F386162

General Info

Members Datasets Scaffolds Average Seq Length
284 210 568 682

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10105192|Ga0105245_101051922
Length 723
Sequence LTLAFSPEYARQTQVIPGKTIEQVNHVTQQGLQMTLKNMRAKHLKVLAVVLALILAGGNVLLSTRGTRAQGIDLAGIDKSIDPGDDFFGYANGTWSRAAQIPSDRPSYGAFDAIAEKVNARTADLIRSAGKSANDPEAQKIGDYYDAFMNEDAIEKKGLAPIKTELDEINGIADKTALARVLGSQLRADVDPLNSTNFYTDRLFGIWVSPDFNNPTHNVAYMLQGGLGLPDRDNYLGTEKDDLELQAKYREHIVTILKLAQVADAEAKAARIYDLEKMIATAHATRTDSADVQKANNPWAMKDFSTKAAGLDWTTYFKAAGLSAQPTIIVWHPGGVAGISRLVGSQPLEVWKEYLTFHVIDRASGLLPKPFATERFKFYGTTLNGIPQQSDRWKRAISNTSAALGDAVGKLYVHKYFPPEAKARIQEMVKNIIASFGRRIDNLTWMTPATKAKAKAKLGTLYVGVGYPEHWRDYAGLKILRDDPLGNGQRSDLFDYQWTLSKLSKPVDKTEWWMTPQTVNAVNLPIQNGLNFPAAILNPPFFDPNADPVENYGSIGATIGHEISHSFDDQGSQFDAYGKLQNWWTPADLEHFRAAADRLAAQXXXYEPLPSMHVNGKLTLSENIADVAGLSAAYDAYRTAYGDKPSANAKGLTNDQRFFIAYAQSWRSKVRPEFLKVLLTTDGHAPDQYRADTVRNLDAWYQAFNIQPGRKLYLAPEARVRVW

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
80 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
81 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
120 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
134 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
135 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
136 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
143 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
173 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
174 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
175 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
176 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
177 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
178 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
179 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
180 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
181 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
182 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
183 2643221583 Caulobacter sp. Root655 Isolate Unclassified
184 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
185 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
186 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
187 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
188 2818991435 Caulobacter henricii 536 Isolate Unclassified
189 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
190 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
191 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
192 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
193 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
194 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
195 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
196 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
197 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
198 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
199 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
200 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
201 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
202 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
203 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
204 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
205 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
206 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
207 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
208 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
209 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
210 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.03
Metatranscriptomes 0
Isolates 11.97

