F386160

General Info

Members Datasets Scaffolds Average Seq Length
284 189 568 355

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10000133|Ga0105245_1000013358
Length 371
Sequence MGVLTATRDDPPMLGGAVSLLVVYAIVFALYVVVPGRWVDGYVTDDAGRVLRYHLNGLIVFAIAIGAWALLCWRDVLAWDAFYQHRVAMLVTAIAVGLVFTAAIVLGSVPTGKSLGADLYLGRLKNPQALGGRVDAKMFLYLIGAVMLELNILSFAAHHVLTYPDDPSPGVYLYAGLFTFFLVEYLFFERVHLYTYDFVAERVGFKLGWGCLAFYPFFYCVGLWFAAGQPSPHESVPWLVMSAVIFFCGWSLARGANLQKFVFKTRPEATHFGPLPQRALRDEVSDRRVLVGGFWGLSRHINYLGELLMATGLALSLGYPASIWPWLYPLYYVGLLVPRQLDDDRRCAAKYGPLWDEYMKTVRWRIIPFVY

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
140 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
141 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
148 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
171 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
179 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
180 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
181 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
182 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
183 2508501039 Frankia saprophytica CN3 Isolate Nodule
184 2517572101 Frankia sp. DC12 Isolate Nodule
185 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
186 2687453737 Frankia sp. BMG5.36 Isolate Nodule
187 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
188 8002775197 Frankia nepalensis CN7 Isolate Nodule
189 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.54
Metatranscriptomes 0
Isolates 2.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.76
Nodule 2.46
Rhizoplane 1.76
Rhizosphere 88.03
Stem 0
Stem Tuber 0
Unclassified 7.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10000133 3300009098 Bacteria 71019
2 JGI24737J22298_10021046 3300001990 Bacteria 2080
3 JGI24743J22301_10002873 3300001991 Bacteria 2655
4 rootH1_10153027 3300003316 Unclassified 1968
5 Ga0065715_10178257 3300005293 Bacteria 1495
6 Ga0070658_10024025 3300005327 Bacteria 4891
7 Ga0070676_10013052 3300005328 Bacteria 4553
8 Ga0070683_100004837 3300005329 Bacteria 11153
9 Ga0070683_100284795 3300005329 Unclassified 1572
10 Ga0070690_100000468 3300005330 Bacteria 20261
11 Ga0070670_100041852 3300005331 Bacteria 3937
12 Ga0070677_10000410 3300005333 Bacteria 14927
13 Ga0068869_100000740 3300005334 Bacteria 18571
14 Ga0070666_10005186 3300005335 Bacteria 7979
15 Ga0070666_10141568 3300005335 Bacteria 1675
16 Ga0070680_100134131 3300005336 Bacteria 2073
17 Ga0070682_100087055 3300005337 Bacteria 2036
18 Ga0068868_100006639 3300005338 Bacteria 8206
19 Ga0070660_100002689 3300005339 Bacteria 12215
20 Ga0070689_100010070 3300005340 Bacteria 6729
21 Ga0070687_100000827 3300005343 Bacteria 10333
22 Ga0070661_100000943 3300005344 Bacteria 20763
23 Ga0070661_100003876 3300005344 Bacteria 10297
24 Ga0070661_100164547 3300005344 Bacteria 1681
25 Ga0070692_10016963 3300005345 Bacteria 3473
26 Ga0070668_100010522 3300005347 Bacteria 6878
27 Ga0070669_100000788 3300005353 Bacteria 23041
28 Ga0070675_100058223 3300005354 Bacteria 3187
29 Ga0070675_100222616 3300005354 Bacteria 1644
30 Ga0070671_100297350 3300005355 Unclassified 1374
