F386359
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 284 | 152 | 568 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0038247|Ga0466967_0038247_1362_2324 |
| Length | 320 |
| Sequence | LNFAPVLRTLAALVAAAGLACAAAPASTPTRAIAPGVSASGVALGGLTSERARARLEHAFGRPVTIARGGERTAIAPPRLGAAADVDGAVTAALEAPPGSAVHVRVTHSAGRLATVVAALAKRYDRAPVDAAVTGATLAGRPVFSPARAGLAVDTRAMRSEVARMLTSGNRTPLRLVTHPLAPKRTAATFGPVVVVTRGANRLQLFDGTRLVATFPVATGQAIYPTPAGLWRIVTKQRDPWWYPPTYDEWAKGLQPVPPGPSNPLGTRWMGLDAPGVGIHGTDAPSSIGYSASHGCIRMQVPDAEWLFDHVDVGTPVVIL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 20 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 21 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 22 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 23 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 24 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 27 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 28 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 46 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 47 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 65 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 66 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 67 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 68 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 69 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 70 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 71 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 72 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 73 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 74 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 75 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 76 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 77 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 78 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 79 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 80 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 81 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 82 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 83 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 84 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 85 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 86 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 87 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 88 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 89 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 90 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 91 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 92 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 93 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 94 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 95 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 96 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 97 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 98 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 99 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 135 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 136 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 137 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 138 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 139 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 140 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 143 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 144 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 145 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 146 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 147 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 148 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.3 |
| Metatranscriptomes | 0.7 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 17.96 |
| Rhizosphere | 81.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466967_0038247 | 3300045976 | Bacteria | 4113 |
| 2 | Ga0070683_100089712 | 3300005329 | Bacteria | 2885 |
