F386162
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 284 | 210 | 568 | 682 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_10105192|Ga0105245_101051922 |
| Length | 723 |
| Sequence | LTLAFSPEYARQTQVIPGKTIEQVNHVTQQGLQMTLKNMRAKHLKVLAVVLALILAGGNVLLSTRGTRAQGIDLAGIDKSIDPGDDFFGYANGTWSRAAQIPSDRPSYGAFDAIAEKVNARTADLIRSAGKSANDPEAQKIGDYYDAFMNEDAIEKKGLAPIKTELDEINGIADKTALARVLGSQLRADVDPLNSTNFYTDRLFGIWVSPDFNNPTHNVAYMLQGGLGLPDRDNYLGTEKDDLELQAKYREHIVTILKLAQVADAEAKAARIYDLEKMIATAHATRTDSADVQKANNPWAMKDFSTKAAGLDWTTYFKAAGLSAQPTIIVWHPGGVAGISRLVGSQPLEVWKEYLTFHVIDRASGLLPKPFATERFKFYGTTLNGIPQQSDRWKRAISNTSAALGDAVGKLYVHKYFPPEAKARIQEMVKNIIASFGRRIDNLTWMTPATKAKAKAKLGTLYVGVGYPEHWRDYAGLKILRDDPLGNGQRSDLFDYQWTLSKLSKPVDKTEWWMTPQTVNAVNLPIQNGLNFPAAILNPPFFDPNADPVENYGSIGATIGHEISHSFDDQGSQFDAYGKLQNWWTPADLEHFRAAADRLAAQXXXYEPLPSMHVNGKLTLSENIADVAGLSAAYDAYRTAYGDKPSANAKGLTNDQRFFIAYAQSWRSKVRPEFLKVLLTTDGHAPDQYRADTVRNLDAWYQAFNIQPGRKLYLAPEARVRVW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 56 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 80 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 81 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 119 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 120 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 121 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 122 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 123 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 125 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 126 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 127 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 146 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 147 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 148 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 149 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 152 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 153 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 154 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 155 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 156 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 157 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 158 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 159 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 160 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 161 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 162 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 163 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 164 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 165 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 166 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 173 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 174 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 175 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 176 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 177 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 178 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 179 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 180 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 181 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 182 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 183 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 184 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 185 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 186 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 187 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 188 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 189 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 190 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 191 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 192 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 193 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 194 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 195 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 196 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 197 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 