Biome Distribution

Category Percentage (%)
Aerial Root 0.35
Bulb 0
Endosphere 15.14
Nodule 0.35
Rhizoplane 4.58
Rhizosphere 64.44
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10105192 3300009098 Bacteria 2618
2 JGI24748J21848_1000014 3300002074 Bacteria 147126
3 JGI24034J26672_10000012 3300002239 Bacteria 146139
4 rootH2_10011429 3300003320 Bacteria 15141
5 Ga0055526_1003151 3300003771 Bacteria 10684
6 Ga0055537_1000028 3300003773 Bacteria 102200
7 Ga0055524_1003547 3300003775 Bacteria 7535
8 Ga0055536_1001186 3300003781 Bacteria 16236
9 Ga0055536_1001488 3300003781 Bacteria 14090
10 Ga0055534_1000411 3300003784 Bacteria 26197
11 Ga0055528_1004685 3300003790 Bacteria 6535
12 Ga0055528_1007531 3300003790 Bacteria 4800
13 Ga0055530_10001142 3300003791 Bacteria 20657
14 Ga0055530_10001167 3300003791 Bacteria 20372
15 Ga0055530_10004254 3300003791 Bacteria 7496
16 Ga0055531_10000799 3300003794 Bacteria 26105
17 Ga0058692_1000026 3300003856 Bacteria 203096
18 Ga0065712_10081270 3300005290 Bacteria 3009
19 Ga0070658_10000761 3300005327 Bacteria 27668
20 Ga0070683_100000017 3300005329 Bacteria 207189
21 Ga0070683_100047549 3300005329 Bacteria 3965
22 Ga0070670_100000400 3300005331 Bacteria 35600
23 Ga0068868_100000040 3300005338 Bacteria 70432
24 Ga0070668_100004802 3300005347 Bacteria 10017
25 Ga0070668_100021281 3300005347 Bacteria 4902
26 Ga0070669_100012123 3300005353 Bacteria 6118
27 Ga0070669_100052834 3300005353 Bacteria 2974
28 Ga0070675_100033019 3300005354 Bacteria 4193
29 Ga0070671_100027740 3300005355 Bacteria 4662
30 Ga0070673_100025877 3300005364 Bacteria 4326
31 Ga0070688_100040948 3300005365 Bacteria 2841
32 Ga0070713_100018300 3300005436 Bacteria 5326
33 Ga0070701_10010264 3300005438 Bacteria 4134
34 Ga0070705_100000076 3300005440 Bacteria 53948
35 Ga0070694_100000101 3300005444 Bacteria 41614
36 Ga0070694_100000348 3300005444 Bacteria 24822
37 Ga0070694_100001916 3300005444 Bacteria 12310
38 Ga0070708_100108885 3300005445 Bacteria 2545
39 Ga0070662_100059575 3300005457 Bacteria 2781
40 Ga0070681_10004938 3300005458 Bacteria 12820
41 Ga0070681_10029847 3300005458 Bacteria 5473
42 Ga0070706_100023318 3300005467 Bacteria 5701
43 Ga0070698_100000117 3300005471 Bacteria 67940
44 Ga0070698_100001577 3300005471 Bacteria 25342
45 Ga0070699_100010562 3300005518 Bacteria 7992
46 Ga0070684_100000016 3300005535 Bacteria 139439
47 Ga0070697_100004313 3300005536 Bacteria 10911
48 Ga0068853_100007903 3300005539 Bacteria 8530
49 Ga0070696_100000574 3300005546 Bacteria 23470
50 Ga0070696_100027855 3300005546 Bacteria 3853
51 Ga0070693_100000328 3300005547 Bacteria 21805
52 Ga0070665_100025208 3300005548 Bacteria 5993
53 Ga0070665_100049922 3300005548 Bacteria 4198
54 Ga0070665_100134176 3300005548 Bacteria 2477
55 Ga0070704_100009224 3300005549 Bacteria 5952
56 Ga0070664_100000737 3300005564 Bacteria 25207
57 Ga0070664_100024312 3300005564 Bacteria 5010
58 Ga0068856_100001290 3300005614 Bacteria 26389
59 Ga0068856_100014309 3300005614 Bacteria 7673
60 Ga0068852_100059812 3300005616 Bacteria 3306
61 Ga0068859_100060868 3300005617 Bacteria 3804
62 Ga0068864_100011874 3300005618 Bacteria 7193
63 Ga0068858_100004226 3300005842 Bacteria 14137
64 Ga0068862_100007865 3300005844 Bacteria 8820
65 Ga0075367_10006982 3300006178 Bacteria 5750
66 Ga0075367_10023644 3300006178 Bacteria 3460
