F386344

General Info

Members Datasets Scaffolds Average Seq Length
284 180 568 103

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0000135|Ga0466963_0000135_6562_6918
Length 118
Sequence MAVETCPSRFRTCEHSTVTLEDLSRLAAQLDGVVETRRDGLLDWRYRGRLVARQLDDDHVVIRASFDFRDFLLHSFPETFSVPARFAKHMMVVADLEHGNPDAVEDAVVGAWELQSAR

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
48 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
86 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
87 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
88 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
99 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
100 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
101 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
102 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
107 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
178 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.59
Metatranscriptomes 1.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.28
Rhizosphere 93.66
Stem 0
Stem Tuber 0
Unclassified 19.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0000135 3300044694 Bacteria 28446
2 ARcpr5oldR_c023435 3300000041 Bacteria 560
3 ARcpr5yngRDRAFT_c013763 3300000043 Bacteria 679
4 Ga0070683_100678744 3300005329 Bacteria 986
5 Ga0070690_100328730 3300005330 Unclassified 1104
6 Ga0070680_100446007 3300005336 Unclassified 1105
7 Ga0068868_101289792 3300005338 Bacteria 678
8 Ga0070668_100363235 3300005347 Bacteria 1228
9 Ga0070671_100143129 3300005355 Bacteria 2018
10 Ga0070659_101882926 3300005366 Bacteria 536
11 Ga0070709_10929390 3300005434 Bacteria 689
12 Ga0070714_100055766 3300005435 Bacteria 3378
13 Ga0070714_100089087 3300005435 Bacteria 2701
14 Ga0070714_101522354 3300005435 Bacteria 653
15 Ga0070713_100035668 3300005436 Bacteria 4006
16 Ga0070713_100047759 3300005436 Bacteria 3520
17 Ga0070710_10016510 3300005437 Bacteria 3759
18 Ga0070710_11074574 3300005437 Unclassified 590
19 Ga0070710_11261762 3300005437 Unclassified 548
20 Ga0070711_100838256 3300005439 Bacteria 782
21 Ga0070700_100900627 3300005441 Bacteria 720
22 Ga0070708_100455342 3300005445 Bacteria 1207
23 Ga0070662_100496846 3300005457 Bacteria 1017
24 Ga0070681_10973348 3300005458 Unclassified 768
25 Ga0070685_10151670 3300005466 Bacteria 1469
26 Ga0070706_100322098 3300005467 Bacteria 1441
27 Ga0070684_100004872 3300005535 Bacteria 10251
28 Ga0070697_100670564 3300005536 Bacteria 914
29 Ga0068853_100816748 3300005539 Unclassified 893
30 Ga0070695_100000073 3300005545 Bacteria 40528
31 Ga0070696_100780038 3300005546 Unclassified 785
32 Ga0070664_100893339 3300005564 Bacteria 833
33 Ga0068857_100065508 3300005577 Bacteria 3231
34 Ga0068857_100249930 3300005577 Bacteria 1625
35 Ga0068854_100528554 3300005578 Unclassified 997
36 Ga0068866_10351568 3300005718 Unclassified 937
37 Ga0068870_10510408 3300005840 Bacteria 803
38 Ga0081455_10038800 3300005937 Bacteria 4215
39 Ga0081455_11035392 3300005937 Unclassified 508
40 Ga0081538_10089927 3300005981 Bacteria 1592
41 Ga0081540_1035524 3300005983 Bacteria 2671
42 Ga0070717_10003164 3300006028 Bacteria 11756
43 Ga0070717_11190522 3300006028 Bacteria 693
