 Ga0496101_0006366 3300048904 Bacteria 7599
231 Ga0496101_0010303 3300048904 Bacteria 6172
232 Ga0496101_0086401 3300048904 Bacteria 2326
233 Ga0496102_0004126 3300048905 Bacteria 12315
234 Ga0496103_0026054 3300048906 Bacteria 3538
235 Ga0496103_0222681 3300048906 Unclassified 1213
236 Ga0496104_0007506 3300048907 Bacteria 9642
237 Ga0496104_0011375 3300048907 Bacteria 7965
238 Ga0496104_0106403 3300048907 Bacteria 2688
239 Ga0496104_0114546 3300048907 Bacteria 2586
240 Ga0496105_0004708 3300048908 Bacteria 10291
241 Ga0496105_0008798 3300048908 Bacteria 7861
242 Ga0496106_0004174 3300048909 Bacteria 10769
243 Ga0496106_0009901 3300048909 Bacteria 7038
244 Ga0496106_0069650 3300048909 Bacteria 2685
245 Ga0496106_0085559 3300048909 Bacteria 2428
246 Ga0496107_0002389 3300048910 Bacteria 12150
247 Ga0496107_0002928 3300048910 Bacteria 11284
248 Ga0496107_0008570 3300048910 Bacteria 7077
249 Ga0496107_0064067 3300048910 Bacteria 2664
250 Ga0496108_0003187 3300048911 Bacteria 13203
251 Ga0496108_0010152 3300048911 Bacteria 7643
252 Ga0496108_0491975 3300048911 Bacteria 1071
253 Ga0496109_0003709 3300048912 Bacteria 12761
254 Ga0496109_0008365 3300048912 Bacteria 8791
255 Ga0496109_0041516 3300048912 Bacteria 4166
256 Ga0496110_0002690 3300048913 Bacteria 13429
257 Ga0496110_0007787 3300048913 Bacteria 8583
258 Ga0496110_0082449 3300048913 Bacteria 2868
259 Ga0496110_0165706 3300048913 Bacteria 2004
260 Ga0496111_0020042 3300048914 Bacteria 4652
261 Ga0496111_0082941 3300048914 Bacteria 2342
262 Ga0496111_0324911 3300048914 Unclassified 1139
263 Ga0496112_0016717 3300048915 Bacteria 6879
264 Ga0496112_0050517 3300048915 Bacteria 4078
265 Ga0496112_0314945 3300048915 Unclassified 1510
266 Ga0496113_0026557 3300048916 Bacteria 4141
267 Ga0496113_0053949 3300048916 Bacteria 3007
268 Ga0496114_0002086 3300048917 Bacteria 15206
269 Ga0496114_0002981 3300048917 Bacteria 12981
270 Ga0496114_0058250 3300048917 Bacteria 3225
271 Ga0496115_0001353 3300048918 Bacteria 17501
272 Ga0496115_0002049 3300048918 Bacteria 14422
273 Ga0496115_0002704 3300048918 Bacteria 12730
274 Ga0496115_0086400 3300048918 Bacteria 2559
275 Ga0501067_0001941 3300049583 Bacteria 11382
276 Ga0501067_0212493 3300049583 Bacteria 1077
277 Ga0501069_0003038 3300049585 Bacteria 8621
278 nmdc:mga0a205_106496_c1 3300050515 Bacteria 2701
279 nmdc:mga0a205_227850_c1 3300050515 Bacteria 1748
280 Ga0495619_0001672 3300053085 Bacteria 14668
281 Ga0495619_0018167 3300053085 Bacteria 4459
282 Ga0466962_0000794 3300061719 Bacteria 14225
283 Ga0466962_0007907 3300061719 Bacteria 5099
284 Ga0466962_0059528 3300061719 Bacteria 1823
285 Ga0466967_0038247
286 Ga0070683_100089712
287 Ga0070683_100379753
288 Ga0070680_100007887
289 Ga0070680_100024961
290 Ga0070680_100167529
291 Ga0070680_100184849
292 Ga0070682_100043229
293 Ga0070660_100003462
294 Ga0070660_100045839
295 Ga0070661_100014269
296 Ga0070668_100001762
297 Ga0070710_10225907
298 Ga0070694_100107708
299 Ga0070708_100012021
300 Ga0070708_100035205
301 Ga0070681_10020294
302 Ga0070681_10021377
303 Ga0070681_10075961
304 Ga0070681_10107811
305 Ga0070698_100017306
306 Ga0070699_100098093
307 Ga0070679_100019319
308 Ga0070679_100089173
309 Ga0070679_100130944
310 Ga0070696_100050326
311 Ga0070693_100091000
312 Ga0070665_100055853
313 Ga0070704_100353146
314 Ga0068855_100037145
315 Ga0068855_100072519
316 Ga0068855_100112068
317 Ga0068855_100220228
318 Ga0068857_100020906
319 Ga0068857_100032287
320 Ga0068854_100289258
321 Ga0068852_100021248
322 Ga0068861_100037755
323 Ga0070716_100115149
324 Ga0097621_100133395
325 Ga0075434_100054617
326 Ga0075435_100076858
327 Ga0105240_10051834
328 Ga0105245_10074924
329 Ga0105241_10246050
330 Ga0105237_10011065
331 Ga0105237_10091807
332 Ga0105238_10018908
333 Ga0105238_10055911
334 Ga0105249_10004322
335 Ga0105239_10195022
336 Ga0157373_10052586
337 Ga0157370_10051647
338 Ga0157370_10055541
339 Ga0157369_10030077
340 Ga0157369_10163550
341 Ga0157374_10039517
342 Ga0157378_10050325
343 Ga0163162_10064997
344 Ga0157372_10026969
345 Ga0157372_10044422
346 Ga0157372_10057837
347 Ga0157372_10079843
348 Ga0157375_10027950
349 Ga0157375_10347110
350 Ga0157376_10190753
351 Ga0163161_10027988
352 Ga0206356_10262733
353 Ga0206354_11171552
354 Ga0207685_10027301
355 Ga0207707_10015712
356 Ga0207707_10042549
357 Ga0207707_10078848
358 Ga0207693_10024538
359 Ga0207663_10149426
360 Ga0207660_10018051
361 Ga0207660_10139098
362 Ga0207657_10010889
363 Ga0207657_10012021
364 Ga0207657_10148783
365 Ga0207649_10052892