67 Ga0068871_100082791 3300006358 Bacteria 2661
68 Ga0075433_10036166 3300006852 Bacteria 4252
69 Ga0075434_100000085 3300006871 Bacteria 50753
70 Ga0075434_100000096 3300006871 Bacteria 48926
71 Ga0075434_100013141 3300006871 Bacteria 7865
72 Ga0075434_100088981 3300006871 Bacteria 3089
73 Ga0075436_100000505 3300006914 Bacteria 25226
74 Ga0097620_100060872 3300006931 Bacteria 3804
75 Ga0075435_100000001 3300007076 Bacteria 207579
76 Ga0075435_100015555 3300007076 Bacteria 5723
77 Ga0105251_10002747 3300009011 Bacteria 13475
78 Ga0105240_10029661 3300009093 Bacteria 7121
79 Ga0111539_10073052 3300009094 Bacteria 4044
80 Ga0105245_10000057 3300009098 Bacteria 124024
81 Ga0105245_10057562 3300009098 Bacteria 3497
82 Ga0105247_10000050 3300009101 Bacteria 146183
83 Ga0114129_10022462 3300009147 Bacteria 8955
84 Ga0114129_10028077 3300009147 Bacteria 7972
85 Ga0114129_10160613 3300009147 Bacteria 3070
86 Ga0105243_10000050 3300009148 Bacteria 142670
87 Ga0105243_10000393 3300009148 Bacteria 46112
88 Ga0105241_10002677 3300009174 Bacteria 13350
89 Ga0105242_10000189 3300009176 Bacteria 47464
90 Ga0105242_10000313 3300009176 Bacteria 38823
91 Ga0105242_10002875 3300009176 Bacteria 13491
92 Ga0105238_10000001 3300009551 Bacteria 2036163
93 Ga0105249_10119260 3300009553 Bacteria 2505
94 Ga0157371_10000372 3300013102 Bacteria 56552
95 Ga0157370_10010424 3300013104 Bacteria 9796
96 Ga0157369_10006660 3300013105 Bacteria 13350
97 Ga0157374_10000010 3300013296 Bacteria 505635
98 Ga0157378_10000004 3300013297 Bacteria 201051
99 Ga0163162_10108039 3300013306 Bacteria 2878
100 Ga0157372_10022940 3300013307 Bacteria 6760
101 Ga0157375_10000941 3300013308 Bacteria 25240
102 Ga0157375_10004838 3300013308 Bacteria 11702
103 Ga0163163_10003159 3300014325 Bacteria 13956
104 Ga0163163_10062024 3300014325 Bacteria 3704
105 Ga0182008_10000090 3300014497 Bacteria 69702
106 Ga0157377_10000019 3300014745 Bacteria 171658
107 Ga0157379_10014436 3300014968 Bacteria 6930
108 Ga0157376_10000019 3300014969 Bacteria 255553
109 Ga0157376_10038049 3300014969 Bacteria 3911
110 Ga0182006_1008133 3300015261 Bacteria 4759
111 Ga0182006_1017729 3300015261 Bacteria 3019
112 Ga0182007_10000025 3300015262 Bacteria 172058
113 Ga0182005_1000063 3300015265 Bacteria 97663
114 Ga0163161_10000600 3300017792 Bacteria 28833
115 Ga0209565_1000037 3300025263 Bacteria 289371
116 Ga0209565_1002061 3300025263 Bacteria 7698
117 Ga0209673_1000032 3300025273 Bacteria 339956
118 Ga0209673_1000807 3300025273 Bacteria 41435
119 Ga0209675_1000020 3300025291 Bacteria 335854
120 Ga0209676_1000149 3300025292 Bacteria 167854
121 Ga0209676_1000200 3300025292 Bacteria 133793
122 Ga0209676_1000466 3300025292 Bacteria 68081
123 Ga0209676_1001673 3300025292 Bacteria 19241
124 Ga0209564_1000983 3300025295 Bacteria 35799
125 Ga0209050_1000057 3300025298 Bacteria 326289
126 Ga0209050_1000189 3300025298 Bacteria 138610
127 Ga0209050_1000491 3300025298 Bacteria 68285
128 Ga0209050_1010759 3300025298 Bacteria 4458
129 Ga0209256_1002971 3300025299 Bacteria 12672
130 Ga0209256_1004238 3300025299 Bacteria 9190
131 Ga0209256_1017850 3300025299 Bacteria 2335
132 Ga0209051_1001075 3300025303 Bacteria 25368
133 Ga0209051_1003331 3300025303 Bacteria 10618
134 Ga0209257_1000702 3300025304 Bacteria 51789
135 Ga0209257_1002610 3300025304 Bacteria 17444