44 Ga0070716_100383735 3300006173 Unclassified 1005
45 Ga0070712_100433877 3300006175 Bacteria 1091
46 Ga0097621_101179474 3300006237 Bacteria 721
47 Ga0068865_101473622 3300006881 Unclassified 609
48 Ga0097620_100119072 3300006931 Bacteria 2706
49 Ga0075435_100989119 3300007076 Bacteria 734
50 Ga0105240_10315443 3300009093 Bacteria 1784
51 Ga0105243_10224628 3300009148 Bacteria 1662
52 Ga0105243_10643116 3300009148 Bacteria 1027
53 Ga0105243_11510297 3300009148 Bacteria 696
54 Ga0105248_10714058 3300009177 Bacteria 1131
55 Ga0105237_10041066 3300009545 Bacteria 4666
56 Ga0105249_10132421 3300009553 Bacteria 2382
57 Ga0157343_1022065 3300012488 Bacteria 584
58 Ga0157316_1002096 3300012510 Bacteria 1324
59 Ga0157370_10401967 3300013104 Unclassified 1261
60 Ga0157369_10395755 3300013105 Unclassified 1433
61 Ga0157378_10128591 3300013297 Unclassified 2342
62 Ga0157378_11553802 3300013297 Bacteria 707
63 Ga0163162_10442521 3300013306 Bacteria 1432
64 Ga0163162_11665762 3300013306 Bacteria 728
65 Ga0157372_10188026 3300013307 Bacteria 2391
66 Ga0157375_10962141 3300013308 Bacteria 995
67 Ga0163163_10455907 3300014325 Bacteria 1339
68 Ga0157376_10308439 3300014969 Bacteria 1501
69 Ga0197907_10561437 3300020069 Unclassified 1533
70 Ga0206356_11071118 3300020070 Unclassified 3267
71 Ga0206355_1038128 3300020076 Bacteria 896
72 Ga0213875_10331472 3300021388 Bacteria 722
73 Ga0224712_10031166 3300022467 Bacteria 1932
74 Ga0207692_10006997 3300025898 Bacteria 4604
75 Ga0207692_10435320 3300025898 Unclassified 823
76 Ga0207692_10473907 3300025898 Unclassified 791
77 Ga0207642_10338466 3300025899 Bacteria 884
78 Ga0207699_10424582 3300025906 Bacteria 950
79 Ga0207699_11059392 3300025906 Bacteria 600
80 Ga0207707_10490393 3300025912 Unclassified 1049
81 Ga0207695_10051529 3300025913 Bacteria 4321
82 Ga0207671_10686304 3300025914 Unclassified 815
83 Ga0207693_10033302 3300025915 Bacteria 4066
84 Ga0207663_10033803 3300025916 Bacteria 3050
85 Ga0207652_10652851 3300025921 Unclassified 941
86 Ga0207646_10889082 3300025922 Bacteria 791
87 Ga0207700_10020736 3300025928 Bacteria 4472
88 Ga0207700_10032996 3300025928 Bacteria 3701
89 Ga0207700_11233129 3300025928 Unclassified 667
90 Ga0207664_10004126 3300025929 Bacteria 9805
91 Ga0207664_10021083 3300025929 Bacteria 4838
92 Ga0207664_10222477 3300025929 Bacteria 1637
93 Ga0207664_10768495 3300025929 Unclassified 867
94 Ga0207664_11202302 3300025929 Unclassified 676
95 Ga0207664_11444189 3300025929 Bacteria 609
96 Ga0207644_10114303 3300025931 Bacteria 2045
97 Ga0207644_10200331 3300025931 Unclassified 1575
98 Ga0207706_11226716 3300025933 Unclassified 622
99 Ga0207709_10093307 3300025935 Bacteria 1973
100 Ga0207709_10168649 3300025935 Bacteria 1534
101 Ga0207661_10104326 3300025944 Bacteria 2387
102 Ga0207661_10506647 3300025944 Bacteria 1103
103 Ga0207679_10157939 3300025945 Bacteria 1854
104 Ga0207679_10221462 3300025945 Bacteria 1592
105 Ga0207679_10470926 3300025945 Bacteria 1117
106 Ga0207668_10654672 3300025972 Bacteria 920
107 Ga0207640_10597531 3300025981 Unclassified 934
108 Ga0207677_11586895 3300026023 Bacteria 606
109 Ga0207639_11240337 3300026041 Bacteria 700
110 Ga0207674_10002991 3300026116 Bacteria 20962