| 3 | Ga0070683_100379753 | 3300005329 | Unclassified | 1346 |
| 4 | Ga0070680_100007887 | 3300005336 | Bacteria | 8120 |
| 5 | Ga0070680_100024961 | 3300005336 | Bacteria | 4777 |
| 6 | Ga0070680_100167529 | 3300005336 | Unclassified | 1848 |
| 7 | Ga0070680_100184849 | 3300005336 | Unclassified | 1755 |
| 8 | Ga0070682_100043229 | 3300005337 | Unclassified | 2785 |
| 9 | Ga0070660_100003462 | 3300005339 | Bacteria | 10865 |
| 10 | Ga0070660_100045839 | 3300005339 | Bacteria | 3349 |
| 11 | Ga0070661_100014269 | 3300005344 | Bacteria | 5597 |
| 12 | Ga0070668_100001762 | 3300005347 | Bacteria | 15742 |
| 13 | Ga0070710_10225907 | 3300005437 | Bacteria | 1193 |
| 14 | Ga0070694_100107708 | 3300005444 | Bacteria | 1981 |
| 15 | Ga0070708_100012021 | 3300005445 | Bacteria | 7057 |
| 16 | Ga0070708_100035205 | 3300005445 | Bacteria | 4361 |
| 17 | Ga0070681_10020294 | 3300005458 | Bacteria | 6661 |
| 18 | Ga0070681_10021377 | 3300005458 | Bacteria | 6488 |
| 19 | Ga0070681_10075961 | 3300005458 | Bacteria | 3319 |
| 20 | Ga0070681_10107811 | 3300005458 | Bacteria | 2726 |
| 21 | Ga0070698_100017306 | 3300005471 | Bacteria | 7595 |
| 22 | Ga0070699_100098093 | 3300005518 | Unclassified | 2567 |
| 23 | Ga0070679_100019319 | 3300005530 | Bacteria | 6622 |
| 24 | Ga0070679_100089173 | 3300005530 | Bacteria | 3071 |
| 25 | Ga0070679_100130944 | 3300005530 | Bacteria | 2490 |
| 26 | Ga0070696_100050326 | 3300005546 | Bacteria | 2896 |
| 27 | Ga0070693_100091000 | 3300005547 | Bacteria | 1839 |
| 28 | Ga0070665_100055853 | 3300005548 | Bacteria | 3959 |
| 29 | Ga0070704_100353146 | 3300005549 | Unclassified | 1242 |
| 30 | Ga0068855_100037145 | 3300005563 | Bacteria | 5795 |
| 31 | Ga0068855_100072519 | 3300005563 | Bacteria | 4002 |
| 32 | Ga0068855_100112068 | 3300005563 | Bacteria | 3131 |
| 33 | Ga0068855_100220228 | 3300005563 | Bacteria | 2128 |
| 34 | Ga0068857_100020906 | 3300005577 | Bacteria | 5757 |
| 35 | Ga0068857_100032287 | 3300005577 | Bacteria | 4630 |
| 36 | Ga0068854_100289258 | 3300005578 | Bacteria | 1322 |
| 37 | Ga0068852_100021248 | 3300005616 | Bacteria | 5178 |
| 38 | Ga0068861_100037755 | 3300005719 | Bacteria | 3591 |
| 39 | Ga0070716_100115149 | 3300006173 | Bacteria | 1673 |
| 40 | Ga0097621_100133395 | 3300006237 | Bacteria | 2116 |
| 41 | Ga0075434_100054617 | 3300006871 | Bacteria | 3968 |
| 42 | Ga0075435_100076858 | 3300007076 | Bacteria | 2736 |
| 43 | Ga0105240_10051834 | 3300009093 | Bacteria | 5162 |
| 44 | Ga0105245_10074924 | 3300009098 | Bacteria | 3080 |
| 45 | Ga0105241_10246050 | 3300009174 | Unclassified | 1514 |
| 46 | Ga0105237_10011065 | 3300009545 | Bacteria | 9564 |
| 47 | Ga0105237_10091807 | 3300009545 | Bacteria | 3026 |
| 48 | Ga0105238_10018908 | 3300009551 | Bacteria | 7016 |
| 49 | Ga0105238_10055911 | 3300009551 | Bacteria | 3960 |
| 50 | Ga0105249_10004322 | 3300009553 | Bacteria | 12288 |
| 51 | Ga0105239_10195022 | 3300010375 | Unclassified | 2268 |
| 52 | Ga0157373_10052586 | 3300013100 | Bacteria | 2898 |
| 53 | Ga0157370_10051647 | 3300013104 | Bacteria | 3927 |
| 54 | Ga0157370_10055541 | 3300013104 | Bacteria | 3771 |
| 55 | Ga0157369_10030077 | 3300013105 | Bacteria | 5993 |
| 56 | Ga0157369_10163550 | 3300013105 | Bacteria | 2348 |
| 57 | Ga0157374_10039517 | 3300013296 | Bacteria | 4342 |
| 58 | Ga0157378_10050325 | 3300013297 | Bacteria | 3708 |
| 59 | Ga0163162_10064997 | 3300013306 | Bacteria | 3694 |
| 60 | Ga0157372_10026969 | 3300013307 | Bacteria | 6255 |
| 61 | Ga0157372_10044422 | 3300013307 | Bacteria | 4923 |
| 62 | Ga0157372_10057837 | 3300013307 | Bacteria | 4335 |
| 63 | Ga0157372_10079843 | 3300013307 | Bacteria | 3701 |
| 64 | Ga0157375_10027950 | 3300013308 | Bacteria | 5279 |
| 65 | Ga0157375_10347110 | 3300013308 | Bacteria | 1650 |
| 66 | Ga0157376_10190753 | 3300014969 | Unclassified | 1879 |
| 67 | Ga0163161_10027988 | 3300017792 | Bacteria | 4000 |
| 68 | Ga0206356_10262733 | 3300020070 | Bacteria | 1909 |
| 69 | Ga0206354_11171552 | 3300020081 | Bacteria | 1735 |