31 Ga0070674_100000050 3300005356 Bacteria 51856
32 Ga0070688_100001490 3300005365 Bacteria 11657
33 Ga0070659_100000243 3300005366 Bacteria 42844
34 Ga0070659_100007020 3300005366 Bacteria 8157
35 Ga0070667_100085478 3300005367 Bacteria 2705
36 Ga0070667_100105086 3300005367 Bacteria 2443
37 Ga0070701_10022914 3300005438 Bacteria 3000
38 Ga0070705_100001222 3300005440 Bacteria 13890
39 Ga0070663_100003245 3300005455 Bacteria 9354
40 Ga0070678_100022743 3300005456 Bacteria 4161
41 Ga0070662_100000622 3300005457 Bacteria 21529
42 Ga0070681_10136442 3300005458 Bacteria 2384
43 Ga0068867_100022975 3300005459 Bacteria 4462
44 Ga0070685_10000059 3300005466 Bacteria 64287
45 Ga0070685_10022256 3300005466 Bacteria 3453
46 Ga0070679_100011872 3300005530 Bacteria 8312
47 Ga0070679_100022505 3300005530 Bacteria 6160
48 Ga0070679_100247308 3300005530 Bacteria 1740
49 Ga0068853_100041048 3300005539 Bacteria 3950
50 Ga0068853_100215301 3300005539 Bacteria 1752
51 Ga0070672_100026085 3300005543 Bacteria 4343
52 Ga0070686_100000062 3300005544 Bacteria 82388
53 Ga0068855_100000369 3300005563 Bacteria 55783
54 Ga0068855_100001064 3300005563 Bacteria 34039
55 Ga0068855_100001615 3300005563 Bacteria 28292
56 Ga0068855_100161489 3300005563 Bacteria 2543
57 Ga0068855_100213129 3300005563 Bacteria 2169
58 Ga0070664_100000682 3300005564 Bacteria 25899
59 Ga0068857_100005157 3300005577 Bacteria 11107
60 Ga0068857_100027493 3300005577 Bacteria 5018
61 Ga0068857_100034547 3300005577 Bacteria 4472
62 Ga0068854_100000098 3300005578 Bacteria 61057
63 Ga0068854_100110245 3300005578 Bacteria 2075
64 Ga0068856_100008331 3300005614 Bacteria 10100
65 Ga0068856_100020509 3300005614 Bacteria 6419
66 Ga0068856_100152110 3300005614 Bacteria 2323
67 Ga0068856_100336506 3300005614 Bacteria 1527
68 Ga0068852_100000817 3300005616 Bacteria 20563
69 Ga0068852_100096064 3300005616 Unclassified 2663
70 Ga0068859_100026468 3300005617 Bacteria 5817
71 Ga0068859_100134152 3300005617 Bacteria 2547
72 Ga0068864_100021605 3300005618 Bacteria 5389
73 Ga0068864_100028012 3300005618 Bacteria 4761
74 Ga0068866_10000603 3300005718 Bacteria 16394
75 Ga0068861_100000136 3300005719 Bacteria 37322
76 Ga0068851_10000025 3300005834 Bacteria 123782
77 Ga0068851_10000107 3300005834 Bacteria 44477
78 Ga0068851_10000532 3300005834 Bacteria 16626
79 Ga0068870_10000229 3300005840 Bacteria 20619
80 Ga0068863_100021408 3300005841 Bacteria 6171
81 Ga0068863_100078960 3300005841 Bacteria 3117
82 Ga0068858_100000080 3300005842 Bacteria 100656
83 Ga0068858_100031942 3300005842 Bacteria 4891
84 Ga0068860_100058799 3300005843 Bacteria 3655
85 Ga0081540_1000172 3300005983 Bacteria 67524
86 Ga0081540_1000201 3300005983 Bacteria 62353
87 Ga0081540_1000903 3300005983 Bacteria 26812
88 Ga0070717_10209090 3300006028 Bacteria 1712
89 Ga0070715_10066801 3300006163 Unclassified 1595
90 Ga0097621_100008854 3300006237 Bacteria 7276
91 Ga0097621_100028646 3300006237 Unclassified 4391
92 Ga0075428_100049771 3300006844 Bacteria 4598
93 Ga0075428_100068767 3300006844 Bacteria 3874
94 Ga0075431_100015369 3300006847 Bacteria 7757
95 Ga0075431_100182884 3300006847 Bacteria 2151