198 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 199 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 200 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 201 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 202 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 203 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 204 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 205 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 206 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 207 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 208 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 209 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 210 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.03 |
| Metatranscriptomes | 0 |
| Isolates | 11.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.35 |
| Bulb | 0 |
| Endosphere | 15.14 |
| Nodule | 0.35 |
| Rhizoplane | 4.58 |
| Rhizosphere | 64.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105245_10105192 | 3300009098 | Bacteria | 2618 |
| 2 | JGI24748J21848_1000014 | 3300002074 | Bacteria | 147126 |
| 3 | JGI24034J26672_10000012 | 3300002239 | Bacteria | 146139 |
| 4 | rootH2_10011429 | 3300003320 | Bacteria | 15141 |
| 5 | Ga0055526_1003151 | 3300003771 | Bacteria | 10684 |
| 6 | Ga0055537_1000028 | 3300003773 | Bacteria | 102200 |
| 7 | Ga0055524_1003547 | 3300003775 | Bacteria | 7535 |
| 8 | Ga0055536_1001186 | 3300003781 | Bacteria | 16236 |
| 9 | Ga0055536_1001488 | 3300003781 | Bacteria | 14090 |
| 10 | Ga0055534_1000411 | 3300003784 | Bacteria | 26197 |
| 11 | Ga0055528_1004685 | 3300003790 | Bacteria | 6535 |
| 12 | Ga0055528_1007531 | 3300003790 | Bacteria | 4800 |
| 13 | Ga0055530_10001142 | 3300003791 | Bacteria | 20657 |
| 14 | Ga0055530_10001167 | 3300003791 | Bacteria | 20372 |
| 15 | Ga0055530_10004254 | 3300003791 | Bacteria | 7496 |
| 16 | Ga0055531_10000799 | 3300003794 | Bacteria | 26105 |
| 17 | Ga0058692_1000026 | 3300003856 | Bacteria | 203096 |
| 18 | Ga0065712_10081270 | 3300005290 | Bacteria | 3009 |
| 19 | Ga0070658_10000761 | 3300005327 | Bacteria | 27668 |
| 20 | Ga0070683_100000017 | 3300005329 | Bacteria | 207189 |
| 21 | Ga0070683_100047549 | 3300005329 | Bacteria | 3965 |
| 22 | Ga0070670_100000400 | 3300005331 | Bacteria | 35600 |
| 23 | Ga0068868_100000040 | 3300005338 | Bacteria | 70432 |
| 24 | Ga0070668_100004802 | 3300005347 | Bacteria | 10017 |
| 25 | Ga0070668_100021281 | 3300005347 | Bacteria | 4902 |
| 26 | Ga0070669_100012123 | 3300005353 | Bacteria | 6118 |
| 27 | Ga0070669_100052834 | 3300005353 | Bacteria | 2974 |
| 28 | Ga0070675_100033019 | 3300005354 | Bacteria | 4193 |
| 29 | Ga0070671_100027740 | 3300005355 | Bacteria | 4662 |
| 30 | Ga0070673_100025877 | 3300005364 | Bacteria | 4326 |
| 31 | Ga0070688_100040948 | 3300005365 | Bacteria | 2841 |
| 32 | Ga0070713_100018300 | 3300005436 | Bacteria | 5326 |
| 33 | Ga0070701_10010264 | 3300005438 | Bacteria | 4134 |
| 34 | Ga0070705_100000076 | 3300005440 | Bacteria | 53948 |
| 35 | Ga0070694_100000101 | 3300005444 | Bacteria | 41614 |
| 36 | Ga0070694_100000348 | 3300005444 | Bacteria | 24822 |
| 37 | Ga0070694_100001916 | 3300005444 | Bacteria | 12310 |
| 38 | Ga0070708_100108885 | 3300005445 | Bacteria | 2545 |
| 39 | Ga0070662_100059575 | 3300005457 | Bacteria | 2781 |
| 40 | Ga0070681_10004938 | 3300005458 | Bacteria | 12820 |
| 41 | Ga0070681_10029847 | 3300005458 | Bacteria | 5473 |
| 42 | Ga0070706_100023318 | 3300005467 | Bacteria | 5701 |
| 43 | Ga0070698_100000117 | 3300005471 | Bacteria | 67940 |
| 44 | Ga0070698_100001577 | 3300005471 | Bacteria | 25342 |
| 45 | Ga0070699_100010562 | 3300005518 | Bacteria | 7992 |
| 46 | Ga0070684_100000016 | 3300005535 | Bacteria | 139439 |
| 47 | Ga0070697_100004313 | 3300005536 | Bacteria | 10911 |
| 48 | Ga0068853_100007903 | 3300005539 | Bacteria | 8530 |
| 49 | Ga0070696_100000574 | 3300005546 | Bacteria | 23470 |
| 50 | Ga0070696_100027855 | 3300005546 | Bacteria | 3853 |
| 51 | Ga0070693_100000328 | 3300005547 | Bacteria | 21805 |
| 52 | Ga0070665_100025208 | 3300005548 | Bacteria | 5993 |