| 70 | Ga0207685_10027301 | 3300025905 | Bacteria | 1996 |
| 71 | Ga0207707_10015712 | 3300025912 | Bacteria | 6597 |
| 72 | Ga0207707_10042549 | 3300025912 | Bacteria | 3964 |
| 73 | Ga0207707_10078848 | 3300025912 | Bacteria | 2876 |
| 74 | Ga0207693_10024538 | 3300025915 | Bacteria | 4783 |
| 75 | Ga0207663_10149426 | 3300025916 | Bacteria | 1637 |
| 76 | Ga0207660_10018051 | 3300025917 | Bacteria | 4698 |
| 77 | Ga0207660_10139098 | 3300025917 | Unclassified | 1855 |
| 78 | Ga0207657_10010889 | 3300025919 | Bacteria | 9051 |
| 79 | Ga0207657_10012021 | 3300025919 | Bacteria | 8563 |
| 80 | Ga0207657_10148783 | 3300025919 | Bacteria | 1908 |
| 81 | Ga0207649_10052892 | 3300025920 | Bacteria | 2521 |
| 82 | Ga0207652_10008133 | 3300025921 | Bacteria | 8422 |
| 83 | Ga0207652_10022233 | 3300025921 | Bacteria | 5243 |
| 84 | Ga0207652_10033425 | 3300025921 | Bacteria | 4331 |
| 85 | Ga0207652_10105169 | 3300025921 | Bacteria | 2497 |
| 86 | Ga0207687_10038181 | 3300025927 | Bacteria | 3281 |
| 87 | Ga0207664_10139496 | 3300025929 | Bacteria | 2049 |
| 88 | Ga0207664_10288949 | 3300025929 | Bacteria | 1440 |
| 89 | Ga0207706_10056799 | 3300025933 | Bacteria | 3450 |
| 90 | Ga0207667_10090232 | 3300025949 | Bacteria | 3167 |
| 91 | Ga0207667_10306500 | 3300025949 | Bacteria | 1622 |
| 92 | Ga0207712_10014920 | 3300025961 | Bacteria | 5004 |
| 93 | Ga0207668_10047818 | 3300025972 | Bacteria | 2931 |
| 94 | Ga0207674_10021117 | 3300026116 | Bacteria | 7020 |
| 95 | Ga0207674_10087299 | 3300026116 | Bacteria | 3113 |
| 96 | Ga0207675_100000145 | 3300026118 | Bacteria | 61287 |
| 97 | Ga0268265_10174095 | 3300028380 | Bacteria | 1843 |
| 98 | Ga0265322_10030514 | 3300028654 | Bacteria | 1540 |
| 99 | Ga0265338_10112828 | 3300028800 | Bacteria | 2185 |
| 100 | Ga0265330_10043651 | 3300031235 | Bacteria | 1983 |
| 101 | Ga0265328_10037394 | 3300031239 | Bacteria | 1793 |
| 102 | Ga0265325_10015889 | 3300031241 | Bacteria | 4220 |
| 103 | Ga0265339_10072696 | 3300031249 | Bacteria | 1829 |
| 104 | Ga0265316_10016150 | 3300031344 | Bacteria | 6489 |
| 105 | Ga0265313_10057455 | 3300031595 | Bacteria | 1836 |
| 106 | Ga0265314_10004995 | 3300031711 | Bacteria | 12087 |
| 107 | Ga0265342_10042644 | 3300031712 | Bacteria | 2740 |
| 108 | Ga0373944_0005376 | 3300035089 | Bacteria | 3371 |
| 109 | Ga0373936_0003286 | 3300035113 | Bacteria | 6061 |
| 110 | Ga0373936_0116469 | 3300035113 | Unclassified | 1138 |
| 111 | Ga0373956_0132461 | 3300035119 | Bacteria | 1168 |
| 112 | Ga0373943_0000048 | 3300035170 | Bacteria | 41033 |
| 113 | Ga0373943_0005381 | 3300035170 | Bacteria | 5760 |
| 114 | Ga0373946_0006643 | 3300035171 | Bacteria | 4201 |
| 115 | Ga0373935_0010962 | 3300035692 | Bacteria | 5444 |
| 116 | Ga0373933_0040130 | 3300035724 | Bacteria | 2756 |
| 117 | Ga0373947_0006567 | 3300035725 | Bacteria | 6746 |
| 118 | Ga0373947_0023315 | 3300035725 | Bacteria | 3598 |
| 119 | Ga0373937_0055548 | 3300036401 | Bacteria | 3635 |
| 120 | Ga0373937_0063840 | 3300036401 | Bacteria | 3387 |
| 121 | Ga0373925_0004043 | 3300037068 | Bacteria | 11141 |
| 122 | Ga0395899_0026901 | 3300037312 | Bacteria | 4340 |
| 123 | Ga0395899_0035495 | 3300037312 | Bacteria | 3743 |
| 124 | Ga0395900_0141367 | 3300037418 | Bacteria | 2465 |
| 125 | Ga0395900_0424677 | 3300037418 | Bacteria | 1289 |
| 126 | Ga0395898_0008258 | 3300037466 | Bacteria | 11011 |
| 127 | Ga0395898_0042259 | 3300037466 | Bacteria | 4498 |
| 128 | Ga0395898_0054213 | 3300037466 | Bacteria | 3913 |
| 129 | Ga0395898_0072657 | 3300037466 | Bacteria | 3323 |
| 130 | Ga0395898_0081816 | 3300037466 | Bacteria | 3113 |
| 131 | Ga0395898_0102862 | 3300037466 | Bacteria | 2741 |
| 132 | Ga0395905_0014438 | 3300037471 | Bacteria | 7541 |
| 133 | Ga0395905_0085601 | 3300037471 | Bacteria | 2953 |
| 134 | Ga0395905_0376199 | 3300037471 | Bacteria | 1314 |
| 135 | Ga0395905_0470023 | 3300037471 | Unclassified | 1156 |
| 136 | Ga0395901_0010703 | 3300038443 | Bacteria | 9299 |
| 137 | Ga0395901_0013240 | 3300038443 | Bacteria | 8375 |