96 Ga0075429_100161297 3300006880 Bacteria 1964
97 Ga0068865_100002243 3300006881 Bacteria 11372
98 Ga0097620_100026468 3300006931 Bacteria 5817
99 Ga0097620_100134156 3300006931 Bacteria 2547
100 Ga0105240_10088081 3300009093 Bacteria 3800
101 Ga0105245_10001681 3300009098 Bacteria 20103
102 Ga0105245_10046478 3300009098 Bacteria 3879
103 Ga0105245_10064053 3300009098 Bacteria 3322
104 Ga0114129_10554230 3300009147 Unclassified 1494
105 Ga0105243_10009420 3300009148 Bacteria 7443
106 Ga0105241_10000136 3300009174 Bacteria 52632
107 Ga0105241_10007846 3300009174 Bacteria 7850
108 Ga0105241_10290634 3300009174 Bacteria 1399
109 Ga0105242_10000769 3300009176 Bacteria 24975
110 Ga0105248_10000262 3300009177 Bacteria 61793
111 Ga0105237_10000270 3300009545 Bacteria 73136
112 Ga0105237_10022059 3300009545 Bacteria 6536
113 Ga0105237_10250756 3300009545 Bacteria 1772
114 Ga0105238_10026185 3300009551 Bacteria 5943
115 Ga0105249_10009230 3300009553 Bacteria 8627
116 Ga0105239_10008428 3300010375 Bacteria 11736
117 Ga0105239_10140461 3300010375 Unclassified 2691
118 Ga0105239_10208645 3300010375 Unclassified 2189
119 Ga0105246_10000611 3300011119 Bacteria 19886
120 Ga0105246_10023869 3300011119 Bacteria 3964
121 Ga0157373_10008688 3300013100 Bacteria 7538
122 Ga0157371_10004551 3300013102 Bacteria 12068
123 Ga0157369_10101101 3300013105 Bacteria 3073
124 Ga0157378_10305851 3300013297 Bacteria 1540
125 Ga0163162_10105704 3300013306 Unclassified 2909
126 Ga0157372_10007588 3300013307 Bacteria 11533
127 Ga0157375_10287801 3300013308 Bacteria 1806
128 Ga0163163_10013191 3300014325 Bacteria 7552
129 Ga0163163_10093357 3300014325 Bacteria 3026
130 Ga0157380_10015717 3300014326 Bacteria 5564
131 Ga0157377_10000646 3300014745 Bacteria 14544
132 Ga0157379_10076120 3300014968 Bacteria 3005
133 Ga0157376_10001167 3300014969 Bacteria 17258
134 Ga0207697_10001078 3300025315 Bacteria 15067
135 Ga0207656_10000001 3300025321 Bacteria 1323684
136 Ga0207656_10008262 3300025321 Bacteria 3822
137 Ga0207682_10005475 3300025893 Bacteria 5170
138 Ga0207710_10058938 3300025900 Bacteria 1737
139 Ga0207680_10074059 3300025903 Bacteria 2119
140 Ga0207647_10004136 3300025904 Bacteria 10768
141 Ga0207685_10047065 3300025905 Unclassified 1644
142 Ga0207643_10002455 3300025908 Bacteria 10008
143 Ga0207705_10104725 3300025909 Bacteria 2084
144 Ga0207654_10000003 3300025911 Bacteria 1030378
145 Ga0207707_10104439 3300025912 Bacteria 2476
146 Ga0207695_10000617 3300025913 Bacteria 71447
147 Ga0207695_10001517 3300025913 Bacteria 38540
148 Ga0207671_10000001 3300025914 Bacteria 1318881
149 Ga0207662_10000030 3300025918 Bacteria 64692
150 Ga0207657_10000107 3300025919 Bacteria 80870
151 Ga0207657_10127015 3300025919 Bacteria 2093
152 Ga0207649_10001250 3300025920 Bacteria 15204
153 Ga0207649_10066222 3300025920 Bacteria 2289
154 Ga0207652_10170939 3300025921 Bacteria 1950
155 Ga0207694_10000047 3300025924 Bacteria 163953
156 Ga0207694_10000265 3300025924 Bacteria 49883
157 Ga0207650_10000217 3300025925 Bacteria 65387
158 Ga0207659_10042236 3300025926 Bacteria 3196
159 Ga0207687_10000078 3300025927 Bacteria 71055