136 Ga0209257_1002644 3300025304 Bacteria 17240
137 Ga0209257_1005788 3300025304 Bacteria 8417
138 Ga0209257_1011932 3300025304 Bacteria 4098
139 Ga0207713_1019503 3300025735 Bacteria 3313
140 Ga0207710_10000003 3300025900 Bacteria 1071597
141 Ga0207705_10004308 3300025909 Bacteria 10771
142 Ga0207684_10016445 3300025910 Bacteria 6352
143 Ga0207657_10055696 3300025919 Bacteria 3414
144 Ga0207681_10004725 3300025923 Bacteria 8381
145 Ga0207694_10000001 3300025924 Bacteria 4078485
146 Ga0207650_10000105 3300025925 Bacteria 110180
147 Ga0207659_10051294 3300025926 Bacteria 2933
148 Ga0207687_10000002 3300025927 Bacteria 975489
149 Ga0207644_10003478 3300025931 Bacteria 10183
150 Ga0207706_10035950 3300025933 Bacteria 4401
151 Ga0207686_10000028 3300025934 Bacteria 163090
152 Ga0207686_10000384 3300025934 Bacteria 30891
153 Ga0207709_10000082 3300025935 Bacteria 163123
154 Ga0207709_10000339 3300025935 Bacteria 48683
155 Ga0207709_10012330 3300025935 Bacteria 4711
156 Ga0207691_10010787 3300025940 Bacteria 8771
157 Ga0207661_10000004 3300025944 Bacteria 606391
158 Ga0207661_10029963 3300025944 Bacteria 4185
159 Ga0207712_10014287 3300025961 Bacteria 5104
160 Ga0207668_10001968 3300025972 Bacteria 12019
161 Ga0207640_10013374 3300025981 Bacteria 4700
162 Ga0207677_10000103 3300026023 Bacteria 70458
163 Ga0207703_10003021 3300026035 Bacteria 14260
164 Ga0207703_10043985 3300026035 Bacteria 3587
165 Ga0207702_10001060 3300026078 Bacteria 28175
166 Ga0207674_10028960 3300026116 Bacteria 5838
167 Ga0207674_10042526 3300026116 Bacteria 4692
168 Ga0209371_1000028 3300027312 Bacteria 429688
169 Ga0268266_10022431 3300028379 Bacteria 5381
170 Ga0268265_10007889 3300028380 Bacteria 7185
171 Ga0307515_10038196 3300028794 Bacteria 7690
172 Ga0268256_1000030 3300030500 Bacteria 429688
173 Ga0316183_1111502 3300030742 Bacteria 10051
174 Ga0265327_10000175 3300031251 Bacteria 137193
175 Ga0307414_10016040 3300032004 Bacteria 4542
176 Ga0373937_0036992 3300036401 Bacteria 4448
177 Ga0395905_0003248 3300037471 Bacteria 17479
178 Ga0436365_0547496 3300039437 Bacteria 28109
179 Ga0436365_1667386 3300039437 Bacteria 3814
180 Ga0451576_0095344 3300045051 Bacteria 3094
181 Ga0495627_000679 3300046453 Bacteria 26196
182 Ga0495592_0059325 3300046454 Bacteria 2818
183 Ga0495638_0000206 3300046460 Bacteria 83841
184 Ga0495638_0006683 3300046460 Bacteria 8359
185 Ga0495610_0004177 3300046512 Bacteria 10792
186 Ga0495610_0014024 3300046512 Bacteria 4732
187 Ga0495616_0000160 3300046513 Bacteria 58888
188 Ga0495628_0054108 3300046516 Bacteria 3165
189 Ga0495631_0003990 3300046518 Bacteria 7957
190 Ga0495637_0013681 3300046520 Bacteria 3846
191 Ga0495642_0014069 3300046528 Bacteria 3101
192 Ga0495654_0000123 3300046530 Bacteria 86159
193 Ga0495668_0008784 3300046616 Bacteria 6263
194 Ga0495625_0000816 3300046660 Bacteria 42972
195 Ga0495588_0004791 3300046674 Bacteria 5986
196 Ga0495670_0000004 3300046691 Bacteria 310086
197 Ga0495672_0000079 3300047320 Bacteria 161885
198 Ga0495672_0001824 3300047320 Bacteria 20383
199 Ga0495673_0000094 3300047469 Bacteria 183868
200 Ga0495681_0017622 3300047470 Bacteria 3958
201 Ga0495686_0014578 3300047472 Bacteria 5407
202 Ga0496102_0015199 3300048905 Bacteria 6701
203 Ga0496104_0008616 3300048907 Bacteria 9071
204 Ga0496106_0021365 3300048909 Bacteria 4806