| 138 | Ga0395901_0044798 | 3300038443 | Bacteria | 4588 |
| 139 | Ga0395901_0108196 | 3300038443 | Bacteria | 2918 |
| 140 | Ga0395901_0259209 | 3300038443 | Bacteria | 1810 |
| 141 | Ga0436365_0519522 | 3300039437 | Unclassified | 2086 |
| 142 | Ga0436365_1671594 | 3300039437 | Bacteria | 1743 |
| 143 | Ga0439448_0021144 | 3300042005 | Bacteria | 2017 |
| 144 | Ga0439458_0043661 | 3300042157 | Bacteria | 1094 |
| 145 | Ga0466961_0034333 | 3300044693 | Bacteria | 3256 |
| 146 | Ga0466963_0000037 | 3300044694 | Bacteria | 42541 |
| 147 | Ga0466963_0002629 | 3300044694 | Bacteria | 10091 |
| 148 | Ga0466963_0012598 | 3300044694 | Bacteria | 5180 |
| 149 | Ga0466963_0024188 | 3300044694 | Bacteria | 3866 |
| 150 | Ga0466963_0059679 | 3300044694 | Bacteria | 2546 |
| 151 | Ga0466963_0062267 | 3300044694 | Bacteria | 2496 |
| 152 | Ga0466963_0090892 | 3300044694 | Bacteria | 2079 |
| 153 | Ga0466963_0241913 | 3300044694 | Unclassified | 1266 |
| 154 | Ga0466964_0008661 | 3300044706 | Bacteria | 3825 |
| 155 | Ga0466964_0152289 | 3300044706 | Bacteria | 1073 |
| 156 | Ga0466971_0000254 | 3300044719 | Bacteria | 20367 |
| 157 | Ga0466971_0030832 | 3300044719 | Bacteria | 2400 |
| 158 | Ga0466957_0000448 | 3300044842 | Bacteria | 20335 |
| 159 | Ga0466957_0103343 | 3300044842 | Bacteria | 1799 |
| 160 | Ga0466957_0122873 | 3300044842 | Bacteria | 1656 |
| 161 | Ga0466957_0193556 | 3300044842 | Bacteria | 1333 |
| 162 | Ga0466960_0182659 | 3300044901 | Bacteria | 1138 |
| 163 | Ga0466958_0000148 | 3300045836 | Bacteria | 24461 |
| 164 | Ga0466958_0057875 | 3300045836 | Bacteria | 2356 |
| 165 | Ga0466967_0001347 | 3300045976 | Bacteria | 14104 |
| 166 | Ga0466967_0006287 | 3300045976 | Bacteria | 8378 |
| 167 | Ga0466967_0050526 | 3300045976 | Bacteria | 3641 |
| 168 | Ga0466967_0109672 | 3300045976 | Bacteria | 2534 |
| 169 | Ga0466967_0115775 | 3300045976 | Unclassified | 2469 |
| 170 | Ga0466967_0141575 | 3300045976 | Bacteria | 2240 |
| 171 | Ga0466967_0199471 | 3300045976 | Bacteria | 1894 |
| 172 | Ga0466967_0271903 | 3300045976 | Bacteria | 1624 |
| 173 | Ga0466967_0280565 | 3300045976 | Unclassified | 1598 |
| 174 | Ga0495592_0042056 | 3300046454 | Bacteria | 3423 |
| 175 | Ga0495629_0000159 | 3300046459 | Bacteria | 59616 |
| 176 | Ga0495629_0033665 | 3300046459 | Bacteria | 3624 |
| 177 | Ga0495641_0002695 | 3300046461 | Bacteria | 13801 |
| 178 | Ga0495651_0108157 | 3300046462 | Bacteria | 2059 |
| 179 | Ga0495653_0195808 | 3300046463 | Bacteria | 1375 |
| 180 | Ga0495582_0000036 | 3300046473 | Bacteria | 71283 |
| 181 | Ga0495639_0013005 | 3300046475 | Bacteria | 3591 |
| 182 | Ga0495662_0003844 | 3300046476 | Bacteria | 7571 |
| 183 | Ga0495664_0066013 | 3300046477 | Unclassified | 2158 |
| 184 | Ga0495594_0032535 | 3300046499 | Bacteria | 2832 |
| 185 | Ga0495608_0002074 | 3300046511 | Bacteria | 14433 |
| 186 | Ga0495608_0239373 | 3300046511 | Unclassified | 1134 |
| 187 | Ga0495628_0036080 | 3300046516 | Bacteria | 3971 |
| 188 | Ga0495628_0061306 | 3300046516 | Bacteria | 2950 |
| 189 | Ga0495630_0011214 | 3300046517 | Bacteria | 6485 |
| 190 | Ga0495630_0133297 | 3300046517 | Bacteria | 1887 |
| 191 | Ga0495663_0059523 | 3300046525 | Bacteria | 1199 |
| 192 | Ga0495666_0037845 | 3300046526 | Unclassified | 2346 |
| 193 | Ga0495652_0095002 | 3300046529 | Bacteria | 2430 |
| 194 | Ga0495652_0198974 | 3300046529 | Bacteria | 1522 |
| 195 | Ga0495587_0003372 | 3300046536 | Bacteria | 10650 |
| 196 | Ga0495587_0106142 | 3300046536 | Bacteria | 1615 |
| 197 | Ga0495645_0037027 | 3300046543 | Bacteria | 3556 |
| 198 | Ga0495645_0126731 | 3300046543 | Bacteria | 1794 |
| 199 | Ga0495667_0024019 | 3300046559 | Bacteria | 4105 |
| 200 | Ga0495667_0089953 | 3300046559 | Bacteria | 1989 |
| 201 | Ga0495634_0059568 | 3300046642 | Bacteria | 2543 |
| 202 | Ga0495635_0024261 | 3300046663 | Bacteria | 4228 |
| 203 | Ga0495635_0030247 | 3300046663 | Bacteria | 3763 |
| 204 | Ga0495659_0057097 | 3300046664 | Bacteria | 1434 |
| 205 | Ga0495657_0003990 | 3300046675 | Bacteria | 11841 |