| 53 | Ga0070665_100049922 | 3300005548 | Bacteria | 4198 |
| 54 | Ga0070665_100134176 | 3300005548 | Bacteria | 2477 |
| 55 | Ga0070704_100009224 | 3300005549 | Bacteria | 5952 |
| 56 | Ga0070664_100000737 | 3300005564 | Bacteria | 25207 |
| 57 | Ga0070664_100024312 | 3300005564 | Bacteria | 5010 |
| 58 | Ga0068856_100001290 | 3300005614 | Bacteria | 26389 |
| 59 | Ga0068856_100014309 | 3300005614 | Bacteria | 7673 |
| 60 | Ga0068852_100059812 | 3300005616 | Bacteria | 3306 |
| 61 | Ga0068859_100060868 | 3300005617 | Bacteria | 3804 |
| 62 | Ga0068864_100011874 | 3300005618 | Bacteria | 7193 |
| 63 | Ga0068858_100004226 | 3300005842 | Bacteria | 14137 |
| 64 | Ga0068862_100007865 | 3300005844 | Bacteria | 8820 |
| 65 | Ga0075367_10006982 | 3300006178 | Bacteria | 5750 |
| 66 | Ga0075367_10023644 | 3300006178 | Bacteria | 3460 |
| 67 | Ga0068871_100082791 | 3300006358 | Bacteria | 2661 |
| 68 | Ga0075433_10036166 | 3300006852 | Bacteria | 4252 |
| 69 | Ga0075434_100000085 | 3300006871 | Bacteria | 50753 |
| 70 | Ga0075434_100000096 | 3300006871 | Bacteria | 48926 |
| 71 | Ga0075434_100013141 | 3300006871 | Bacteria | 7865 |
| 72 | Ga0075434_100088981 | 3300006871 | Bacteria | 3089 |
| 73 | Ga0075436_100000505 | 3300006914 | Bacteria | 25226 |
| 74 | Ga0097620_100060872 | 3300006931 | Bacteria | 3804 |
| 75 | Ga0075435_100000001 | 3300007076 | Bacteria | 207579 |
| 76 | Ga0075435_100015555 | 3300007076 | Bacteria | 5723 |
| 77 | Ga0105251_10002747 | 3300009011 | Bacteria | 13475 |
| 78 | Ga0105240_10029661 | 3300009093 | Bacteria | 7121 |
| 79 | Ga0111539_10073052 | 3300009094 | Bacteria | 4044 |
| 80 | Ga0105245_10000057 | 3300009098 | Bacteria | 124024 |
| 81 | Ga0105245_10057562 | 3300009098 | Bacteria | 3497 |
| 82 | Ga0105247_10000050 | 3300009101 | Bacteria | 146183 |
| 83 | Ga0114129_10022462 | 3300009147 | Bacteria | 8955 |
| 84 | Ga0114129_10028077 | 3300009147 | Bacteria | 7972 |
| 85 | Ga0114129_10160613 | 3300009147 | Bacteria | 3070 |
| 86 | Ga0105243_10000050 | 3300009148 | Bacteria | 142670 |
| 87 | Ga0105243_10000393 | 3300009148 | Bacteria | 46112 |
| 88 | Ga0105241_10002677 | 3300009174 | Bacteria | 13350 |
| 89 | Ga0105242_10000189 | 3300009176 | Bacteria | 47464 |
| 90 | Ga0105242_10000313 | 3300009176 | Bacteria | 38823 |
| 91 | Ga0105242_10002875 | 3300009176 | Bacteria | 13491 |
| 92 | Ga0105238_10000001 | 3300009551 | Bacteria | 2036163 |
| 93 | Ga0105249_10119260 | 3300009553 | Bacteria | 2505 |
| 94 | Ga0157371_10000372 | 3300013102 | Bacteria | 56552 |
| 95 | Ga0157370_10010424 | 3300013104 | Bacteria | 9796 |
| 96 | Ga0157369_10006660 | 3300013105 | Bacteria | 13350 |
| 97 | Ga0157374_10000010 | 3300013296 | Bacteria | 505635 |
| 98 | Ga0157378_10000004 | 3300013297 | Bacteria | 201051 |
| 99 | Ga0163162_10108039 | 3300013306 | Bacteria | 2878 |
| 100 | Ga0157372_10022940 | 3300013307 | Bacteria | 6760 |
| 101 | Ga0157375_10000941 | 3300013308 | Bacteria | 25240 |
| 102 | Ga0157375_10004838 | 3300013308 | Bacteria | 11702 |
| 103 | Ga0163163_10003159 | 3300014325 | Bacteria | 13956 |
| 104 | Ga0163163_10062024 | 3300014325 | Bacteria | 3704 |
| 105 | Ga0182008_10000090 | 3300014497 | Bacteria | 69702 |
| 106 | Ga0157377_10000019 | 3300014745 | Bacteria | 171658 |
| 107 | Ga0157379_10014436 | 3300014968 | Bacteria | 6930 |
| 108 | Ga0157376_10000019 | 3300014969 | Bacteria | 255553 |
| 109 | Ga0157376_10038049 | 3300014969 | Bacteria | 3911 |
| 110 | Ga0182006_1008133 | 3300015261 | Bacteria | 4759 |
| 111 | Ga0182006_1017729 | 3300015261 | Bacteria | 3019 |
| 112 | Ga0182007_10000025 | 3300015262 | Bacteria | 172058 |
| 113 | Ga0182005_1000063 | 3300015265 | Bacteria | 97663 |
| 114 | Ga0163161_10000600 | 3300017792 | Bacteria | 28833 |
| 115 | Ga0209565_1000037 | 3300025263 | Bacteria | 289371 |
| 116 | Ga0209565_1002061 | 3300025263 | Bacteria | 7698 |
| 117 | Ga0209673_1000032 | 3300025273 | Bacteria | 339956 |
| 118 | Ga0209673_1000807 | 3300025273 | Bacteria | 41435 |
| 119 | Ga0209675_1000020 | 3300025291 | Bacteria | 335854 |
| 120 | Ga0209676_1000149 | 3300025292 | Bacteria | 167854 |
| 121 | Ga0209676_1000200 | 3300025292 | Bacteria | 133793 |