366 Ga0207652_10008133
367 Ga0207652_10022233
368 Ga0207652_10033425
369 Ga0207652_10105169
370 Ga0207687_10038181
371 Ga0207664_10139496
372 Ga0207664_10288949
373 Ga0207706_10056799
374 Ga0207667_10090232
375 Ga0207667_10306500
376 Ga0207712_10014920
377 Ga0207668_10047818
378 Ga0207674_10021117
379 Ga0207674_10087299
380 Ga0207675_100000145
381 Ga0268265_10174095
382 Ga0265322_10030514
383 Ga0265338_10112828
384 Ga0265330_10043651
385 Ga0265328_10037394
386 Ga0265325_10015889
387 Ga0265339_10072696
388 Ga0265316_10016150
389 Ga0265313_10057455
390 Ga0265314_10004995
391 Ga0265342_10042644
392 Ga0373944_0005376
393 Ga0373936_0003286
394 Ga0373936_0116469
395 Ga0373956_0132461
396 Ga0373943_0000048
397 Ga0373943_0005381
398 Ga0373946_0006643
399 Ga0373935_0010962
400 Ga0373933_0040130
401 Ga0373947_0006567
402 Ga0373947_0023315
403 Ga0373937_0055548
404 Ga0373937_0063840
405 Ga0373925_0004043
406 Ga0395899_0026901
407 Ga0395899_0035495
408 Ga0395900_0141367
409 Ga0395900_0424677
410 Ga0395898_0008258
411 Ga0395898_0042259
412 Ga0395898_0054213
413 Ga0395898_0072657
414 Ga0395898_0081816
415 Ga0395898_0102862
416 Ga0395905_0014438
417 Ga0395905_0085601
418 Ga0395905_0376199
419 Ga0395905_0470023
420 Ga0395901_0010703
421 Ga0395901_0013240
422 Ga0395901_0044798
423 Ga0395901_0108196
424 Ga0395901_0259209
425 Ga0436365_0519522
426 Ga0436365_1671594
427 Ga0439448_0021144
428 Ga0439458_0043661
429 Ga0466961_0034333
430 Ga0466963_0000037
431 Ga0466963_0002629
432 Ga0466963_0012598
433 Ga0466963_0024188
434 Ga0466963_0059679
435 Ga0466963_0062267
436 Ga0466963_0090892
437 Ga0466963_0241913
438 Ga0466964_0008661
439 Ga0466964_0152289
440 Ga0466971_0000254
441 Ga0466971_0030832
442 Ga0466957_0000448
443 Ga0466957_0103343
444 Ga0466957_0122873
445 Ga0466957_0193556
446 Ga0466960_0182659
447 Ga0466958_0000148
448 Ga0466958_0057875
449 Ga0466967_0001347
450 Ga0466967_0006287
451 Ga0466967_0050526
452 Ga0466967_0109672
453 Ga0466967_0115775
454 Ga0466967_0141575
455 Ga0466967_0199471
456 Ga0466967_0271903
457 Ga0466967_0280565
458 Ga0495592_0042056
459 Ga0495629_0000159
460 Ga0495629_0033665
461 Ga0495641_0002695
462 Ga0495651_0108157
463 Ga0495653_0195808
464 Ga0495582_0000036
465 Ga0495639_0013005
466 Ga0495662_0003844
467 Ga0495664_0066013
468 Ga0495594_0032535
469 Ga0495608_0002074
470 Ga0495608_0239373
471 Ga0495628_0036080
472 Ga0495628_0061306
473 Ga0495630_0011214
474 Ga0495630_0133297
475 Ga0495663_0059523
476 Ga0495666_0037845
477 Ga0495652_0095002
478 Ga0495652_0198974
479 Ga0495587_0003372
480 Ga0495587_0106142
481 Ga0495645_0037027
482 Ga0495645_0126731
483 Ga0495667_0024019
484 Ga0495667_0089953
485 Ga0495634_0059568
486 Ga0495635_0024261
487 Ga0495635_0030247
488 Ga0495659_0057097
489 Ga0495657_0003990
490 Ga0495657_0056515
491 Ga0495646_0106282
492 Ga0495658_0001382
493 Ga0495658_0004867
494 Ga0495658_0010192
495 Ga0495613_0001777
496 Ga0495600_0100826
497 Ga0495674_0033122
498 Ga0495674_0145061
499 Ga0495676_0000361
500 Ga0495680_0005394
501 Ga0495680_0031078
502 Ga0495680_0247593
503 Ga0495684_0017925
504 Ga0495684_0018124
505 Ga0495684_0074126
506 Ga0495593_0018610
507 Ga0495614_0038741
508 Ga0496100_0004629
509 Ga0496100_0008150
510 Ga0496100_0024953
511 Ga0496100_0076582
512 Ga0496100_0188549
513 Ga0496101_0003811
514 Ga0496101_0006366
515 Ga0496101_0010303
516 Ga0496101_0086401
517 Ga0496102_0004126
518 Ga0496103_0026054
519 Ga0496103_0222681
520 Ga0496104_0007506
521 Ga0496104_0011375
522 Ga0496104_0106403
523 Ga0496104_0114546
524 Ga0496105_0004708
525 Ga0496105_0008798
526 Ga0496106_0004174
527 Ga0496106_0009901
528 Ga0496106_0069650
529 Ga0496106_0085559
530 Ga0496107_0002389
531 Ga0496107_0002928
532 Ga0496107_0008570
533 Ga0496107_0064067
534 Ga0496108_0003187
535 Ga0496108_0010152
536 Ga0496108_0491975
537 Ga0496109_0003709
538 Ga0496109_0008365
539 Ga0496109_0041516
540 Ga0496110_0002690
541 Ga0496110_0007787
542 Ga0496110_0082449
543 Ga0496110_0165706
544 Ga0496111_0020042
545 Ga0496111_0082941
546 Ga0496111_0324911
547 Ga0496112_0016717
548 Ga0496112_0050517
549 Ga0496112_0314945
550 Ga0496113_0026557
551 Ga0496113_0053949
552 Ga0496114_0002086
553 Ga0496114_0002981
554 Ga0496114_0058250
555 Ga0496115_0001353
556 Ga0496115_0002049
557 Ga0496115_0002704
558 Ga0496115_0086400
559 Ga0501067_0001941
560 Ga0501067_0212493
561 Ga0501069_0003038
562 nmdc:mga0a205_106496_c1
563 nmdc:mga0a205_227850_c1
564 Ga0495619_0001672
565 Ga0495619_0018167
566 Ga0466962_0000794
567 Ga0466962_0007907
568 Ga0466962_0059528