| 206 | Ga0495657_0056515 | 3300046675 | Bacteria | 2612 |
| 207 | Ga0495646_0106282 | 3300046680 | Unclassified | 1603 |
| 208 | Ga0495658_0001382 | 3300046683 | Bacteria | 12733 |
| 209 | Ga0495658_0004867 | 3300046683 | Bacteria | 6590 |
| 210 | Ga0495658_0010192 | 3300046683 | Bacteria | 4698 |
| 211 | Ga0495613_0001777 | 3300046689 | Bacteria | 16372 |
| 212 | Ga0495600_0100826 | 3300046809 | Bacteria | 1882 |
| 213 | Ga0495674_0033122 | 3300047319 | Bacteria | 4683 |
| 214 | Ga0495674_0145061 | 3300047319 | Bacteria | 1993 |
| 215 | Ga0495676_0000361 | 3300047321 | Bacteria | 37295 |
| 216 | Ga0495680_0005394 | 3300047322 | Bacteria | 12050 |
| 217 | Ga0495680_0031078 | 3300047322 | Bacteria | 4350 |
| 218 | Ga0495680_0247593 | 3300047322 | Bacteria | 1264 |
| 219 | Ga0495684_0017925 | 3300047471 | Bacteria | 5455 |
| 220 | Ga0495684_0018124 | 3300047471 | Bacteria | 5427 |
| 221 | Ga0495684_0074126 | 3300047471 | Bacteria | 2586 |
| 222 | Ga0495593_0018610 | 3300047673 | Bacteria | 3901 |
| 223 | Ga0495614_0038741 | 3300048089 | Bacteria | 2045 |
| 224 | Ga0496100_0004629 | 3300048903 | Bacteria | 7318 |
| 225 | Ga0496100_0008150 | 3300048903 | Bacteria | 5832 |
| 226 | Ga0496100_0024953 | 3300048903 | Bacteria | 3651 |
| 227 | Ga0496100_0076582 | 3300048903 | Bacteria | 2246 |
| 228 | Ga0496100_0188549 | 3300048903 | Bacteria | 1496 |
| 229 | Ga0496101_0003811 | 3300048904 | Bacteria | 9420 |
| 230 | Ga0496101_0006366 | 3300048904 | Bacteria | 7599 |
| 231 | Ga0496101_0010303 | 3300048904 | Bacteria | 6172 |
| 232 | Ga0496101_0086401 | 3300048904 | Bacteria | 2326 |
| 233 | Ga0496102_0004126 | 3300048905 | Bacteria | 12315 |
| 234 | Ga0496103_0026054 | 3300048906 | Bacteria | 3538 |
| 235 | Ga0496103_0222681 | 3300048906 | Unclassified | 1213 |
| 236 | Ga0496104_0007506 | 3300048907 | Bacteria | 9642 |
| 237 | Ga0496104_0011375 | 3300048907 | Bacteria | 7965 |
| 238 | Ga0496104_0106403 | 3300048907 | Bacteria | 2688 |
| 239 | Ga0496104_0114546 | 3300048907 | Bacteria | 2586 |
| 240 | Ga0496105_0004708 | 3300048908 | Bacteria | 10291 |
| 241 | Ga0496105_0008798 | 3300048908 | Bacteria | 7861 |
| 242 | Ga0496106_0004174 | 3300048909 | Bacteria | 10769 |
| 243 | Ga0496106_0009901 | 3300048909 | Bacteria | 7038 |
| 244 | Ga0496106_0069650 | 3300048909 | Bacteria | 2685 |
| 245 | Ga0496106_0085559 | 3300048909 | Bacteria | 2428 |
| 246 | Ga0496107_0002389 | 3300048910 | Bacteria | 12150 |
| 247 | Ga0496107_0002928 | 3300048910 | Bacteria | 11284 |
| 248 | Ga0496107_0008570 | 3300048910 | Bacteria | 7077 |
| 249 | Ga0496107_0064067 | 3300048910 | Bacteria | 2664 |
| 250 | Ga0496108_0003187 | 3300048911 | Bacteria | 13203 |
| 251 | Ga0496108_0010152 | 3300048911 | Bacteria | 7643 |
| 252 | Ga0496108_0491975 | 3300048911 | Bacteria | 1071 |
| 253 | Ga0496109_0003709 | 3300048912 | Bacteria | 12761 |
| 254 | Ga0496109_0008365 | 3300048912 | Bacteria | 8791 |
| 255 | Ga0496109_0041516 | 3300048912 | Bacteria | 4166 |
| 256 | Ga0496110_0002690 | 3300048913 | Bacteria | 13429 |
| 257 | Ga0496110_0007787 | 3300048913 | Bacteria | 8583 |
| 258 | Ga0496110_0082449 | 3300048913 | Bacteria | 2868 |
| 259 | Ga0496110_0165706 | 3300048913 | Bacteria | 2004 |
| 260 | Ga0496111_0020042 | 3300048914 | Bacteria | 4652 |
| 261 | Ga0496111_0082941 | 3300048914 | Bacteria | 2342 |
| 262 | Ga0496111_0324911 | 3300048914 | Unclassified | 1139 |
| 263 | Ga0496112_0016717 | 3300048915 | Bacteria | 6879 |
| 264 | Ga0496112_0050517 | 3300048915 | Bacteria | 4078 |
| 265 | Ga0496112_0314945 | 3300048915 | Unclassified | 1510 |
| 266 | Ga0496113_0026557 | 3300048916 | Bacteria | 4141 |
| 267 | Ga0496113_0053949 | 3300048916 | Bacteria | 3007 |
| 268 | Ga0496114_0002086 | 3300048917 | Bacteria | 15206 |
| 269 | Ga0496114_0002981 | 3300048917 | Bacteria | 12981 |
| 270 | Ga0496114_0058250 | 3300048917 | Bacteria | 3225 |
| 271 | Ga0496115_0001353 | 3300048918 | Bacteria | 17501 |
| 272 | Ga0496115_0002049 | 3300048918 | Bacteria | 14422 |