| 122 | Ga0209676_1000466 | 3300025292 | Bacteria | 68081 |
| 123 | Ga0209676_1001673 | 3300025292 | Bacteria | 19241 |
| 124 | Ga0209564_1000983 | 3300025295 | Bacteria | 35799 |
| 125 | Ga0209050_1000057 | 3300025298 | Bacteria | 326289 |
| 126 | Ga0209050_1000189 | 3300025298 | Bacteria | 138610 |
| 127 | Ga0209050_1000491 | 3300025298 | Bacteria | 68285 |
| 128 | Ga0209050_1010759 | 3300025298 | Bacteria | 4458 |
| 129 | Ga0209256_1002971 | 3300025299 | Bacteria | 12672 |
| 130 | Ga0209256_1004238 | 3300025299 | Bacteria | 9190 |
| 131 | Ga0209256_1017850 | 3300025299 | Bacteria | 2335 |
| 132 | Ga0209051_1001075 | 3300025303 | Bacteria | 25368 |
| 133 | Ga0209051_1003331 | 3300025303 | Bacteria | 10618 |
| 134 | Ga0209257_1000702 | 3300025304 | Bacteria | 51789 |
| 135 | Ga0209257_1002610 | 3300025304 | Bacteria | 17444 |
| 136 | Ga0209257_1002644 | 3300025304 | Bacteria | 17240 |
| 137 | Ga0209257_1005788 | 3300025304 | Bacteria | 8417 |
| 138 | Ga0209257_1011932 | 3300025304 | Bacteria | 4098 |
| 139 | Ga0207713_1019503 | 3300025735 | Bacteria | 3313 |
| 140 | Ga0207710_10000003 | 3300025900 | Bacteria | 1071597 |
| 141 | Ga0207705_10004308 | 3300025909 | Bacteria | 10771 |
| 142 | Ga0207684_10016445 | 3300025910 | Bacteria | 6352 |
| 143 | Ga0207657_10055696 | 3300025919 | Bacteria | 3414 |
| 144 | Ga0207681_10004725 | 3300025923 | Bacteria | 8381 |
| 145 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 146 | Ga0207650_10000105 | 3300025925 | Bacteria | 110180 |
| 147 | Ga0207659_10051294 | 3300025926 | Bacteria | 2933 |
| 148 | Ga0207687_10000002 | 3300025927 | Bacteria | 975489 |
| 149 | Ga0207644_10003478 | 3300025931 | Bacteria | 10183 |
| 150 | Ga0207706_10035950 | 3300025933 | Bacteria | 4401 |
| 151 | Ga0207686_10000028 | 3300025934 | Bacteria | 163090 |
| 152 | Ga0207686_10000384 | 3300025934 | Bacteria | 30891 |
| 153 | Ga0207709_10000082 | 3300025935 | Bacteria | 163123 |
| 154 | Ga0207709_10000339 | 3300025935 | Bacteria | 48683 |
| 155 | Ga0207709_10012330 | 3300025935 | Bacteria | 4711 |
| 156 | Ga0207691_10010787 | 3300025940 | Bacteria | 8771 |
| 157 | Ga0207661_10000004 | 3300025944 | Bacteria | 606391 |
| 158 | Ga0207661_10029963 | 3300025944 | Bacteria | 4185 |
| 159 | Ga0207712_10014287 | 3300025961 | Bacteria | 5104 |
| 160 | Ga0207668_10001968 | 3300025972 | Bacteria | 12019 |
| 161 | Ga0207640_10013374 | 3300025981 | Bacteria | 4700 |
| 162 | Ga0207677_10000103 | 3300026023 | Bacteria | 70458 |
| 163 | Ga0207703_10003021 | 3300026035 | Bacteria | 14260 |
| 164 | Ga0207703_10043985 | 3300026035 | Bacteria | 3587 |
| 165 | Ga0207702_10001060 | 3300026078 | Bacteria | 28175 |
| 166 | Ga0207674_10028960 | 3300026116 | Bacteria | 5838 |
| 167 | Ga0207674_10042526 | 3300026116 | Bacteria | 4692 |
| 168 | Ga0209371_1000028 | 3300027312 | Bacteria | 429688 |
| 169 | Ga0268266_10022431 | 3300028379 | Bacteria | 5381 |
| 170 | Ga0268265_10007889 | 3300028380 | Bacteria | 7185 |
| 171 | Ga0307515_10038196 | 3300028794 | Bacteria | 7690 |
| 172 | Ga0268256_1000030 | 3300030500 | Bacteria | 429688 |
| 173 | Ga0316183_1111502 | 3300030742 | Bacteria | 10051 |
| 174 | Ga0265327_10000175 | 3300031251 | Bacteria | 137193 |
| 175 | Ga0307414_10016040 | 3300032004 | Bacteria | 4542 |
| 176 | Ga0373937_0036992 | 3300036401 | Bacteria | 4448 |
| 177 | Ga0395905_0003248 | 3300037471 | Bacteria | 17479 |
| 178 | Ga0436365_0547496 | 3300039437 | Bacteria | 28109 |
| 179 | Ga0436365_1667386 | 3300039437 | Bacteria | 3814 |
| 180 | Ga0451576_0095344 | 3300045051 | Bacteria | 3094 |
| 181 | Ga0495627_000679 | 3300046453 | Bacteria | 26196 |
| 182 | Ga0495592_0059325 | 3300046454 | Bacteria | 2818 |
| 183 | Ga0495638_0000206 | 3300046460 | Bacteria | 83841 |
| 184 | Ga0495638_0006683 | 3300046460 | Bacteria | 8359 |
| 185 | Ga0495610_0004177 | 3300046512 | Bacteria | 10792 |
| 186 | Ga0495610_0014024 | 3300046512 | Bacteria | 4732 |
| 187 | Ga0495616_0000160 | 3300046513 | Bacteria | 58888 |
| 188 | Ga0495628_0054108 | 3300046516 | Bacteria | 3165 |
| 189 | Ga0495631_0003990 | 3300046518 | Bacteria | 7957 |
| 190 | Ga0495637_0013681 | 3300046520 | Bacteria | 3846 |