160 Ga0207687_10030375 3300025927 Bacteria 3643
161 Ga0207687_10147776 3300025927 Unclassified 1790
162 Ga0207664_10276379 3300025929 Bacteria 1473
163 Ga0207690_10000945 3300025932 Bacteria 18591
164 Ga0207706_10000082 3300025933 Bacteria 98165
165 Ga0207670_10000222 3300025936 Bacteria 37036
166 Ga0207691_10000031 3300025940 Bacteria 118063
167 Ga0207711_10000337 3300025941 Bacteria 49962
168 Ga0207711_10003086 3300025941 Bacteria 14524
169 Ga0207711_10035416 3300025941 Bacteria 4230
170 Ga0207689_10000015 3300025942 Bacteria 118820
171 Ga0207661_10010297 3300025944 Bacteria 6726
172 Ga0207661_10246004 3300025944 Unclassified 1588
173 Ga0207679_10000284 3300025945 Bacteria 38404
174 Ga0207679_10007005 3300025945 Bacteria 7145
175 Ga0207667_10000462 3300025949 Bacteria 54635
176 Ga0207667_10001083 3300025949 Bacteria 34556
177 Ga0207667_10003702 3300025949 Bacteria 18851
178 Ga0207667_10074957 3300025949 Bacteria 3514
179 Ga0207667_10120520 3300025949 Bacteria 2703
180 Ga0207651_10000616 3300025960 Bacteria 14996
181 Ga0207712_10019021 3300025961 Bacteria 4480
182 Ga0207640_10037654 3300025981 Bacteria 3045
183 Ga0207658_10003908 3300025986 Bacteria 10475
184 Ga0207677_10000960 3300026023 Bacteria 16010
185 Ga0207703_10000033 3300026035 Bacteria 187752
186 Ga0207703_10000860 3300026035 Bacteria 29727
187 Ga0207639_10019365 3300026041 Bacteria 4853
188 Ga0207639_10027596 3300026041 Bacteria 4138
189 Ga0207639_10302714 3300026041 Bacteria 1414
190 Ga0207678_10000894 3300026067 Bacteria 27361
191 Ga0207708_10003832 3300026075 Bacteria 11084
192 Ga0207702_10034331 3300026078 Bacteria 4240
193 Ga0207702_10064183 3300026078 Bacteria 3142
194 Ga0207702_10064759 3300026078 Bacteria 3129
195 Ga0207702_10108557 3300026078 Bacteria 2463
196 Ga0207641_10062999 3300026088 Bacteria 3166
197 Ga0207676_10138316 3300026095 Bacteria 2081
198 Ga0207674_10000008 3300026116 Bacteria 225355
199 Ga0207674_10000552 3300026116 Bacteria 49121
200 Ga0207674_10039578 3300026116 Bacteria 4886
201 Ga0207674_10367098 3300026116 Bacteria 1391
202 Ga0207675_100000001 3300026118 Bacteria 381356
203 Ga0207683_10007554 3300026121 Bacteria 9316
204 Ga0207698_10000167 3300026142 Bacteria 41351
205 Ga0207698_10000981 3300026142 Bacteria 16612
206 Ga0207698_10004470 3300026142 Bacteria 8531
207 Ga0268265_10000039 3300028380 Bacteria 198606
208 Ga0268265_10004858 3300028380 Bacteria 9263
209 Ga0268264_10000680 3300028381 Bacteria 39577
210 Ga0307515_10173720 3300028794 Unclassified 2134
211 Ga0307511_10044409 3300030521 Unclassified 3692
212 Ga0265330_10003920 3300031235 Bacteria 7648
213 Ga0265329_10002023 3300031242 Bacteria 9502
214 Ga0265316_10004929 3300031344 Bacteria 13126
215 Ga0265316_10059426 3300031344 Bacteria 2973
216 Ga0265316_10143731 3300031344 Bacteria 1790
217 Ga0307509_10001858 3300031507 Bacteria 34921
218 Ga0307509_10065866 3300031507 Bacteria 3802
219 Ga0307514_10066020 3300031649 Bacteria 2738
220 Ga0265314_10057691 3300031711 Bacteria 2664
221 Ga0265342_10006755 3300031712 Bacteria 8499
222 Ga0316576_10009455 3300031727 Bacteria 6293
223 Ga0316576_10161074 3300031727 Bacteria 1692