| 273 | Ga0496115_0002704 | 3300048918 | Bacteria | 12730 |
| 274 | Ga0496115_0086400 | 3300048918 | Bacteria | 2559 |
| 275 | Ga0501067_0001941 | 3300049583 | Bacteria | 11382 |
| 276 | Ga0501067_0212493 | 3300049583 | Bacteria | 1077 |
| 277 | Ga0501069_0003038 | 3300049585 | Bacteria | 8621 |
| 278 | nmdc:mga0a205_106496_c1 | 3300050515 | Bacteria | 2701 |
| 279 | nmdc:mga0a205_227850_c1 | 3300050515 | Bacteria | 1748 |
| 280 | Ga0495619_0001672 | 3300053085 | Bacteria | 14668 |
| 281 | Ga0495619_0018167 | 3300053085 | Bacteria | 4459 |
| 282 | Ga0466962_0000794 | 3300061719 | Bacteria | 14225 |
| 283 | Ga0466962_0007907 | 3300061719 | Bacteria | 5099 |
| 284 | Ga0466962_0059528 | 3300061719 | Bacteria | 1823 |
| 285 | Ga0466967_0038247 | |||
| 286 | Ga0070683_100089712 | |||
| 287 | Ga0070683_100379753 | |||
| 288 | Ga0070680_100007887 | |||
| 289 | Ga0070680_100024961 | |||
| 290 | Ga0070680_100167529 | |||
| 291 | Ga0070680_100184849 | |||
| 292 | Ga0070682_100043229 | |||
| 293 | Ga0070660_100003462 | |||
| 294 | Ga0070660_100045839 | |||
| 295 | Ga0070661_100014269 | |||
| 296 | Ga0070668_100001762 | |||
| 297 | Ga0070710_10225907 | |||
| 298 | Ga0070694_100107708 | |||
| 299 | Ga0070708_100012021 | |||
| 300 | Ga0070708_100035205 | |||
| 301 | Ga0070681_10020294 | |||
| 302 | Ga0070681_10021377 | |||
| 303 | Ga0070681_10075961 | |||
| 304 | Ga0070681_10107811 | |||
| 305 | Ga0070698_100017306 | |||
| 306 | Ga0070699_100098093 | |||
| 307 | Ga0070679_100019319 | |||
| 308 | Ga0070679_100089173 | |||
| 309 | Ga0070679_100130944 | |||
| 310 | Ga0070696_100050326 | |||
| 311 | Ga0070693_100091000 | |||
| 312 | Ga0070665_100055853 | |||
| 313 | Ga0070704_100353146 | |||
| 314 | Ga0068855_100037145 | |||
| 315 | Ga0068855_100072519 | |||
| 316 | Ga0068855_100112068 | |||
| 317 | Ga0068855_100220228 | |||
| 318 | Ga0068857_100020906 | |||
| 319 | Ga0068857_100032287 | |||
| 320 | Ga0068854_100289258 | |||
| 321 | Ga0068852_100021248 | |||
| 322 | Ga0068861_100037755 | |||
| 323 | Ga0070716_100115149 | |||
| 324 | Ga0097621_100133395 | |||
| 325 | Ga0075434_100054617 | |||
| 326 | Ga0075435_100076858 | |||
| 327 | Ga0105240_10051834 | |||
| 328 | Ga0105245_10074924 | |||
| 329 | Ga0105241_10246050 | |||
| 330 | Ga0105237_10011065 | |||
| 331 | Ga0105237_10091807 | |||
| 332 | Ga0105238_10018908 | |||
| 333 | Ga0105238_10055911 | |||
| 334 | Ga0105249_10004322 | |||
| 335 | Ga0105239_10195022 | |||
| 336 | Ga0157373_10052586 | |||
| 337 | Ga0157370_10051647 | |||
| 338 | Ga0157370_10055541 | |||
| 339 | Ga0157369_10030077 | |||
| 340 | Ga0157369_10163550 | |||
| 341 | Ga0157374_10039517 | |||
| 342 | Ga0157378_10050325 | |||
| 343 | Ga0163162_10064997 | |||
| 344 | Ga0157372_10026969 | |||
| 345 | Ga0157372_10044422 | |||
| 346 | Ga0157372_10057837 | |||
| 347 | Ga0157372_10079843 | |||
| 348 | Ga0157375_10027950 | |||
| 349 | Ga0157375_10347110 | |||
| 350 | Ga0157376_10190753 | |||
| 351 | Ga0163161_10027988 | |||
| 352 | Ga0206356_10262733 | |||
| 353 | Ga0206354_11171552 | |||
| 354 | Ga0207685_10027301 | |||
| 355 | Ga0207707_10015712 | |||
| 356 | Ga0207707_10042549 | |||
| 357 | Ga0207707_10078848 | |||
| 358 | Ga0207693_10024538 | |||
| 359 | Ga0207663_10149426 | |||
| 360 | Ga0207660_10018051 | |||
| 361 | Ga0207660_10139098 | |||
| 362 | Ga0207657_10010889 | |||
| 363 | Ga0207657_10012021 | |||
| 364 | Ga0207657_10148783 | |||
| 365 | Ga0207649_10052892 | |||
| 366 | Ga0207652_10008133 | |||
| 367 | Ga0207652_10022233 | |||
| 368 | Ga0207652_10033425 | |||
| 369 | Ga0207652_10105169 | |||
| 370 | Ga0207687_10038181 | |||
| 371 | Ga0207664_10139496 | |||
| 372 | Ga0207664_10288949 | |||
| 373 | Ga0207706_10056799 | |||
| 374 | Ga0207667_10090232 | |||
| 375 | Ga0207667_10306500 | |||
| 376 | Ga0207712_10014920 | |||
| 377 | Ga0207668_10047818 | |||
| 378 | Ga0207674_10021117 | |||
| 379 | Ga0207674_10087299 | |||
| 380 | Ga0207675_100000145 | |||
| 381 | Ga0268265_10174095 | |||
| 382 | Ga0265322_10030514 | |||
| 383 | Ga0265338_10112828 | |||
| 384 | Ga0265330_10043651 | |||