205 Ga0496106_0056975 3300048909 Bacteria 2955
206 Ga0496106_0102459 3300048909 Unclassified 2221
207 Ga0496107_0000349 3300048910 Bacteria 25181
208 Ga0496108_0003556 3300048911 Bacteria 12506
209 Ga0496109_0040948 3300048912 Bacteria 4197
210 Ga0496110_0073983 3300048913 Bacteria 3024
211 Ga0496111_0009985 3300048914 Bacteria 6351
212 Ga0496112_0016263 3300048915 Bacteria 6964
213 Ga0496112_0020046 3300048915 Bacteria 6331
214 Ga0496114_0097902 3300048917 Bacteria 2500
215 Ga0496116_0001561 3300048919 Bacteria 25351
216 Ga0496117_0000483 3300048920 Bacteria 66226
217 Ga0496117_0000763 3300048920 Bacteria 50659
218 Ga0496118_0000433 3300048921 Bacteria 69559
219 Ga0496118_0001923 3300048921 Bacteria 29489
220 Ga0496118_0033191 3300048921 Bacteria 4239
221 Ga0496119_0003899 3300048922 Bacteria 15186
222 Ga0496120_0000564 3300048923 Bacteria 56487
223 Ga0496121_0002092 3300048924 Bacteria 31479
224 Ga0496121_0034294 3300048924 Bacteria 4570
225 Ga0496121_0052937 3300048924 Bacteria 3404
226 Ga0496122_0000341 3300048925 Bacteria 100819
227 Ga0496123_0000276 3300048926 Bacteria 100865
228 Ga0496123_0054166 3300048926 Bacteria 2643
229 Ga0496124_0000384 3300048927 Bacteria 80610
230 Ga0496124_0005407 3300048927 Bacteria 14404
231 Ga0496125_0000543 3300048928 Bacteria 64969
232 Ga0496125_0003859 3300048928 Bacteria 17767
233 Ga0496125_0011469 3300048928 Bacteria 8862
234 Ga0496126_0000546 3300048929 Bacteria 72601
235 nmdc:mga05p37_7126_c1 3300050507 Bacteria 13182
236 nmdc:mga08y16_117065_c1 3300050511 Bacteria 2774
237 nmdc:mga0n895_17282_c1 3300050512 Bacteria 6646
238 nmdc:mga0n895_33562_c1 3300050512 Bacteria 4934
239 nmdc:mga0n895_49_c1 3300050512 Bacteria 73512
240 nmdc:mga0n895_72800_c1 3300050512 Bacteria 3410
241 nmdc:mga0rr50_11_c1 3300050513 Bacteria 216152
242 nmdc:mga0rr50_67975_c1 3300050513 Bacteria 2709
243 nmdc:mga08x19_435_c1 3300050514 Bacteria 28614
244 nmdc:mga0a205_54840_c1 3300050515 Bacteria 3849
245 nmdc:mga0a205_94659_c1 3300050515 Bacteria 2886
246 Ga0500595_008544 3300053119 Bacteria 4179
247 Ga0500608_000101 3300053122 Bacteria 34992
248 Ga0500618_000255 3300053125 Bacteria 41984
249 Ga0500559_0000243 3300053136 Bacteria 43046
250 Ga0500627_0007706 3300053158 Bacteria 3772
251 2511124613 2510917020 Bacteria 5657507
252 2525558302 2524614729 Bacteria 3091755
253 2547499626 2547132130 Bacteria 4660562
254 2578459839 2576861471 Bacteria 4648976
255 2630650290 2627854209 Bacteria 3093011
256 2643747919 2643221545 Bacteria 5083237
257 2643926160 2643221583 Bacteria 5218014
258 2644507977 2643221691 Bacteria 5093099
259 2747951183 2747842428 Bacteria 4689383
260 2765577466 2765235840 Bacteria 4663337
261 2816519237 2816332141 Bacteria 4436036
262 2819536787 2818991435 Bacteria 5433759
263 2819645948 2818991454 Bacteria 5563326
264 2842392462 2842391507 Bacteria 4486072
265 2842761216 2842757796 Bacteria 3981385
266 2852653442 2852649853 Bacteria 4036942
267 2857446600 2857442823 Bacteria 4562550
268 2857506699 2857504554 Bacteria 5369913
269 2874224316 2874220319 Bacteria 4594709
270 2919092002 2919089067 Bacteria 4560942
271 2919135261 2919134579 Bacteria 4480386
272 2928498634 2928496128 Bacteria 4631123
273 2931382278 2931380184 Bacteria 4455911
274 2937613038 2937610967 Bacteria 4618818
275 2939592374 2939589442 Bacteria 4214238