111 Ga0265338_10724926 3300028800 Bacteria 685
112 Ga0373944_0145806 3300035089 Unclassified 831
113 Ga0373939_0057807 3300035114 Unclassified 1225
114 Ga0373953_0151188 3300035117 Bacteria 995
115 Ga0373943_0004106 3300035170 Bacteria 6606
116 Ga0373955_0943706 3300035172 Unclassified 531
117 Ga0373935_0065000 3300035692 Bacteria 2340
118 Ga0373927_0528811 3300035695 Bacteria 779
119 Ga0373933_0076938 3300035724 Bacteria 2039
120 Ga0373947_0000125 3300035725 Bacteria 38878
121 Ga0373937_0001555 3300036401 Bacteria 19280
122 Ga0373937_0361701 3300036401 Bacteria 1375
123 Ga0373925_0001092 3300037068 Bacteria 24324
124 Ga0395899_0551560 3300037312 Bacteria 741
125 Ga0436364_1158832 3300037853 Bacteria 932
126 Ga0451795_1307596 3300041456 Unclassified 569
127 Ga0451802_1669113 3300041460 Unclassified 544
128 Ga0451807_2136852 3300041486 Unclassified 608
129 Ga0451853_2664541 3300041512 Bacteria 1279
130 Ga0466969_0000826 3300044656 Bacteria 16834
131 Ga0466969_0445828 3300044656 Unclassified 589
132 Ga0466965_0009006 3300044683 Bacteria 4630
133 Ga0466965_0232715 3300044683 Bacteria 985
134 Ga0466966_0111954 3300044684 Bacteria 1682
135 Ga0466966_0120707 3300044684 Unclassified 1610
136 Ga0466961_0014983 3300044693 Bacteria 4977
137 Ga0466961_0087016 3300044693 Bacteria 1975
138 Ga0466961_0277336 3300044693 Bacteria 1026
139 Ga0466961_0399857 3300044693 Bacteria 834
140 Ga0466963_0000597 3300044694 Bacteria 17231
141 Ga0466963_0006762 3300044694 Bacteria 6814
142 Ga0466964_0014825 3300044706 Bacteria 2966
143 Ga0466964_0106215 3300044706 Unclassified 1245
144 Ga0466971_0003235 3300044719 Bacteria 6953
145 Ga0466971_0528912 3300044719 Unclassified 584
146 Ga0466968_0005765 3300044735 Bacteria 4646
147 Ga0466968_0017649 3300044735 Bacteria 2856
148 Ga0466970_0000686 3300044765 Bacteria 16534
149 Ga0466970_0221569 3300044765 Unclassified 1056
150 Ga0466970_0314253 3300044765 Bacteria 885
151 Ga0466957_0013492 3300044842 Bacteria 4739
152 Ga0466957_0017196 3300044842 Bacteria 4233
153 Ga0466957_0029584 3300044842 Bacteria 3267
154 Ga0466959_0011967 3300045049 Bacteria 6256
155 Ga0466959_0033440 3300045049 Bacteria 3802
156 Ga0466959_0535590 3300045049 Bacteria 790
157 Ga0451576_1424883 3300045051 Bacteria 721
158 Ga0466958_0005078 3300045836 Bacteria 7033
159 Ga0466958_0034632 3300045836 Bacteria 3013
160 Ga0466958_0216420 3300045836 Bacteria 1221
161 Ga0466967_0000242 3300045976 Bacteria 23913
162 Ga0466967_0027991 3300045976 Bacteria 4697
163 Ga0466967_0109806 3300045976 Bacteria 2532
164 Ga0466967_0217444 3300045976 Bacteria 1814
165 Ga0466967_0223431 3300045976 Bacteria 1791
166 Ga0466967_0714496 3300045976 Bacteria 993
167 Ga0466967_0797654 3300045976 Unclassified 937
168 Ga0495592_0000168 3300046454 Bacteria 58320
169 Ga0495592_0228060 3300046454 Bacteria 1242
170 Ga0495592_0308492 3300046454 Bacteria 1026
171 Ga0495629_0101936 3300046459 Bacteria 2002
172 Ga0495641_0003284 3300046461 Bacteria 12211
173 Ga0495641_0054591 3300046461 Bacteria 1815
174 Ga0495651_0000011 3300046462 Bacteria 147193
175 Ga0495651_0155148 3300046462 Bacteria 1646
176 Ga0495653_0003016 3300046463 Bacteria 13497
177 Ga0495653_0014961 3300046463 Bacteria 6327