| 385 | Ga0265328_10037394 | |||
| 386 | Ga0265325_10015889 | |||
| 387 | Ga0265339_10072696 | |||
| 388 | Ga0265316_10016150 | |||
| 389 | Ga0265313_10057455 | |||
| 390 | Ga0265314_10004995 | |||
| 391 | Ga0265342_10042644 | |||
| 392 | Ga0373944_0005376 | |||
| 393 | Ga0373936_0003286 | |||
| 394 | Ga0373936_0116469 | |||
| 395 | Ga0373956_0132461 | |||
| 396 | Ga0373943_0000048 | |||
| 397 | Ga0373943_0005381 | |||
| 398 | Ga0373946_0006643 | |||
| 399 | Ga0373935_0010962 | |||
| 400 | Ga0373933_0040130 | |||
| 401 | Ga0373947_0006567 | |||
| 402 | Ga0373947_0023315 | |||
| 403 | Ga0373937_0055548 | |||
| 404 | Ga0373937_0063840 | |||
| 405 | Ga0373925_0004043 | |||
| 406 | Ga0395899_0026901 | |||
| 407 | Ga0395899_0035495 | |||
| 408 | Ga0395900_0141367 | |||
| 409 | Ga0395900_0424677 | |||
| 410 | Ga0395898_0008258 | |||
| 411 | Ga0395898_0042259 | |||
| 412 | Ga0395898_0054213 | |||
| 413 | Ga0395898_0072657 | |||
| 414 | Ga0395898_0081816 | |||
| 415 | Ga0395898_0102862 | |||
| 416 | Ga0395905_0014438 | |||
| 417 | Ga0395905_0085601 | |||
| 418 | Ga0395905_0376199 | |||
| 419 | Ga0395905_0470023 | |||
| 420 | Ga0395901_0010703 | |||
| 421 | Ga0395901_0013240 | |||
| 422 | Ga0395901_0044798 | |||
| 423 | Ga0395901_0108196 | |||
| 424 | Ga0395901_0259209 | |||
| 425 | Ga0436365_0519522 | |||
| 426 | Ga0436365_1671594 | |||
| 427 | Ga0439448_0021144 | |||
| 428 | Ga0439458_0043661 | |||
| 429 | Ga0466961_0034333 | |||
| 430 | Ga0466963_0000037 | |||
| 431 | Ga0466963_0002629 | |||
| 432 | Ga0466963_0012598 | |||
| 433 | Ga0466963_0024188 | |||
| 434 | Ga0466963_0059679 | |||
| 435 | Ga0466963_0062267 | |||
| 436 | Ga0466963_0090892 | |||
| 437 | Ga0466963_0241913 | |||
| 438 | Ga0466964_0008661 | |||
| 439 | Ga0466964_0152289 | |||
| 440 | Ga0466971_0000254 | |||
| 441 | Ga0466971_0030832 | |||
| 442 | Ga0466957_0000448 | |||
| 443 | Ga0466957_0103343 | |||
| 444 | Ga0466957_0122873 | |||
| 445 | Ga0466957_0193556 | |||
| 446 | Ga0466960_0182659 | |||
| 447 | Ga0466958_0000148 | |||
| 448 | Ga0466958_0057875 | |||
| 449 | Ga0466967_0001347 | |||
| 450 | Ga0466967_0006287 | |||
| 451 | Ga0466967_0050526 | |||
| 452 | Ga0466967_0109672 | |||
| 453 | Ga0466967_0115775 | |||
| 454 | Ga0466967_0141575 | |||
| 455 | Ga0466967_0199471 | |||
| 456 | Ga0466967_0271903 | |||
| 457 | Ga0466967_0280565 | |||
| 458 | Ga0495592_0042056 | |||
| 459 | Ga0495629_0000159 | |||
| 460 | Ga0495629_0033665 | |||
| 461 | Ga0495641_0002695 | |||
| 462 | Ga0495651_0108157 | |||
| 463 | Ga0495653_0195808 | |||
| 464 | Ga0495582_0000036 | |||
| 465 | Ga0495639_0013005 | |||
| 466 | Ga0495662_0003844 | |||
| 467 | Ga0495664_0066013 | |||
| 468 | Ga0495594_0032535 | |||
| 469 | Ga0495608_0002074 | |||
| 470 | Ga0495608_0239373 | |||
| 471 | Ga0495628_0036080 | |||
| 472 | Ga0495628_0061306 | |||
| 473 | Ga0495630_0011214 | |||
| 474 | Ga0495630_0133297 | |||
| 475 | Ga0495663_0059523 | |||
| 476 | Ga0495666_0037845 | |||
| 477 | Ga0495652_0095002 | |||
| 478 | Ga0495652_0198974 | |||
| 479 | Ga0495587_0003372 | |||
| 480 | Ga0495587_0106142 | |||
| 481 | Ga0495645_0037027 | |||
| 482 | Ga0495645_0126731 | |||
| 483 | Ga0495667_0024019 | |||
| 484 | Ga0495667_0089953 | |||
| 485 | Ga0495634_0059568 | |||
| 486 | Ga0495635_0024261 | |||
| 487 | Ga0495635_0030247 | |||
| 488 | Ga0495659_0057097 | |||
| 489 | Ga0495657_0003990 | |||
| 490 | Ga0495657_0056515 | |||
| 491 | Ga0495646_0106282 | |||
| 492 | Ga0495658_0001382 | |||
| 493 | Ga0495658_0004867 | |||
| 494 | Ga0495658_0010192 | |||
| 495 | Ga0495613_0001777 | |||
| 496 | Ga0495600_0100826 | |||
| 497 | Ga0495674_0033122 | |||
| 498 | Ga0495674_0145061 | |||
| 499 | Ga0495676_0000361 | |||
| 500 | Ga0495680_0005394 | |||
| 501 | Ga0495680_0031078 | |||
| 502 | Ga0495680_0247593 | |||
| 503 | Ga0495684_0017925 | |||
| 504 | Ga0495684_0018124 | |||
| 505 | Ga0495684_0074126 | |||
| 506 | Ga0495593_0018610 | |||
| 507 | Ga0495614_0038741 | |||
| 508 | Ga0496100_0004629 | |||
| 509 | Ga0496100_0008150 | |||
| 510 | Ga0496100_0024953 | |||