| 191 | Ga0495642_0014069 | 3300046528 | Bacteria | 3101 |
| 192 | Ga0495654_0000123 | 3300046530 | Bacteria | 86159 |
| 193 | Ga0495668_0008784 | 3300046616 | Bacteria | 6263 |
| 194 | Ga0495625_0000816 | 3300046660 | Bacteria | 42972 |
| 195 | Ga0495588_0004791 | 3300046674 | Bacteria | 5986 |
| 196 | Ga0495670_0000004 | 3300046691 | Bacteria | 310086 |
| 197 | Ga0495672_0000079 | 3300047320 | Bacteria | 161885 |
| 198 | Ga0495672_0001824 | 3300047320 | Bacteria | 20383 |
| 199 | Ga0495673_0000094 | 3300047469 | Bacteria | 183868 |
| 200 | Ga0495681_0017622 | 3300047470 | Bacteria | 3958 |
| 201 | Ga0495686_0014578 | 3300047472 | Bacteria | 5407 |
| 202 | Ga0496102_0015199 | 3300048905 | Bacteria | 6701 |
| 203 | Ga0496104_0008616 | 3300048907 | Bacteria | 9071 |
| 204 | Ga0496106_0021365 | 3300048909 | Bacteria | 4806 |
| 205 | Ga0496106_0056975 | 3300048909 | Bacteria | 2955 |
| 206 | Ga0496106_0102459 | 3300048909 | Unclassified | 2221 |
| 207 | Ga0496107_0000349 | 3300048910 | Bacteria | 25181 |
| 208 | Ga0496108_0003556 | 3300048911 | Bacteria | 12506 |
| 209 | Ga0496109_0040948 | 3300048912 | Bacteria | 4197 |
| 210 | Ga0496110_0073983 | 3300048913 | Bacteria | 3024 |
| 211 | Ga0496111_0009985 | 3300048914 | Bacteria | 6351 |
| 212 | Ga0496112_0016263 | 3300048915 | Bacteria | 6964 |
| 213 | Ga0496112_0020046 | 3300048915 | Bacteria | 6331 |
| 214 | Ga0496114_0097902 | 3300048917 | Bacteria | 2500 |
| 215 | Ga0496116_0001561 | 3300048919 | Bacteria | 25351 |
| 216 | Ga0496117_0000483 | 3300048920 | Bacteria | 66226 |
| 217 | Ga0496117_0000763 | 3300048920 | Bacteria | 50659 |
| 218 | Ga0496118_0000433 | 3300048921 | Bacteria | 69559 |
| 219 | Ga0496118_0001923 | 3300048921 | Bacteria | 29489 |
| 220 | Ga0496118_0033191 | 3300048921 | Bacteria | 4239 |
| 221 | Ga0496119_0003899 | 3300048922 | Bacteria | 15186 |
| 222 | Ga0496120_0000564 | 3300048923 | Bacteria | 56487 |
| 223 | Ga0496121_0002092 | 3300048924 | Bacteria | 31479 |
| 224 | Ga0496121_0034294 | 3300048924 | Bacteria | 4570 |
| 225 | Ga0496121_0052937 | 3300048924 | Bacteria | 3404 |
| 226 | Ga0496122_0000341 | 3300048925 | Bacteria | 100819 |
| 227 | Ga0496123_0000276 | 3300048926 | Bacteria | 100865 |
| 228 | Ga0496123_0054166 | 3300048926 | Bacteria | 2643 |
| 229 | Ga0496124_0000384 | 3300048927 | Bacteria | 80610 |
| 230 | Ga0496124_0005407 | 3300048927 | Bacteria | 14404 |
| 231 | Ga0496125_0000543 | 3300048928 | Bacteria | 64969 |
| 232 | Ga0496125_0003859 | 3300048928 | Bacteria | 17767 |
| 233 | Ga0496125_0011469 | 3300048928 | Bacteria | 8862 |
| 234 | Ga0496126_0000546 | 3300048929 | Bacteria | 72601 |
| 235 | nmdc:mga05p37_7126_c1 | 3300050507 | Bacteria | 13182 |
| 236 | nmdc:mga08y16_117065_c1 | 3300050511 | Bacteria | 2774 |
| 237 | nmdc:mga0n895_17282_c1 | 3300050512 | Bacteria | 6646 |
| 238 | nmdc:mga0n895_33562_c1 | 3300050512 | Bacteria | 4934 |
| 239 | nmdc:mga0n895_49_c1 | 3300050512 | Bacteria | 73512 |
| 240 | nmdc:mga0n895_72800_c1 | 3300050512 | Bacteria | 3410 |
| 241 | nmdc:mga0rr50_11_c1 | 3300050513 | Bacteria | 216152 |
| 242 | nmdc:mga0rr50_67975_c1 | 3300050513 | Bacteria | 2709 |
| 243 | nmdc:mga08x19_435_c1 | 3300050514 | Bacteria | 28614 |
| 244 | nmdc:mga0a205_54840_c1 | 3300050515 | Bacteria | 3849 |
| 245 | nmdc:mga0a205_94659_c1 | 3300050515 | Bacteria | 2886 |
| 246 | Ga0500595_008544 | 3300053119 | Bacteria | 4179 |
| 247 | Ga0500608_000101 | 3300053122 | Bacteria | 34992 |
| 248 | Ga0500618_000255 | 3300053125 | Bacteria | 41984 |
| 249 | Ga0500559_0000243 | 3300053136 | Bacteria | 43046 |
| 250 | Ga0500627_0007706 | 3300053158 | Bacteria | 3772 |
| 251 | 2511124613 | 2510917020 | Bacteria | 5657507 |
| 252 | 2525558302 | 2524614729 | Bacteria | 3091755 |
| 253 | 2547499626 | 2547132130 | Bacteria | 4660562 |
| 254 | 2578459839 | 2576861471 | Bacteria | 4648976 |
| 255 | 2630650290 | 2627854209 | Bacteria | 3093011 |
| 256 | 2643747919 | 2643221545 | Bacteria | 5083237 |
| 257 | 2643926160 | 2643221583 | Bacteria | 5218014 |
| 258 | 2644507977 | 2643221691 | Bacteria | 5093099 |
| 259 | 2747951183 | 2747842428 | Bacteria | 4689383 |