178 Ga0495580_0017956 3300046472 Bacteria 5275
179 Ga0495582_0108491 3300046473 Bacteria 1558
180 Ga0495639_0000801 3300046475 Bacteria 14368
181 Ga0495662_0046839 3300046476 Bacteria 2087
182 Ga0495662_0202731 3300046476 Unclassified 978
183 Ga0495662_0487217 3300046476 Bacteria 605
184 Ga0495664_0008823 3300046477 Bacteria 5632
185 Ga0495585_0620308 3300046492 Unclassified 508
186 Ga0495608_0001685 3300046511 Bacteria 15868
187 Ga0495608_0071099 3300046511 Bacteria 2271
188 Ga0495618_0000900 3300046514 Bacteria 20427
189 Ga0495618_0009151 3300046514 Bacteria 5977
190 Ga0495618_0089636 3300046514 Bacteria 1967
191 Ga0495618_0218463 3300046514 Bacteria 1203
192 Ga0495628_0000024 3300046516 Bacteria 130196
193 Ga0495628_0403757 3300046516 Bacteria 998
194 Ga0495628_0625794 3300046516 Unclassified 766
195 Ga0495630_0063245 3300046517 Bacteria 2779
196 Ga0495630_0094845 3300046517 Bacteria 2255
197 Ga0495630_0562717 3300046517 Bacteria 874
198 Ga0495666_0001109 3300046526 Bacteria 12886
199 Ga0495652_0000299 3300046529 Bacteria 58948
200 Ga0495652_0348563 3300046529 Unclassified 1061
201 Ga0495652_0392493 3300046529 Bacteria 984
202 Ga0495652_0858586 3300046529 Unclassified 601
203 Ga0495665_0003294 3300046531 Bacteria 8752
204 Ga0495665_0366385 3300046531 Bacteria 733
205 Ga0495640_0026859 3300046533 Bacteria 4155
206 Ga0495586_0041549 3300046535 Bacteria 2476
207 Ga0495587_0000204 3300046536 Bacteria 43619
208 Ga0495645_0000035 3300046543 Bacteria 102305
209 Ga0495645_0064224 3300046543 Bacteria 2657
210 Ga0495667_0035746 3300046559 Bacteria 3319
211 Ga0495667_0055879 3300046559 Unclassified 2596
212 Ga0495667_0146645 3300046559 Bacteria 1520
213 Ga0495667_0863942 3300046559 Bacteria 556
214 Ga0495634_0009568 3300046642 Bacteria 7142
215 Ga0495634_0088905 3300046642 Bacteria 2009
216 Ga0495635_0041083 3300046663 Bacteria 3195
217 Ga0495635_0243433 3300046663 Bacteria 1213
218 Ga0495659_0129680 3300046664 Unclassified 999
219 Ga0495599_0000009 3300046678 Bacteria 217299
220 Ga0495599_0049765 3300046678 Bacteria 2627
221 Ga0495623_0000039 3300046679 Bacteria 80360
222 Ga0495646_0002081 3300046680 Bacteria 12130
223 Ga0495646_0230304 3300046680 Unclassified 999
224 Ga0495647_0102131 3300046681 Bacteria 1188
225 Ga0495658_0001305 3300046683 Bacteria 13049
226 Ga0495658_0179076 3300046683 Bacteria 1315
227 Ga0495658_0835156 3300046683 Bacteria 589
228 Ga0495613_0007204 3300046689 Bacteria 8285
229 Ga0495613_0450806 3300046689 Unclassified 872
230 Ga0495624_0003310 3300046690 Bacteria 12000
231 Ga0495600_0192771 3300046809 Bacteria 1310
232 Ga0495600_0196229 3300046809 Bacteria 1297
233 Ga0495581_0022479 3300047315 Bacteria 3654
234 Ga0495604_0001424 3300047317 Bacteria 19635
235 Ga0495604_0787813 3300047317 Unclassified 599
236 Ga0495674_0286787 3300047319 Bacteria 1347
237 Ga0495674_0696467 3300047319 Bacteria 798
238 Ga0495674_1092515 3300047319 Archaea 607
239 Ga0495676_0001649 3300047321 Bacteria 19486
240 Ga0495680_0004978 3300047322 Bacteria 12558
241 Ga0495680_0006492 3300047322 Bacteria 10856
242 Ga0495680_0099355 3300047322 Bacteria 2170
243 Ga0495675_0000608 3300047444 Bacteria 23082
244 Ga0495684_0203243 3300047471 Bacteria 1459
