F386147

General Info

Members Datasets Scaffolds Average Seq Length
284 204 266 410

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10000061|Ga0099794_1000006137
Length 451
Sequence MRFNTFSSASVSATWSPIGFPLVVLLRSHPLCDSIRAEEQLAQILFRNFRMLDPEKDEIVGGHEILVEGDSIREVSAKPIKAPDASAIDCGGRTLMPGLIDCHVHVTLSEVLIRQLEHVPLTLMAARAAVAMRAMLDRGFTTVRDTGGADWGLKAAVDQGLVDGPRMFISGRAIGPTGGHADARRRTDSGPPCRCCHALAFAMATADGDAEVRKTVREEMRQGCDQVKIMMSGGVASPYDPLDSLQFSPGEVAAAVEEAQAFGRYVCAHAYTPQAIQRAAQAGVRTIEHGNLIDEASAALMAQKGMLLIANLVTYYAMRERASMFGMPPDMLAKNDLVIEGGLRSLEICKRAGVPVAYGTDLLGQLQVDQSREFVLRSQVMSPLEIIRSATLIGARVVRQQGKLGCLRPGAFADLLVIDGNPLKDLGLFETPEKSFVAIMKGGKFHKNRLR

Samples

Sample ID Description Type Environment
1 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
2 2643221733 Bosea sp. Root381 Isolate Unclassified
3 2643221734 Bosea sp. Root670 Isolate Unclassified
4 2643221736 Bosea sp. Root483D1 Isolate Unclassified
5 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
6 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
7 2818991467 Bosea vestrisii 3192 Isolate Unclassified
8 2841760612 Bosea sp. Tri-49 Isolate Nodule
9 2844104063 Bosea sp. Tri-39 Isolate Nodule
10 2851182111 Bosea sp. Tri-44 Isolate Nodule
11 2851246043 Bosea sp. Tri-54 Isolate Nodule
12 2855730933 Achromobacter sp. HZ28 Isolate Nodule
13 2855767633 Achromobacter sp. HZ34 Isolate Nodule
14 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
15 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
16 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
113 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
114 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
115 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
121 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
140 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
144 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
145 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
153 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
154 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
155 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
167 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
189 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
190 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
191 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
192 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
193 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
194 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
195 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
196 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
199 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
200 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
201 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
204 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.66
Metatranscriptomes 0
Isolates 6.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.03
Nodule 2.82
Rhizoplane 3.52
Rhizosphere 67.96
Stem 0
Stem Tuber 0
Unclassified 12.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000052 3300003187 Bacteria 159471
2 JGI25151J46595_10000075 3300003187 Bacteria 135181
3 JGI25406J46586_10029026 3300003203 Bacteria 2100
4 JGI25153J46596_10005584 3300003215 Bacteria 6575
5 Ga0055529_1001227 3300003763 Bacteria 9749
6 Ga0055526_1002207 3300003771 Bacteria 13341
7 Ga0055524_1000014 3300003775 Bacteria 259417
8 Ga0065165_1000026 3300005262 Bacteria 233376
9 Ga0065712_10071782 3300005290 Bacteria 5068
10 Ga0070658_10013107 3300005327 Bacteria 6652
11 Ga0070680_100043577 3300005336 Bacteria 3645
12 Ga0070669_100101061 3300005353 Bacteria 2175