| 260 | 2765577466 | 2765235840 | Bacteria | 4663337 |
| 261 | 2816519237 | 2816332141 | Bacteria | 4436036 |
| 262 | 2819536787 | 2818991435 | Bacteria | 5433759 |
| 263 | 2819645948 | 2818991454 | Bacteria | 5563326 |
| 264 | 2842392462 | 2842391507 | Bacteria | 4486072 |
| 265 | 2842761216 | 2842757796 | Bacteria | 3981385 |
| 266 | 2852653442 | 2852649853 | Bacteria | 4036942 |
| 267 | 2857446600 | 2857442823 | Bacteria | 4562550 |
| 268 | 2857506699 | 2857504554 | Bacteria | 5369913 |
| 269 | 2874224316 | 2874220319 | Bacteria | 4594709 |
| 270 | 2919092002 | 2919089067 | Bacteria | 4560942 |
| 271 | 2919135261 | 2919134579 | Bacteria | 4480386 |
| 272 | 2928498634 | 2928496128 | Bacteria | 4631123 |
| 273 | 2931382278 | 2931380184 | Bacteria | 4455911 |
| 274 | 2937613038 | 2937610967 | Bacteria | 4618818 |
| 275 | 2939592374 | 2939589442 | Bacteria | 4214238 |
| 276 | 2939625343 | 2939622612 | Bacteria | 4698046 |
| 277 | 2939630351 | 2939626828 | Bacteria | 4695272 |
| 278 | 2941477574 | 2941475908 | Bacteria | 4145589 |
| 279 | 2961051080 | 2961047084 | Bacteria | 4594415 |
| 280 | 2961065380 | 2961064222 | Bacteria | 4749990 |
| 281 | 2974310273 | 2974307012 | Bacteria | 4172388 |
| 282 | 2977251000 | 2977247770 | Bacteria | 4160543 |
| 283 | 2984514507 | 2984514374 | Bacteria | 4172479 |
| 284 | 2987608986 | 2987605356 | Bacteria | 4187822 |
| 285 | Ga0105245_10105192 | |||
| 286 | JGI24748J21848_1000014 | |||
| 287 | JGI24034J26672_10000012 | |||
| 288 | rootH2_10011429 | |||
| 289 | Ga0055526_1003151 | |||
| 290 | Ga0055537_1000028 | |||
| 291 | Ga0055524_1003547 | |||
| 292 | Ga0055536_1001186 | |||
| 293 | Ga0055536_1001488 | |||
| 294 | Ga0055534_1000411 | |||
| 295 | Ga0055528_1004685 | |||
| 296 | Ga0055528_1007531 | |||
| 297 | Ga0055530_10001142 | |||
| 298 | Ga0055530_10001167 | |||
| 299 | Ga0055530_10004254 | |||
| 300 | Ga0055531_10000799 | |||
| 301 | Ga0058692_1000026 | |||
| 302 | Ga0065712_10081270 | |||
| 303 | Ga0070658_10000761 | |||
| 304 | Ga0070683_100000017 | |||
| 305 | Ga0070683_100047549 | |||
| 306 | Ga0070670_100000400 | |||
| 307 | Ga0068868_100000040 | |||
| 308 | Ga0070668_100004802 | |||
| 309 | Ga0070668_100021281 | |||
| 310 | Ga0070669_100012123 | |||
| 311 | Ga0070669_100052834 | |||
| 312 | Ga0070675_100033019 | |||
| 313 | Ga0070671_100027740 | |||
| 314 | Ga0070673_100025877 | |||
| 315 | Ga0070688_100040948 | |||
| 316 | Ga0070713_100018300 | |||
| 317 | Ga0070701_10010264 | |||
| 318 | Ga0070705_100000076 | |||
| 319 | Ga0070694_100000101 | |||
| 320 | Ga0070694_100000348 | |||
| 321 | Ga0070694_100001916 | |||
| 322 | Ga0070708_100108885 | |||
| 323 | Ga0070662_100059575 | |||
| 324 | Ga0070681_10004938 | |||
| 325 | Ga0070681_10029847 | |||
| 326 | Ga0070706_100023318 | |||
| 327 | Ga0070698_100000117 | |||
| 328 | Ga0070698_100001577 | |||
| 329 | Ga0070699_100010562 | |||
| 330 | Ga0070684_100000016 | |||
| 331 | Ga0070697_100004313 | |||
| 332 | Ga0068853_100007903 | |||
| 333 | Ga0070696_100000574 | |||
| 334 | Ga0070696_100027855 | |||
| 335 | Ga0070693_100000328 | |||
| 336 | Ga0070665_100025208 | |||
| 337 | Ga0070665_100049922 | |||
| 338 | Ga0070665_100134176 | |||
| 339 | Ga0070704_100009224 | |||
| 340 | Ga0070664_100000737 | |||
| 341 | Ga0070664_100024312 | |||
| 342 | Ga0068856_100001290 | |||
| 343 | Ga0068856_100014309 | |||
| 344 | Ga0068852_100059812 | |||
| 345 | Ga0068859_100060868 | |||
| 346 | Ga0068864_100011874 | |||
| 347 | Ga0068858_100004226 | |||
| 348 | Ga0068862_100007865 | |||
| 349 | Ga0075367_10006982 | |||
| 350 | Ga0075367_10023644 | |||
| 351 | Ga0068871_100082791 | |||
| 352 | Ga0075433_10036166 | |||
| 353 | Ga0075434_100000085 | |||
| 354 | Ga0075434_100000096 | |||
| 355 | Ga0075434_100013141 | |||
| 356 | Ga0075434_100088981 | |||
| 357 | Ga0075436_100000505 | |||
| 358 | Ga0097620_100060872 | |||
| 359 | Ga0075435_100000001 | |||
| 360 | Ga0075435_100015555 | |||
| 361 | Ga0105251_10002747 | |||
| 362 | Ga0105240_10029661 | |||
| 363 | Ga0111539_10073052 | |||
| 364 | Ga0105245_10000057 | |||
| 365 | Ga0105245_10057562 | |||
| 366 | Ga0105247_10000050 | |||
| 367 | Ga0114129_10022462 | |||