245 Ga0495593_0019814 3300047673 Bacteria 3769
246 Ga0495602_0001454 3300048088 Bacteria 23500
247 Ga0495614_0003023 3300048089 Bacteria 7489
248 Ga0496102_0229570 3300048905 Bacteria 1750
249 Ga0496103_0065638 3300048906 Bacteria 2264
250 Ga0496107_0319584 3300048910 Unclassified 1155
251 Ga0496108_1214403 3300048911 Bacteria 637
252 Ga0496109_0180002 3300048912 Bacteria 1985
253 Ga0496109_0419944 3300048912 Bacteria 1263
254 Ga0496109_1419461 3300048912 Unclassified 630
255 Ga0496110_0008672 3300048913 Bacteria 8189
256 Ga0496111_0466360 3300048914 Bacteria 931
257 Ga0496111_0878948 3300048914 Bacteria 646
258 Ga0496113_0930435 3300048916 Bacteria 687
259 Ga0496114_0290157 3300048917 Bacteria 1443
260 Ga0501040_0739055 3300049576 Bacteria 712
261 Ga0501067_0458248 3300049583 Viruses 712
262 Ga0501069_0362036 3300049585 Viruses 856
263 Ga0501072_1077080 3300049588 Archaea 626
264 Ga0501079_0492323 3300049741 Bacteria 964
265 Ga0501045_0180353 3300049824 Bacteria 1574
266 nmdc:mga0rr50_27996_c1 3300050513 Bacteria 3956
267 nmdc:mga08x19_669001_c1 3300050514 Bacteria 736
268 nmdc:mga08x19_931387_c1 3300050514 Unclassified 617
269 Ga0495601_0000224 3300053077 Bacteria 30389
270 Ga0495601_0002997 3300053077 Bacteria 9618
271 Ga0495601_0061531 3300053077 Bacteria 2383
272 Ga0495601_0110839 3300053077 Bacteria 1777
273 Ga0495601_0420538 3300053077 Bacteria 865
274 Ga0495612_0002524 3300053078 Bacteria 7557
275 Ga0495612_0044937 3300053078 Bacteria 1808
276 Ga0495612_0122517 3300053078 Bacteria 1119
277 Ga0495595_0012641 3300053084 Bacteria 3553
278 Ga0495595_0607534 3300053084 Unclassified 559
279 Ga0495595_0620318 3300053084 Unclassified 553
280 Ga0495619_0000712 3300053085 Bacteria 21673
281 Ga0495619_0039526 3300053085 Bacteria 3080
282 Ga0495619_0052080 3300053085 Bacteria 2706
283 Ga0495619_0297200 3300053085 Bacteria 1119
284 Ga0466962_0000890 3300061719 Bacteria 13581
285 Ga0466963_0000135
286 ARcpr5oldR_c023435
287 ARcpr5yngRDRAFT_c013763
288 Ga0070683_100678744
289 Ga0070690_100328730
290 Ga0070680_100446007
291 Ga0068868_101289792
292 Ga0070668_100363235
293 Ga0070671_100143129
294 Ga0070659_101882926
295 Ga0070709_10929390
296 Ga0070714_100055766
297 Ga0070714_100089087
298 Ga0070714_101522354
299 Ga0070713_100035668
300 Ga0070713_100047759
301 Ga0070710_10016510
302 Ga0070710_11074574
303 Ga0070710_11261762
304 Ga0070711_100838256
305 Ga0070700_100900627
306 Ga0070708_100455342
307 Ga0070662_100496846
308 Ga0070681_10973348
309 Ga0070685_10151670
310 Ga0070706_100322098
311 Ga0070684_100004872
312 Ga0070697_100670564
313 Ga0068853_100816748
314 Ga0070695_100000073
315 Ga0070696_100780038
316 Ga0070664_100893339
317 Ga0068857_100065508
318 Ga0068857_100249930
319 Ga0068854_100528554
320 Ga0068866_10351568
321 Ga0068870_10510408
322 Ga0081455_10038800
323 Ga0081455_11035392
324 Ga0081538_10089927
325 Ga0081540_1035524
326 Ga0070717_10003164
327 Ga0070717_11190522
328 Ga0070716_100383735
329 Ga0070712_100433877
330 Ga0097621_101179474
331 Ga0068865_101473622
332 Ga0097620_100119072
333 Ga0075435_100989119
334 Ga0105240_10315443
335 Ga0105243_10224628
336 Ga0105243_10643116
337 Ga0105243_11510297
338 Ga0105248_10714058
339 Ga0105237_10041066
340 Ga0105249_10132421