224 Ga0316578_10026783 3300031728 Bacteria 3253
225 Ga0373927_0013733 3300035695 Bacteria 5378
226 Ga0373937_0011659 3300036401 Bacteria 7714
227 Ga0316584_0005043 3300036712 Bacteria 8801
228 Ga0436363_1226266 3300039450 Bacteria 3107
229 Ga0451853_2786696 3300041512 Bacteria 1234
230 Ga0451577_0032375 3300042876 Bacteria 4711
231 Ga0451577_0035052 3300042876 Unclassified 4521
232 Ga0451577_0111465 3300042876 Unclassified 2448
233 Ga0466972_0056032 3300044658 Bacteria 1895
234 Ga0453683_0003050 3300044673 Bacteria 12539
235 Ga0453683_0009580 3300044673 Bacteria 6462
236 Ga0453683_0047253 3300044673 Unclassified 2698
237 Ga0453683_0085305 3300044673 Unclassified 1978
238 Ga0453684_0012435 3300044712 Bacteria 14034
239 Ga0453684_0016784 3300044712 Bacteria 11406
240 Ga0453684_0033841 3300044712 Bacteria 7110
241 Ga0453684_0092731 3300044712 Bacteria 3722
242 Ga0453684_0119201 3300044712 Bacteria 3190
243 Ga0453684_0152409 3300044712 Unclassified 2745
244 Ga0453684_0163309 3300044712 Bacteria 2632
245 Ga0453684_0310673 3300044712 Bacteria 1789
246 Ga0451576_0040246 3300045051 Bacteria 4948
247 Ga0451576_0103975 3300045051 Bacteria 2954
248 Ga0495650_0000816 3300046471 Bacteria 37924
249 Ga0495580_0240937 3300046472 Unclassified 1240
250 Ga0495658_0166206 3300046683 Bacteria 1363
251 Ga0495602_0095725 3300048088 Bacteria 2450
252 Ga0496102_0005079 3300048905 Bacteria 11147
253 Ga0496102_0006752 3300048905 Bacteria 9797
254 Ga0496106_0020893 3300048909 Bacteria 4858
255 Ga0496108_0123432 3300048911 Bacteria 2222
256 Ga0496109_0070627 3300048912 Bacteria 3205
257 Ga0496116_0000443 3300048919 Bacteria 57820
258 Ga0496117_0006896 3300048920 Bacteria 11270
259 Ga0496117_0065224 3300048920 Bacteria 2477
260 Ga0496118_0000468 3300048921 Bacteria 67115
261 Ga0496118_0020871 3300048921 Bacteria 5793
262 Ga0496119_0004163 3300048922 Bacteria 14528
263 Ga0496120_0001309 3300048923 Bacteria 30936
264 Ga0496120_0004289 3300048923 Bacteria 12100
265 Ga0496120_0037917 3300048923 Bacteria 2856
266 Ga0501069_0020909 3300049585 Bacteria 3549
267 Ga0501074_0179204 3300049590 Bacteria 1512
268 nmdc:mga05p37_381589_c1 3300050507 Bacteria 1651
269 nmdc:mga0qj67_145948_c1 3300050509 Bacteria 1918
270 nmdc:mga06r32_84978_c1 3300050510 Bacteria 3085
271 nmdc:mga08y16_53873_c1 3300050511 Unclassified 4204
272 Ga0495612_0096816 3300053078 Bacteria 1254
273 Ga0500651_0001835 3300053093 Bacteria 10905
274 Ga0500590_008339 3300053148 Bacteria 5166
275 Ga0500616_0000221 3300053153 Bacteria 88983
276 Ga0500616_0099502 3300053153 Bacteria 1424
277 Ga0500620_000331 3300053155 Bacteria 8906
278 2508676810 2508501039 Bacteria 9978592
279 2517763933 2517572101 Bacteria 6884336
280 2676199917 2675902999 Bacteria 9438463
281 2689957507 2687453737 Bacteria 11203906
282 2774844495 2773857921 Bacteria 9435764
283 8002777686 8002775197 Bacteria 10728764
284 8002785505 8002784119 Bacteria 9788632
285 Ga0105245_10000133
286 JGI24737J22298_10021046
287 JGI24743J22301_10002873
288 rootH1_10153027
289 Ga0065715_10178257
290 Ga0070658_10024025
291 Ga0070676_10013052
292 Ga0070683_100004837
293 Ga0070683_100284795
294 Ga0070690_100000468
295 Ga0070670_100041852