| 511 | Ga0496100_0076582 | |||
| 512 | Ga0496100_0188549 | |||
| 513 | Ga0496101_0003811 | |||
| 514 | Ga0496101_0006366 | |||
| 515 | Ga0496101_0010303 | |||
| 516 | Ga0496101_0086401 | |||
| 517 | Ga0496102_0004126 | |||
| 518 | Ga0496103_0026054 | |||
| 519 | Ga0496103_0222681 | |||
| 520 | Ga0496104_0007506 | |||
| 521 | Ga0496104_0011375 | |||
| 522 | Ga0496104_0106403 | |||
| 523 | Ga0496104_0114546 | |||
| 524 | Ga0496105_0004708 | |||
| 525 | Ga0496105_0008798 | |||
| 526 | Ga0496106_0004174 | |||
| 527 | Ga0496106_0009901 | |||
| 528 | Ga0496106_0069650 | |||
| 529 | Ga0496106_0085559 | |||
| 530 | Ga0496107_0002389 | |||
| 531 | Ga0496107_0002928 | |||
| 532 | Ga0496107_0008570 | |||
| 533 | Ga0496107_0064067 | |||
| 534 | Ga0496108_0003187 | |||
| 535 | Ga0496108_0010152 | |||
| 536 | Ga0496108_0491975 | |||
| 537 | Ga0496109_0003709 | |||
| 538 | Ga0496109_0008365 | |||
| 539 | Ga0496109_0041516 | |||
| 540 | Ga0496110_0002690 | |||
| 541 | Ga0496110_0007787 | |||
| 542 | Ga0496110_0082449 | |||
| 543 | Ga0496110_0165706 | |||
| 544 | Ga0496111_0020042 | |||
| 545 | Ga0496111_0082941 | |||
| 546 | Ga0496111_0324911 | |||
| 547 | Ga0496112_0016717 | |||
| 548 | Ga0496112_0050517 | |||
| 549 | Ga0496112_0314945 | |||
| 550 | Ga0496113_0026557 | |||
| 551 | Ga0496113_0053949 | |||
| 552 | Ga0496114_0002086 | |||
| 553 | Ga0496114_0002981 | |||
| 554 | Ga0496114_0058250 | |||
| 555 | Ga0496115_0001353 | |||
| 556 | Ga0496115_0002049 | |||
| 557 | Ga0496115_0002704 | |||
| 558 | Ga0496115_0086400 | |||
| 559 | Ga0501067_0001941 | |||
| 560 | Ga0501067_0212493 | |||
| 561 | Ga0501069_0003038 | |||
| 562 | nmdc:mga0a205_106496_c1 | |||
| 563 | nmdc:mga0a205_227850_c1 | |||
| 564 | Ga0495619_0001672 | |||
| 565 | Ga0495619_0018167 | |||
| 566 | Ga0466962_0000794 | |||
| 567 | Ga0466962_0007907 | |||
| 568 | Ga0466962_0059528 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5bmq-assembly1.cif.gz_A | crystal structure of l,d-transpeptidase (yku) from stackebrandtia nassauensis | 0.8233 | 206 | 338 |
| 2j4r-assembly2.cif.gz_B | structural study of the aquifex aeolicus ppx-gppa enzyme | 0.8101 | 209 | 232 |
| 3zg4-assembly1.cif.gz_A | nmr structure of the catalytic domain from e. faecium l,d- transpeptidase | 0.7911 | 210 | 338 |
| 3zgp-assembly1.cif.gz_A | nmr structure of the catalytic domain from e. faecium l,d- transpeptidase acylated by ertapenem | 0.7691 | 209 | 338 |
| 4xxt-assembly1.cif.gz_A | crystal structure of fused zn-dependent amidase/peptidase/peptodoglycan-binding domain-containing protein from clostridium acetobutylicum atcc 824 | 0.7658 | 210 | 338 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4a1iC02 | Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like | 0.9393 | 207 | 338 | 2.40.440.10 |
| 4a1iC02 | Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like | 0.8856 | 207 | 338 | 2.40.440.10 |
| af_P75954_98_241_2.40.440.10 | Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like | 0.8818 | 210 | 338 | 2.40.440.10 |
| 5uwvD03 | Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like | 0.8632 | 209 | 338 | 2.40.440.10 |
| 2ychA03 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.8305 | 207 | 232 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C6Z948-F1-model_v4 | L,D-transpeptidase family protein | 0.9674 | 209 | 338 |
GO:0005576
GO:0008360 GO:0016757 GO:0018104 GO:0071555 GO:0071972 |
| AF-A0A7C7DP39-F1-model_v4 | L,D-transpeptidase family protein | 0.9622 | 209 | 338 |
GO:0005576
GO:0008360 GO:0016757 GO:0018104 GO:0071555 GO:0071972 |
| AF-A0A7C6UQT4-F1-model_v4 | L,D-transpeptidase | 0.9576 | 209 | 338 |
GO:0005576
GO:0008360 GO:0016757 GO:0018104 GO:0071555 GO:0071972 |
| AF-A0A7S7NP37-F1-model_v4 | L,D-transpeptidase | 0.9572 | 209 | 338 |
GO:0005576
GO:0008360 GO:0016757 GO:0018104 GO:0071555 GO:0071972 |
| AF-A0A2G4H788-F1-model_v4 | L,D-TPase catalytic domain-containing protein | 0.9555 | 207 | 337 |
GO:0005576
GO:0005975 GO:0008360 GO:0016020 GO:0016757 GO:0018104 GO:0071555 GO:0071972 |