341 Ga0157343_1022065
342 Ga0157316_1002096
343 Ga0157370_10401967
344 Ga0157369_10395755
345 Ga0157378_10128591
346 Ga0157378_11553802
347 Ga0163162_10442521
348 Ga0163162_11665762
349 Ga0157372_10188026
350 Ga0157375_10962141
351 Ga0163163_10455907
352 Ga0157376_10308439
353 Ga0197907_10561437
354 Ga0206356_11071118
355 Ga0206355_1038128
356 Ga0213875_10331472
357 Ga0224712_10031166
358 Ga0207692_10006997
359 Ga0207692_10435320
360 Ga0207692_10473907
361 Ga0207642_10338466
362 Ga0207699_10424582
363 Ga0207699_11059392
364 Ga0207707_10490393
365 Ga0207695_10051529
366 Ga0207671_10686304
367 Ga0207693_10033302
368 Ga0207663_10033803
369 Ga0207652_10652851
370 Ga0207646_10889082
371 Ga0207700_10020736
372 Ga0207700_10032996
373 Ga0207700_11233129
374 Ga0207664_10004126
375 Ga0207664_10021083
376 Ga0207664_10222477
377 Ga0207664_10768495
378 Ga0207664_11202302
379 Ga0207664_11444189
380 Ga0207644_10114303
381 Ga0207644_10200331
382 Ga0207706_11226716
383 Ga0207709_10093307
384 Ga0207709_10168649
385 Ga0207661_10104326
386 Ga0207661_10506647
387 Ga0207679_10157939
388 Ga0207679_10221462
389 Ga0207679_10470926
390 Ga0207668_10654672
391 Ga0207640_10597531
392 Ga0207677_11586895
393 Ga0207639_11240337
394 Ga0207674_10002991
395 Ga0265338_10724926
396 Ga0373944_0145806
397 Ga0373939_0057807
398 Ga0373953_0151188
399 Ga0373943_0004106
400 Ga0373955_0943706
401 Ga0373935_0065000
402 Ga0373927_0528811
403 Ga0373933_0076938
404 Ga0373947_0000125
405 Ga0373937_0001555
406 Ga0373937_0361701
407 Ga0373925_0001092
408 Ga0395899_0551560
409 Ga0436364_1158832
410 Ga0451795_1307596
411 Ga0451802_1669113
412 Ga0451807_2136852
413 Ga0451853_2664541
414 Ga0466969_0000826
415 Ga0466969_0445828
416 Ga0466965_0009006
417 Ga0466965_0232715
418 Ga0466966_0111954
419 Ga0466966_0120707
420 Ga0466961_0014983
421 Ga0466961_0087016
422 Ga0466961_0277336
423 Ga0466961_0399857
424 Ga0466963_0000597
425 Ga0466963_0006762
426 Ga0466964_0014825
427 Ga0466964_0106215
428 Ga0466971_0003235
429 Ga0466971_0528912
430 Ga0466968_0005765
431 Ga0466968_0017649
432 Ga0466970_0000686
433 Ga0466970_0221569
434 Ga0466970_0314253
435 Ga0466957_0013492
436 Ga0466957_0017196
437 Ga0466957_0029584
438 Ga0466959_0011967
439 Ga0466959_0033440
440 Ga0466959_0535590
441 Ga0451576_1424883
442 Ga0466958_0005078
443 Ga0466958_0034632
444 Ga0466958_0216420
445 Ga0466967_0000242
446 Ga0466967_0027991
447 Ga0466967_0109806
448 Ga0466967_0217444
449 Ga0466967_0223431
450 Ga0466967_0714496
451 Ga0466967_0797654
452 Ga0495592_0000168
453 Ga0495592_0228060
454 Ga0495592_0308492
455 Ga0495629_0101936
456 Ga0495641_0003284
457 Ga0495641_0054591
458 Ga0495651_0000011
459 Ga0495651_0155148
460 Ga0495653_0003016
461 Ga0495653_0014961
462 Ga0495580_0017956
463 Ga0495582_0108491
464 Ga0495639_0000801
465 Ga0495662_0046839
466 Ga0495662_0202731
467 Ga0495662_0487217
468 Ga0495664_0008823
469 Ga0495585_0620308
470 Ga0495608_0001685
471 Ga0495608_0071099
472 Ga0495618_0000900
473 Ga0495618_0009151
474 Ga0495618_0089636
475 Ga0495618_0218463
476 Ga0495628_0000024
477 Ga0495628_0403757
478 Ga0495628_0625794
479 Ga0495630_0063245
480 Ga0495630_0094845
481 Ga0495630_0562717
482 Ga0495666_0001109
483 Ga0495652_0000299