296 Ga0070677_10000410
297 Ga0068869_100000740
298 Ga0070666_10005186
299 Ga0070666_10141568
300 Ga0070680_100134131
301 Ga0070682_100087055
302 Ga0068868_100006639
303 Ga0070660_100002689
304 Ga0070689_100010070
305 Ga0070687_100000827
306 Ga0070661_100000943
307 Ga0070661_100003876
308 Ga0070661_100164547
309 Ga0070692_10016963
310 Ga0070668_100010522
311 Ga0070669_100000788
312 Ga0070675_100058223
313 Ga0070675_100222616
314 Ga0070671_100297350
315 Ga0070674_100000050
316 Ga0070688_100001490
317 Ga0070659_100000243
318 Ga0070659_100007020
319 Ga0070667_100085478
320 Ga0070667_100105086
321 Ga0070701_10022914
322 Ga0070705_100001222
323 Ga0070663_100003245
324 Ga0070678_100022743
325 Ga0070662_100000622
326 Ga0070681_10136442
327 Ga0068867_100022975
328 Ga0070685_10000059
329 Ga0070685_10022256
330 Ga0070679_100011872
331 Ga0070679_100022505
332 Ga0070679_100247308
333 Ga0068853_100041048
334 Ga0068853_100215301
335 Ga0070672_100026085
336 Ga0070686_100000062
337 Ga0068855_100000369
338 Ga0068855_100001064
339 Ga0068855_100001615
340 Ga0068855_100161489
341 Ga0068855_100213129
342 Ga0070664_100000682
343 Ga0068857_100005157
344 Ga0068857_100027493
345 Ga0068857_100034547
346 Ga0068854_100000098
347 Ga0068854_100110245
348 Ga0068856_100008331
349 Ga0068856_100020509
350 Ga0068856_100152110
351 Ga0068856_100336506
352 Ga0068852_100000817
353 Ga0068852_100096064
354 Ga0068859_100026468
355 Ga0068859_100134152
356 Ga0068864_100021605
357 Ga0068864_100028012
358 Ga0068866_10000603
359 Ga0068861_100000136
360 Ga0068851_10000025
361 Ga0068851_10000107
362 Ga0068851_10000532
363 Ga0068870_10000229
364 Ga0068863_100021408
365 Ga0068863_100078960
366 Ga0068858_100000080
367 Ga0068858_100031942
368 Ga0068860_100058799
369 Ga0081540_1000172
370 Ga0081540_1000201
371 Ga0081540_1000903
372 Ga0070717_10209090
373 Ga0070715_10066801
374 Ga0097621_100008854
375 Ga0097621_100028646
376 Ga0075428_100049771
377 Ga0075428_100068767
378 Ga0075431_100015369
379 Ga0075431_100182884
380 Ga0075429_100161297
381 Ga0068865_100002243
382 Ga0097620_100026468
383 Ga0097620_100134156
384 Ga0105240_10088081
385 Ga0105245_10001681
386 Ga0105245_10046478
387 Ga0105245_10064053
388 Ga0114129_10554230
389 Ga0105243_10009420
390 Ga0105241_10000136
391 Ga0105241_10007846
392 Ga0105241_10290634
393 Ga0105242_10000769
394 Ga0105248_10000262
395 Ga0105237_10000270
396 Ga0105237_10022059
397 Ga0105237_10250756
398 Ga0105238_10026185
399 Ga0105249_10009230
400 Ga0105239_10008428
401 Ga0105239_10140461
402 Ga0105239_10208645
403 Ga0105246_10000611
404 Ga0105246_10023869
405 Ga0157373_10008688
406 Ga0157371_10004551
407 Ga0157369_10101101
408 Ga0157378_10305851
409 Ga0163162_10105704
410 Ga0157372_10007588
411 Ga0157375_10287801
412 Ga0163163_10013191
413 Ga0163163_10093357
414 Ga0157380_10015717
415 Ga0157377_10000646
416 Ga0157379_10076120
417 Ga0157376_10001167
418 Ga0207697_10001078
419 Ga0207656_10000001
420 Ga0207656_10008262
421 Ga0207682_10005475
422 Ga0207710_10058938
423 Ga0207680_10074059
424 Ga0207647_10004136
425 Ga0207685_10047065
426 Ga0207643_10002455
427 Ga0207705_10104725
428 Ga0207654_10000003