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03734

YkuD

L,D-transpeptidase catalytic domain

191

319

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bmq-assembly1.cif.gz_A crystal structure of l,d-transpeptidase (yku) from stackebrandtia nassauensis 0.8233 206 338
2j4r-assembly2.cif.gz_B structural study of the aquifex aeolicus ppx-gppa enzyme 0.8101 209 232
3zg4-assembly1.cif.gz_A nmr structure of the catalytic domain from e. faecium l,d- transpeptidase 0.7911 210 338
3zgp-assembly1.cif.gz_A nmr structure of the catalytic domain from e. faecium l,d- transpeptidase acylated by ertapenem 0.7691 209 338
4xxt-assembly1.cif.gz_A crystal structure of fused zn-dependent amidase/peptidase/peptodoglycan-binding domain-containing protein from clostridium acetobutylicum atcc 824 0.7658 210 338
ID Description Score Start End Superfamily
4a1iC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.9393 207 338 2.40.440.10
4a1iC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8856 207 338 2.40.440.10
af_P75954_98_241_2.40.440.10 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8818 210 338 2.40.440.10
5uwvD03 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8632 209 338 2.40.440.10
2ychA03 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8305 207 232 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A7C6Z948-F1-model_v4 L,D-transpeptidase family protein 0.9674 209 338 GO:0005576
GO:0008360
GO:0016757
GO:0018104
GO:0071555
GO:0071972
AF-A0A7C7DP39-F1-model_v4 L,D-transpeptidase family protein 0.9622 209 338 GO:0005576
GO:0008360
GO:0016757
GO:0018104
GO:0071555
GO:0071972
AF-A0A7C6UQT4-F1-model_v4 L,D-transpeptidase 0.9576 209 338 GO:0005576
GO:0008360
GO:0016757
GO:0018104
GO:0071555
GO:0071972
AF-A0A7S7NP37-F1-model_v4 L,D-transpeptidase 0.9572 209 338 GO:0005576
GO:0008360
GO:0016757
GO:0018104
GO:0071555
GO:0071972
AF-A0A2G4H788-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.9555 207 337 GO:0005576
GO:0005975
GO:0008360
GO:0016020
GO:0016757
GO:0018104
GO:0071555
GO:0071972

Map