| 368 | Ga0114129_10028077 | |||
| 369 | Ga0114129_10160613 | |||
| 370 | Ga0105243_10000050 | |||
| 371 | Ga0105243_10000393 | |||
| 372 | Ga0105241_10002677 | |||
| 373 | Ga0105242_10000189 | |||
| 374 | Ga0105242_10000313 | |||
| 375 | Ga0105242_10002875 | |||
| 376 | Ga0105238_10000001 | |||
| 377 | Ga0105249_10119260 | |||
| 378 | Ga0157371_10000372 | |||
| 379 | Ga0157370_10010424 | |||
| 380 | Ga0157369_10006660 | |||
| 381 | Ga0157374_10000010 | |||
| 382 | Ga0157378_10000004 | |||
| 383 | Ga0163162_10108039 | |||
| 384 | Ga0157372_10022940 | |||
| 385 | Ga0157375_10000941 | |||
| 386 | Ga0157375_10004838 | |||
| 387 | Ga0163163_10003159 | |||
| 388 | Ga0163163_10062024 | |||
| 389 | Ga0182008_10000090 | |||
| 390 | Ga0157377_10000019 | |||
| 391 | Ga0157379_10014436 | |||
| 392 | Ga0157376_10000019 | |||
| 393 | Ga0157376_10038049 | |||
| 394 | Ga0182006_1008133 | |||
| 395 | Ga0182006_1017729 | |||
| 396 | Ga0182007_10000025 | |||
| 397 | Ga0182005_1000063 | |||
| 398 | Ga0163161_10000600 | |||
| 399 | Ga0209565_1000037 | |||
| 400 | Ga0209565_1002061 | |||
| 401 | Ga0209673_1000032 | |||
| 402 | Ga0209673_1000807 | |||
| 403 | Ga0209675_1000020 | |||
| 404 | Ga0209676_1000149 | |||
| 405 | Ga0209676_1000200 | |||
| 406 | Ga0209676_1000466 | |||
| 407 | Ga0209676_1001673 | |||
| 408 | Ga0209564_1000983 | |||
| 409 | Ga0209050_1000057 | |||
| 410 | Ga0209050_1000189 | |||
| 411 | Ga0209050_1000491 | |||
| 412 | Ga0209050_1010759 | |||
| 413 | Ga0209256_1002971 | |||
| 414 | Ga0209256_1004238 | |||
| 415 | Ga0209256_1017850 | |||
| 416 | Ga0209051_1001075 | |||
| 417 | Ga0209051_1003331 | |||
| 418 | Ga0209257_1000702 | |||
| 419 | Ga0209257_1002610 | |||
| 420 | Ga0209257_1002644 | |||
| 421 | Ga0209257_1005788 | |||
| 422 | Ga0209257_1011932 | |||
| 423 | Ga0207713_1019503 | |||
| 424 | Ga0207710_10000003 | |||
| 425 | Ga0207705_10004308 | |||
| 426 | Ga0207684_10016445 | |||
| 427 | Ga0207657_10055696 | |||
| 428 | Ga0207681_10004725 | |||
| 429 | Ga0207694_10000001 | |||
| 430 | Ga0207650_10000105 | |||
| 431 | Ga0207659_10051294 | |||
| 432 | Ga0207687_10000002 | |||
| 433 | Ga0207644_10003478 | |||
| 434 | Ga0207706_10035950 | |||
| 435 | Ga0207686_10000028 | |||
| 436 | Ga0207686_10000384 | |||
| 437 | Ga0207709_10000082 | |||
| 438 | Ga0207709_10000339 | |||
| 439 | Ga0207709_10012330 | |||
| 440 | Ga0207691_10010787 | |||
| 441 | Ga0207661_10000004 | |||
| 442 | Ga0207661_10029963 | |||
| 443 | Ga0207712_10014287 | |||
| 444 | Ga0207668_10001968 | |||
| 445 | Ga0207640_10013374 | |||
| 446 | Ga0207677_10000103 | |||
| 447 | Ga0207703_10003021 | |||
| 448 | Ga0207703_10043985 | |||
| 449 | Ga0207702_10001060 | |||
| 450 | Ga0207674_10028960 | |||
| 451 | Ga0207674_10042526 | |||
| 452 | Ga0209371_1000028 | |||
| 453 | Ga0268266_10022431 | |||
| 454 | Ga0268265_10007889 | |||
| 455 | Ga0307515_10038196 | |||
| 456 | Ga0268256_1000030 | |||
| 457 | Ga0316183_1111502 | |||
| 458 | Ga0265327_10000175 | |||
| 459 | Ga0307414_10016040 | |||
| 460 | Ga0373937_0036992 | |||
| 461 | Ga0395905_0003248 | |||
| 462 | Ga0436365_0547496 | |||
| 463 | Ga0436365_1667386 | |||
| 464 | Ga0451576_0095344 | |||
| 465 | Ga0495627_000679 | |||
| 466 | Ga0495592_0059325 | |||
| 467 | Ga0495638_0000206 | |||
| 468 | Ga0495638_0006683 | |||
| 469 | Ga0495610_0004177 | |||
| 470 | Ga0495610_0014024 | |||
| 471 | Ga0495616_0000160 | |||
| 472 | Ga0495628_0054108 | |||
| 473 | Ga0495631_0003990 | |||
| 474 | Ga0495637_0013681 | |||
| 475 | Ga0495642_0014069 | |||
| 476 | Ga0495654_0000123 | |||
| 477 | Ga0495668_0008784 | |||
| 478 | Ga0495625_0000816 | |||
| 479 | Ga0495588_0004791 | |||
| 480 | Ga0495670_0000004 | |||
| 481 | Ga0495672_0000079 | |||
| 482 | Ga0495672_0001824 | |||
| 483 | Ga0495673_0000094 | |||
| 484 | Ga0495681_0017622 | |||
| 485 | Ga0495686_0014578 | |||
| 486 | Ga0496102_0015199 | |||
| 487 | Ga0496104_0008616 | |||
| 488 | Ga0496106_0021365 | |||
| 489 | Ga0496106_0056975 | |||
| 490 | Ga0496106_0102459 | |||
| 491 | Ga0496107_0000349 | |||
| 492 | Ga0496108_0003556 | |||
| 493 | Ga0496109_0040948 | |||
| 494 | Ga0496110_0073983 | |||
| 495 | Ga0496111_0009985 | |||