429 Ga0207707_10104439
430 Ga0207695_10000617
431 Ga0207695_10001517
432 Ga0207671_10000001
433 Ga0207662_10000030
434 Ga0207657_10000107
435 Ga0207657_10127015
436 Ga0207649_10001250
437 Ga0207649_10066222
438 Ga0207652_10170939
439 Ga0207694_10000047
440 Ga0207694_10000265
441 Ga0207650_10000217
442 Ga0207659_10042236
443 Ga0207687_10000078
444 Ga0207687_10030375
445 Ga0207687_10147776
446 Ga0207664_10276379
447 Ga0207690_10000945
448 Ga0207706_10000082
449 Ga0207670_10000222
450 Ga0207691_10000031
451 Ga0207711_10000337
452 Ga0207711_10003086
453 Ga0207711_10035416
454 Ga0207689_10000015
455 Ga0207661_10010297
456 Ga0207661_10246004
457 Ga0207679_10000284
458 Ga0207679_10007005
459 Ga0207667_10000462
460 Ga0207667_10001083
461 Ga0207667_10003702
462 Ga0207667_10074957
463 Ga0207667_10120520
464 Ga0207651_10000616
465 Ga0207712_10019021
466 Ga0207640_10037654
467 Ga0207658_10003908
468 Ga0207677_10000960
469 Ga0207703_10000033
470 Ga0207703_10000860
471 Ga0207639_10019365
472 Ga0207639_10027596
473 Ga0207639_10302714
474 Ga0207678_10000894
475 Ga0207708_10003832
476 Ga0207702_10034331
477 Ga0207702_10064183
478 Ga0207702_10064759
479 Ga0207702_10108557
480 Ga0207641_10062999
481 Ga0207676_10138316
482 Ga0207674_10000008
483 Ga0207674_10000552
484 Ga0207674_10039578
485 Ga0207674_10367098
486 Ga0207675_100000001
487 Ga0207683_10007554
488 Ga0207698_10000167
489 Ga0207698_10000981
490 Ga0207698_10004470
491 Ga0268265_10000039
492 Ga0268265_10004858
493 Ga0268264_10000680
494 Ga0307515_10173720
495 Ga0307511_10044409
496 Ga0265330_10003920
497 Ga0265329_10002023
498 Ga0265316_10004929
499 Ga0265316_10059426
500 Ga0265316_10143731
501 Ga0307509_10001858
502 Ga0307509_10065866
503 Ga0307514_10066020
504 Ga0265314_10057691
505 Ga0265342_10006755
506 Ga0316576_10009455
507 Ga0316576_10161074
508 Ga0316578_10026783
509 Ga0373927_0013733
510 Ga0373937_0011659
511 Ga0316584_0005043
512 Ga0436363_1226266
513 Ga0451853_2786696
514 Ga0451577_0032375
515 Ga0451577_0035052
516 Ga0451577_0111465
517 Ga0466972_0056032
518 Ga0453683_0003050
519 Ga0453683_0009580
520 Ga0453683_0047253
521 Ga0453683_0085305
522 Ga0453684_0012435
523 Ga0453684_0016784
524 Ga0453684_0033841
525 Ga0453684_0092731
526 Ga0453684_0119201
527 Ga0453684_0152409
528 Ga0453684_0163309
529 Ga0453684_0310673
530 Ga0451576_0040246
531 Ga0451576_0103975
532 Ga0495650_0000816
533 Ga0495580_0240937
534 Ga0495658_0166206
535 Ga0495602_0095725
536 Ga0496102_0005079
537 Ga0496102_0006752
538 Ga0496106_0020893
539 Ga0496108_0123432
540 Ga0496109_0070627
541 Ga0496116_0000443
542 Ga0496117_0006896
543 Ga0496117_0065224
544 Ga0496118_0000468
545 Ga0496118_0020871
546 Ga0496119_0004163
547 Ga0496120_0001309
548 Ga0496120_0004289
549 Ga0496120_0037917
550 Ga0501069_0020909
551 Ga0501074_0179204
552 nmdc:mga05p37_381589_c1
553 nmdc:mga0qj67_145948_c1
554 nmdc:mga06r32_84978_c1
555 nmdc:mga08y16_53873_c1
556 Ga0495612_0096816
557 Ga0500651_0001835
558 Ga0500590_008339
559 Ga0500616_0000221
560 Ga0500616_0099502
561 Ga0500620_000331
562 2508676810
563 2517763933
564 2676199917
565 2689957507
566 2774844495
567 8002777686
568 8002785505