276 2939625343 2939622612 Bacteria 4698046
277 2939630351 2939626828 Bacteria 4695272
278 2941477574 2941475908 Bacteria 4145589
279 2961051080 2961047084 Bacteria 4594415
280 2961065380 2961064222 Bacteria 4749990
281 2974310273 2974307012 Bacteria 4172388
282 2977251000 2977247770 Bacteria 4160543
283 2984514507 2984514374 Bacteria 4172479
284 2987608986 2987605356 Bacteria 4187822
285 Ga0105245_10105192
286 JGI24748J21848_1000014
287 JGI24034J26672_10000012
288 rootH2_10011429
289 Ga0055526_1003151
290 Ga0055537_1000028
291 Ga0055524_1003547
292 Ga0055536_1001186
293 Ga0055536_1001488
294 Ga0055534_1000411
295 Ga0055528_1004685
296 Ga0055528_1007531
297 Ga0055530_10001142
298 Ga0055530_10001167
299 Ga0055530_10004254
300 Ga0055531_10000799
301 Ga0058692_1000026
302 Ga0065712_10081270
303 Ga0070658_10000761
304 Ga0070683_100000017
305 Ga0070683_100047549
306 Ga0070670_100000400
307 Ga0068868_100000040
308 Ga0070668_100004802
309 Ga0070668_100021281
310 Ga0070669_100012123
311 Ga0070669_100052834
312 Ga0070675_100033019
313 Ga0070671_100027740
314 Ga0070673_100025877
315 Ga0070688_100040948
316 Ga0070713_100018300
317 Ga0070701_10010264
318 Ga0070705_100000076
319 Ga0070694_100000101
320 Ga0070694_100000348
321 Ga0070694_100001916
322 Ga0070708_100108885
323 Ga0070662_100059575
324 Ga0070681_10004938
325 Ga0070681_10029847
326 Ga0070706_100023318
327 Ga0070698_100000117
328 Ga0070698_100001577
329 Ga0070699_100010562
330 Ga0070684_100000016
331 Ga0070697_100004313
332 Ga0068853_100007903
333 Ga0070696_100000574
334 Ga0070696_100027855
335 Ga0070693_100000328
336 Ga0070665_100025208
337 Ga0070665_100049922
338 Ga0070665_100134176
339 Ga0070704_100009224
340 Ga0070664_100000737
341 Ga0070664_100024312
342 Ga0068856_100001290
343 Ga0068856_100014309
344 Ga0068852_100059812
345 Ga0068859_100060868
346 Ga0068864_100011874
347 Ga0068858_100004226
348 Ga0068862_100007865
349 Ga0075367_10006982
350 Ga0075367_10023644
351 Ga0068871_100082791
352 Ga0075433_10036166
353 Ga0075434_100000085
354 Ga0075434_100000096
355 Ga0075434_100013141
356 Ga0075434_100088981
357 Ga0075436_100000505
358 Ga0097620_100060872
359 Ga0075435_100000001
360 Ga0075435_100015555
361 Ga0105251_10002747
362 Ga0105240_10029661
363 Ga0111539_10073052
364 Ga0105245_10000057
365 Ga0105245_10057562
366 Ga0105247_10000050
367 Ga0114129_10022462
368 Ga0114129_10028077
369 Ga0114129_10160613
370 Ga0105243_10000050
371 Ga0105243_10000393
372 Ga0105241_10002677
373 Ga0105242_10000189
374 Ga0105242_10000313
375 Ga0105242_10002875
376 Ga0105238_10000001
377 Ga0105249_10119260
378 Ga0157371_10000372
379 Ga0157370_10010424
380 Ga0157369_10006660
381 Ga0157374_10000010
382 Ga0157378_10000004
383 Ga0163162_10108039
384 Ga0157372_10022940
385 Ga0157375_10000941
386 Ga0157375_10004838
387 Ga0163163_10003159
388 Ga0163163_10062024
389 Ga0182008_10000090
390 Ga0157377_10000019
391 Ga0157379_10014436
392 Ga0157376_10000019
393 Ga0157376_10038049
394 Ga0182006_1008133
395 Ga0182006_1017729
396 Ga0182007_10000025
397 Ga0182005_1000063
398 Ga0163161_10000600
399 Ga0209565_1000037
400 Ga0209565_1002061
401 Ga0209673_1000032
402 Ga0209673_1000807
403 Ga0209675_1000020
404 Ga0209676_1000149
405 Ga0209676_1000200
406 Ga0209676_1000466
407 Ga0209676_1001673
408 Ga0209564_1000983
409 Ga0209050_1000057
410 Ga0209050_1000189