| 496 | Ga0496112_0016263 | |||
| 497 | Ga0496112_0020046 | |||
| 498 | Ga0496114_0097902 | |||
| 499 | Ga0496116_0001561 | |||
| 500 | Ga0496117_0000483 | |||
| 501 | Ga0496117_0000763 | |||
| 502 | Ga0496118_0000433 | |||
| 503 | Ga0496118_0001923 | |||
| 504 | Ga0496118_0033191 | |||
| 505 | Ga0496119_0003899 | |||
| 506 | Ga0496120_0000564 | |||
| 507 | Ga0496121_0002092 | |||
| 508 | Ga0496121_0034294 | |||
| 509 | Ga0496121_0052937 | |||
| 510 | Ga0496122_0000341 | |||
| 511 | Ga0496123_0000276 | |||
| 512 | Ga0496123_0054166 | |||
| 513 | Ga0496124_0000384 | |||
| 514 | Ga0496124_0005407 | |||
| 515 | Ga0496125_0000543 | |||
| 516 | Ga0496125_0003859 | |||
| 517 | Ga0496125_0011469 | |||
| 518 | Ga0496126_0000546 | |||
| 519 | nmdc:mga05p37_7126_c1 | |||
| 520 | nmdc:mga08y16_117065_c1 | |||
| 521 | nmdc:mga0n895_17282_c1 | |||
| 522 | nmdc:mga0n895_33562_c1 | |||
| 523 | nmdc:mga0n895_49_c1 | |||
| 524 | nmdc:mga0n895_72800_c1 | |||
| 525 | nmdc:mga0rr50_11_c1 | |||
| 526 | nmdc:mga0rr50_67975_c1 | |||
| 527 | nmdc:mga08x19_435_c1 | |||
| 528 | nmdc:mga0a205_54840_c1 | |||
| 529 | nmdc:mga0a205_94659_c1 | |||
| 530 | Ga0500595_008544 | |||
| 531 | Ga0500608_000101 | |||
| 532 | Ga0500618_000255 | |||
| 533 | Ga0500559_0000243 | |||
| 534 | Ga0500627_0007706 | |||
| 535 | 2511124613 | |||
| 536 | 2525558302 | |||
| 537 | 2547499626 | |||
| 538 | 2578459839 | |||
| 539 | 2630650290 | |||
| 540 | 2643747919 | |||
| 541 | 2643926160 | |||
| 542 | 2644507977 | |||
| 543 | 2747951183 | |||
| 544 | 2765577466 | |||
| 545 | 2816519237 | |||
| 546 | 2819536787 | |||
| 547 | 2819645948 | |||
| 548 | 2842392462 | |||
| 549 | 2842761216 | |||
| 550 | 2852653442 | |||
| 551 | 2857446600 | |||
| 552 | 2857506699 | |||
| 553 | 2874224316 | |||
| 554 | 2919092002 | |||
| 555 | 2919135261 | |||
| 556 | 2928498634 | |||
| 557 | 2931382278 | |||
| 558 | 2937613038 | |||
| 559 | 2939592374 | |||
| 560 | 2939625343 | |||
| 561 | 2939630351 | |||
| 562 | 2941477574 | |||
| 563 | 2961051080 | |||
| 564 | 2961065380 | |||
| 565 | 2974310273 | |||
| 566 | 2977251000 | |||
| 567 | 2984514507 | |||
| 568 | 2987608986 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3zuk-assembly2.cif.gz_B | crystal structure of mycobacterium tuberculosis zinc metalloprotease zmp1 in complex with inhibitor | 0.9521 | 37 | 683 |
| 3zuk-assembly2.cif.gz_B | crystal structure of mycobacterium tuberculosis zinc metalloprotease zmp1 in complex with inhibitor | 0.9364 | 37 | 683 |
| 5v48-assembly1.cif.gz_B | soluble rabbit neprilysin in complex with thiorphan | 0.909 | 41 | 685 |
| 4cth-assembly1.cif.gz_A-2 | neprilysin variant g399v,g714k in complex with phosphoramidon | 0.9068 | 41 | 685 |
| 6svy-assembly1.cif.gz_A | crystal structure of neprilysin in complex with sampatrilat-asp. | 0.9056 | 41 | 685 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0DPD6_499_804_3.40.390.10 | Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) | 0.9473 | 386 | 674 | 3.40.390.10 |
| af_A0A0B4K692_465_770_3.40.390.10 | Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) | 0.9424 | 393 | 673 | 3.40.390.10 |
| af_F1R6K1_425_745_3.40.390.10 | Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) | 0.939 | 387 | 685 | 3.40.390.10 |
| 3zukA02 | Mainly Alpha;Orthogonal Bundle;Neutral endopeptidase; domain 2;Neutral endopeptidase , domain2 | 0.9343 | 76 | 469 | 1.10.1380.10 |
| 3zukA02 | Mainly Alpha;Orthogonal Bundle;Neutral endopeptidase; domain 2;Neutral endopeptidase , domain2 | 0.9317 | 76 | 469 | 1.10.1380.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-T1AQY9-F1-model_v4 | Metallopeptidase | 0.9884 | 478 | 592 |
GO:0004222
GO:0005886 GO:0016485 |
| AF-A0A6P3Z4T4-F1-model_v4 | Neprilysin-3-like | 0.9872 | 41 | 544 |
GO:0004222
GO:0005886 GO:0016485 GO:0046872 |
| AF-A0A7Y5FHJ8-F1-model_v4 | M13 family metallopeptidase | 0.9866 | 482 | 685 |
GO:0004222
GO:0005886 GO:0016485 |
| AF-A0A4Q3TUB8-F1-model_v4 | M13 family peptidase | 0.986 | 317 | 685 |
GO:0004222
GO:0005886 GO:0016485 GO:0046872 |
| AF-A0A833GHM9-F1-model_v4 | M13 family metallopeptidase | 0.9853 | 141 | 522 |
GO:0004222
GO:0005886 GO:0016485 GO:0046872 |