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01222

ERG4_ERG24

Ergosterol biosynthesis ERG4/ERG24 family

17

371

0.91

PF06966

DUF1295

Protein of unknown function (DUF1295)

205

338

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4quv-assembly3.cif.gz_A structure of an integral membrane delta(14)-sterol reductase 0.8822 1 353
4quv-assembly3.cif.gz_B structure of an integral membrane delta(14)-sterol reductase 0.8807 1 353
4quv-assembly3.cif.gz_A structure of an integral membrane delta(14)-sterol reductase 0.8635 1 353
4quv-assembly3.cif.gz_B structure of an integral membrane delta(14)-sterol reductase 0.855 1 353
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.5447 69 335
ID Description Score Start End Superfamily
af_B7F4K3_172_321_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8933 155 304 1.20.120.1630
af_Q5RJ97_422_618_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8889 156 351 1.20.120.1630
af_A0A0R0HQ50_72_255_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8868 155 351 1.20.120.1630
af_Q5RJ97_422_618_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8805 156 351 1.20.120.1630
af_B7F4K3_172_321_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8769 155 304 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A6N9BZD0-F1-model_v4 DUF1295 domain-containing protein 0.9624 4 314 GO:0016020
GO:0016126
GO:0050613
AF-A0A524NYR6-F1-model_v4 DUF1295 domain-containing protein 0.9484 4 353 GO:0016020
GO:0016126
GO:0050613
AF-A0A6L8BCJ7-F1-model_v4 Ergosterol biosynthesis protein 0.9477 4 212 GO:0016020
GO:0016126
GO:0050613
AF-A0A6N9BZD0-F1-model_v4 DUF1295 domain-containing protein 0.9416 4 314 GO:0016020
GO:0016126
GO:0050613
AF-A0A7X7FWR0-F1-model_v4 DUF1295 domain-containing protein 0.9405 108 353 GO:0016020
GO:0016126
GO:0050613

Map