411 Ga0209050_1000491
412 Ga0209050_1010759
413 Ga0209256_1002971
414 Ga0209256_1004238
415 Ga0209256_1017850
416 Ga0209051_1001075
417 Ga0209051_1003331
418 Ga0209257_1000702
419 Ga0209257_1002610
420 Ga0209257_1002644
421 Ga0209257_1005788
422 Ga0209257_1011932
423 Ga0207713_1019503
424 Ga0207710_10000003
425 Ga0207705_10004308
426 Ga0207684_10016445
427 Ga0207657_10055696
428 Ga0207681_10004725
429 Ga0207694_10000001
430 Ga0207650_10000105
431 Ga0207659_10051294
432 Ga0207687_10000002
433 Ga0207644_10003478
434 Ga0207706_10035950
435 Ga0207686_10000028
436 Ga0207686_10000384
437 Ga0207709_10000082
438 Ga0207709_10000339
439 Ga0207709_10012330
440 Ga0207691_10010787
441 Ga0207661_10000004
442 Ga0207661_10029963
443 Ga0207712_10014287
444 Ga0207668_10001968
445 Ga0207640_10013374
446 Ga0207677_10000103
447 Ga0207703_10003021
448 Ga0207703_10043985
449 Ga0207702_10001060
450 Ga0207674_10028960
451 Ga0207674_10042526
452 Ga0209371_1000028
453 Ga0268266_10022431
454 Ga0268265_10007889
455 Ga0307515_10038196
456 Ga0268256_1000030
457 Ga0316183_1111502
458 Ga0265327_10000175
459 Ga0307414_10016040
460 Ga0373937_0036992
461 Ga0395905_0003248
462 Ga0436365_0547496
463 Ga0436365_1667386
464 Ga0451576_0095344
465 Ga0495627_000679
466 Ga0495592_0059325
467 Ga0495638_0000206
468 Ga0495638_0006683
469 Ga0495610_0004177
470 Ga0495610_0014024
471 Ga0495616_0000160
472 Ga0495628_0054108
473 Ga0495631_0003990
474 Ga0495637_0013681
475 Ga0495642_0014069
476 Ga0495654_0000123
477 Ga0495668_0008784
478 Ga0495625_0000816
479 Ga0495588_0004791
480 Ga0495670_0000004
481 Ga0495672_0000079
482 Ga0495672_0001824
483 Ga0495673_0000094
484 Ga0495681_0017622
485 Ga0495686_0014578
486 Ga0496102_0015199
487 Ga0496104_0008616
488 Ga0496106_0021365
489 Ga0496106_0056975
490 Ga0496106_0102459
491 Ga0496107_0000349
492 Ga0496108_0003556
493 Ga0496109_0040948
494 Ga0496110_0073983
495 Ga0496111_0009985
496 Ga0496112_0016263
497 Ga0496112_0020046
498 Ga0496114_0097902
499 Ga0496116_0001561
500 Ga0496117_0000483
501 Ga0496117_0000763
502 Ga0496118_0000433
503 Ga0496118_0001923
504 Ga0496118_0033191
505 Ga0496119_0003899
506 Ga0496120_0000564
507 Ga0496121_0002092
508 Ga0496121_0034294
509 Ga0496121_0052937
510 Ga0496122_0000341
511 Ga0496123_0000276
512 Ga0496123_0054166
513 Ga0496124_0000384
514 Ga0496124_0005407
515 Ga0496125_0000543
516 Ga0496125_0003859
517 Ga0496125_0011469
518 Ga0496126_0000546
519 nmdc:mga05p37_7126_c1
520 nmdc:mga08y16_117065_c1
521 nmdc:mga0n895_17282_c1
522 nmdc:mga0n895_33562_c1
523 nmdc:mga0n895_49_c1
524 nmdc:mga0n895_72800_c1
525 nmdc:mga0rr50_11_c1
526 nmdc:mga0rr50_67975_c1
527 nmdc:mga08x19_435_c1
528 nmdc:mga0a205_54840_c1
529 nmdc:mga0a205_94659_c1
530 Ga0500595_008544
531 Ga0500608_000101
532 Ga0500618_000255
533 Ga0500559_0000243
534 Ga0500627_0007706
535 2511124613
536 2525558302
537 2547499626
538 2578459839
539 2630650290
540 2643747919
541 2643926160
542 2644507977
543 2747951183
544 2765577466
545 2816519237
546 2819536787
547 2819645948
548 2842392462
549 2842761216
550 2852653442
551 2857446600
552 2857506699
553 2874224316
554 2919092002
555 2919135261
556 2928498634
557 2931382278
558 2937613038
559 2939592374
560 2939625343
561 2939630351
562 2941477574
563 2961051080
564 2961065380
565 2974310273
566 2977251000
567 2984514507
568 2987608986