484 Ga0495652_0348563
485 Ga0495652_0392493
486 Ga0495652_0858586
487 Ga0495665_0003294
488 Ga0495665_0366385
489 Ga0495640_0026859
490 Ga0495586_0041549
491 Ga0495587_0000204
492 Ga0495645_0000035
493 Ga0495645_0064224
494 Ga0495667_0035746
495 Ga0495667_0055879
496 Ga0495667_0146645
497 Ga0495667_0863942
498 Ga0495634_0009568
499 Ga0495634_0088905
500 Ga0495635_0041083
501 Ga0495635_0243433
502 Ga0495659_0129680
503 Ga0495599_0000009
504 Ga0495599_0049765
505 Ga0495623_0000039
506 Ga0495646_0002081
507 Ga0495646_0230304
508 Ga0495647_0102131
509 Ga0495658_0001305
510 Ga0495658_0179076
511 Ga0495658_0835156
512 Ga0495613_0007204
513 Ga0495613_0450806
514 Ga0495624_0003310
515 Ga0495600_0192771
516 Ga0495600_0196229
517 Ga0495581_0022479
518 Ga0495604_0001424
519 Ga0495604_0787813
520 Ga0495674_0286787
521 Ga0495674_0696467
522 Ga0495674_1092515
523 Ga0495676_0001649
524 Ga0495680_0004978
525 Ga0495680_0006492
526 Ga0495680_0099355
527 Ga0495675_0000608
528 Ga0495684_0203243
529 Ga0495593_0019814
530 Ga0495602_0001454
531 Ga0495614_0003023
532 Ga0496102_0229570
533 Ga0496103_0065638
534 Ga0496107_0319584
535 Ga0496108_1214403
536 Ga0496109_0180002
537 Ga0496109_0419944
538 Ga0496109_1419461
539 Ga0496110_0008672
540 Ga0496111_0466360
541 Ga0496111_0878948
542 Ga0496113_0930435
543 Ga0496114_0290157
544 Ga0501040_0739055
545 Ga0501067_0458248
546 Ga0501069_0362036
547 Ga0501072_1077080
548 Ga0501079_0492323
549 Ga0501045_0180353
550 nmdc:mga0rr50_27996_c1
551 nmdc:mga08x19_669001_c1
552 nmdc:mga08x19_931387_c1
553 Ga0495601_0000224
554 Ga0495601_0002997
555 Ga0495601_0061531
556 Ga0495601_0110839
557 Ga0495601_0420538
558 Ga0495612_0002524
559 Ga0495612_0044937
560 Ga0495612_0122517
561 Ga0495595_0012641
562 Ga0495595_0607534
563 Ga0495595_0620318
564 Ga0495619_0000712
565 Ga0495619_0039526
566 Ga0495619_0052080
567 Ga0495619_0297200
568 Ga0466962_0000890

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m4w-assembly1.cif.gz_3 a. baumannii ribosome-eravacycline complex: empty 70s 0.8363 14 29
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.8329 2 101
7n2c-assembly1.cif.gz_Lj elongating 70s ribosome complex in a fusidic acid-stalled intermediate state of translocation bound to ef-g(gdp) (int2) 0.8306 14 29
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.8183 2 101
6q9a-assembly1.cif.gz_f structure of tmrna smpb bound past e site of e. coli 70s ribosome 0.8018 14 29
ID Description Score Start End Superfamily
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.835 4 98 3.30.70.1230
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8329 2 101 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.83 1 100 3.90.1150.30
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8184 2 101 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8155 1 100 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A6P2BN12-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9995 1 100
AF-A0A1H3T0E2-F1-model_v4 YjbR protein 0.9838 1 101
AF-A0A6P2BN12-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9799 1 100
AF-A0A0K1JQ15-F1-model_v4 Uncharacterized protein 0.9785 6 100
AF-A0A6J7JU91-F1-model_v4 Unannotated protein 0.9779 1 98

Map