13 Ga0070714_100024960 3300005435 Bacteria 4928
14 Ga0070713_100011632 3300005436 Bacteria 6419
15 Ga0070708_100001098 3300005445 Bacteria 20624
16 Ga0070708_100037599 3300005445 Bacteria 4224
17 Ga0070708_100099986 3300005445 Bacteria 2654
18 Ga0070708_100166245 3300005445 Bacteria 2058
19 Ga0070681_10017518 3300005458 Bacteria 7160
20 Ga0070706_100000058 3300005467 Bacteria 133347
21 Ga0070706_100044910 3300005467 Bacteria 4081
22 Ga0070706_100358637 3300005467 Bacteria 1359
23 Ga0070707_100065031 3300005468 Bacteria 3503
24 Ga0070707_100093539 3300005468 Bacteria 2910
25 Ga0070707_100093673 3300005468 Bacteria 2908
26 Ga0070698_100056286 3300005471 Bacteria 3986
27 Ga0070698_100418657 3300005471 Bacteria 1274
28 Ga0070699_100007065 3300005518 Bacteria 9751
29 Ga0070699_100010386 3300005518 Bacteria 8054
30 Ga0070699_100172192 3300005518 Bacteria 1919
31 Ga0070679_100028597 3300005530 Bacteria 5497
32 Ga0070697_100001145 3300005536 Bacteria 20085
33 Ga0070697_100078724 3300005536 Bacteria 2713
34 Ga0070697_100090507 3300005536 Bacteria 2529
35 Ga0068853_100074269 3300005539 Bacteria 2966
36 Ga0070665_100001451 3300005548 Bacteria 27779
37 Ga0070665_100009504 3300005548 Bacteria 9833
38 Ga0070665_100146091 3300005548 Bacteria 2368
39 Ga0068855_100163996 3300005563 Bacteria 2520
40 Ga0068852_100159399 3300005616 Bacteria 2105
41 Ga0068859_100220199 3300005617 Bacteria 1985
42 Ga0068858_100044944 3300005842 Bacteria 4093
43 Ga0068860_100179338 3300005843 Bacteria 2047
44 Ga0068862_100003768 3300005844 Bacteria 12935
45 Ga0068862_100121468 3300005844 Bacteria 2303
46 Ga0081455_10007592 3300005937 Bacteria 11398
47 Ga0081455_10042808 3300005937 Bacteria 3968
48 Ga0081455_10103775 3300005937 Bacteria 2276
49 Ga0081538_10023146 3300005981 Bacteria 4475
50 Ga0081540_1003437 3300005983 Bacteria 12504
51 Ga0081540_1034098 3300005983 Bacteria 2751
52 Ga0081539_10018439 3300005985 Bacteria 4844
53 Ga0070717_10001753 3300006028 Bacteria 15100
54 Ga0075364_10087591 3300006051 Bacteria 2064
55 Ga0070712_100014074 3300006175 Bacteria 5129
56 Ga0097621_100216189 3300006237 Bacteria 1669
57 Ga0075428_100028733 3300006844 Bacteria 6153
58 Ga0075428_100092567 3300006844 Bacteria 3296
59 Ga0075428_100260718 3300006844 Bacteria 1866
60 Ga0075430_100035697 3300006846 Bacteria 4216
61 Ga0075431_100037851 3300006847 Bacteria 4967
62 Ga0075431_100234169 3300006847 Bacteria 1870
63 Ga0075433_10067495 3300006852 Bacteria 3139
64 Ga0075433_10070294 3300006852 Bacteria 3076
65 Ga0075434_100010673 3300006871 Bacteria 8624
66 Ga0097620_100220192 3300006931 Bacteria 1985
67 Ga0075435_100030270 3300007076 Bacteria 4254
68 Ga0099794_10000061 3300007265 Bacteria 42123
69 Ga0099794_10011956 3300007265 Bacteria 3731
70 Ga0105240_10002521 3300009093 Bacteria 29396
71 Ga0105240_10017319 3300009093 Bacteria 9713
72 Ga0105240_10422907 3300009093 Bacteria 1496
73 Ga0114129_10007423 3300009147 Bacteria 15608
74 Ga0114129_10100257 3300009147 Bacteria 4007
75 Ga0105243_10138874 3300009148 Bacteria 2071
76 Ga0105243_10145255 3300009148 Bacteria 2029
77 Ga0105241_10085165 3300009174 Bacteria 2483
78 Ga0105237_10017156 3300009545 Bacteria 7511
79 Ga0105238_10027801 3300009551 Bacteria 5764
80 Ga0105238_10153750 3300009551 Bacteria 2275
81 Ga0105239_10103473 3300010375 Bacteria 3151
82 Ga0171462_1012 3300013250 Bacteria 208216
83 Ga0157378_10288694 3300013297 Bacteria 1584
84 Ga0157372_10088875 3300013307 Bacteria 3509
85 Ga0157379_10077558 3300014968 Bacteria 2975
86 Ga0157379_10126470 3300014968 Bacteria 2300
87 Ga0213875_10015419 3300021388 Bacteria 3718
88 Ga0209455_1001756 3300025272 Bacteria 9188
89 Ga0209130_1000024 3300025284 Bacteria 354212