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01431

Peptidase_M13

Peptidase family M13

520

720

0.97

PF05649

Peptidase_M13_N

Peptidase family M13

83

468

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zuk-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis zinc metalloprotease zmp1 in complex with inhibitor 0.9521 37 683
3zuk-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis zinc metalloprotease zmp1 in complex with inhibitor 0.9364 37 683
5v48-assembly1.cif.gz_B soluble rabbit neprilysin in complex with thiorphan 0.909 41 685
4cth-assembly1.cif.gz_A-2 neprilysin variant g399v,g714k in complex with phosphoramidon 0.9068 41 685
6svy-assembly1.cif.gz_A crystal structure of neprilysin in complex with sampatrilat-asp. 0.9056 41 685
ID Description Score Start End Superfamily
af_P0DPD6_499_804_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.9473 386 674 3.40.390.10
af_A0A0B4K692_465_770_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.9424 393 673 3.40.390.10
af_F1R6K1_425_745_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.939 387 685 3.40.390.10
3zukA02 Mainly Alpha;Orthogonal Bundle;Neutral endopeptidase; domain 2;Neutral endopeptidase , domain2 0.9343 76 469 1.10.1380.10
3zukA02 Mainly Alpha;Orthogonal Bundle;Neutral endopeptidase; domain 2;Neutral endopeptidase , domain2 0.9317 76 469 1.10.1380.10
ID Description Score Start End GO Terms
AF-T1AQY9-F1-model_v4 Metallopeptidase 0.9884 478 592 GO:0004222
GO:0005886
GO:0016485
AF-A0A6P3Z4T4-F1-model_v4 Neprilysin-3-like 0.9872 41 544 GO:0004222
GO:0005886
GO:0016485
GO:0046872
AF-A0A7Y5FHJ8-F1-model_v4 M13 family metallopeptidase 0.9866 482 685 GO:0004222
GO:0005886
GO:0016485
AF-A0A4Q3TUB8-F1-model_v4 M13 family peptidase 0.986 317 685 GO:0004222
GO:0005886
GO:0016485
GO:0046872
AF-A0A833GHM9-F1-model_v4 M13 family metallopeptidase 0.9853 141 522 GO:0004222
GO:0005886
GO:0016485
GO:0046872

Map