90 Ga0209675_1002662 3300025291 Bacteria 9016
91 Ga0209676_1015023 3300025292 Bacteria 2873
92 Ga0209025_1000017 3300025294 Bacteria 768983
93 Ga0209025_1000027 3300025294 Bacteria 505882
94 Ga0209025_1002185 3300025294 Bacteria 21713
95 Ga0209564_1000074 3300025295 Bacteria 286043
96 Ga0209564_1000082 3300025295 Bacteria 261494
97 Ga0209758_1003296 3300025297 Bacteria 14947
98 Ga0209256_1000033 3300025299 Bacteria 393924
99 Ga0207426_1005970 3300025302 Bacteria 5403
100 Ga0209257_1032576 3300025304 Bacteria 1650
101 Ga0207710_10053052 3300025900 Bacteria 1824
102 Ga0207688_10061209 3300025901 Bacteria 2122
103 Ga0207705_10008325 3300025909 Bacteria 7569
104 Ga0207684_10000066 3300025910 Bacteria 193406
105 Ga0207695_10021699 3300025913 Bacteria 7320
106 Ga0207671_10020014 3300025914 Bacteria 5105
107 Ga0207671_10100664 3300025914 Bacteria 2188
108 Ga0207662_10005426 3300025918 Bacteria 6800
109 Ga0207662_10088714 3300025918 Bacteria 1899
110 Ga0207649_10022820 3300025920 Bacteria 3617
111 Ga0207652_10009999 3300025921 Bacteria 7639
112 Ga0207646_10030255 3300025922 Bacteria 4911
113 Ga0207646_10030633 3300025922 Bacteria 4874
114 Ga0207646_10061481 3300025922 Bacteria 3352
115 Ga0207681_10098761 3300025923 Bacteria 2101
116 Ga0207694_10095486 3300025924 Bacteria 2350
117 Ga0207700_10013617 3300025928 Bacteria 5299
118 Ga0207700_10028948 3300025928 Bacteria 3904
119 Ga0207700_10132205 3300025928 Bacteria 2039
120 Ga0207706_10270864 3300025933 Bacteria 1482
121 Ga0207704_10024293 3300025938 Bacteria 3284
122 Ga0207689_10263304 3300025942 Bacteria 1427
123 Ga0207667_10025602 3300025949 Bacteria 6455
124 Ga0207712_10177539 3300025961 Bacteria 1670
125 Ga0207640_10101350 3300025981 Bacteria 2020
126 Ga0207677_10085475 3300026023 Bacteria 2277
127 Ga0207703_10272072 3300026035 Bacteria 1535
128 Ga0207678_10169390 3300026067 Bacteria 1865
129 Ga0207708_10138027 3300026075 Bacteria 1911
130 Ga0207702_10031661 3300026078 Bacteria 4409
131 Ga0207698_10091569 3300026142 Bacteria 2489
132 Ga0207698_10348114 3300026142 Bacteria 1398
133 Ga0209588_1000039 3300027671 Bacteria 61088
134 Ga0268266_10007210 3300028379 Bacteria 10057
135 Ga0268266_10033142 3300028379 Bacteria 4392
136 Ga0268266_10054239 3300028379 Bacteria 3444
137 Ga0268266_10124023 3300028379 Bacteria 2302
138 Ga0268265_10021737 3300028380 Bacteria 4498
139 Ga0268265_10104232 3300028380 Unclassified 2298
140 Ga0307515_10050889 3300028794 Bacteria 6191
141 Ga0307511_10059567 3300030521 Unclassified 2935
142 Ga0265330_10017935 3300031235 Bacteria 3254
143 Ga0265328_10043013 3300031239 Bacteria 1662
144 Ga0265320_10010896 3300031240 Bacteria 5381
145 Ga0265340_10023374 3300031247 Bacteria 3152
146 Ga0265339_10027203 3300031249 Bacteria 3267
147 Ga0265331_10039386 3300031250 Bacteria 2305
148 Ga0265316_10153061 3300031344 Bacteria 1727
149 Ga0307509_10000118 3300031507 Bacteria 115087
150 Ga0307508_10238075 3300031616 Bacteria 1418
151 Ga0265342_10007156 3300031712 Bacteria 8212
152 Ga0265342_10020568 3300031712 Bacteria 4230
153 Ga0265342_10024705 3300031712 Bacteria 3790
154 Ga0373960_0001728 3300035121 Bacteria 4887
155 Ga0373931_0016827 3300035691 Bacteria 3606
156 Ga0373927_0243595 3300035695 Bacteria 1182
157 Ga0395899_0004614 3300037312 Bacteria 10737
158 Ga0395900_0006806 3300037418 Bacteria 11855
159 Ga0395900_0025067 3300037418 Bacteria 6104
160 Ga0395900_0115708 3300037418 Bacteria 2752
161 Ga0395898_0025644 3300037466 Bacteria 5938
162 Ga0436364_0905943 3300037853 Bacteria 5525
163 Ga0395901_0026772 3300038443 Bacteria 5920
164 Ga0395901_0042132 3300038443 Bacteria 4732
165 Ga0436360_0736765 3300039438 Bacteria 8393
166 Ga0436360_1148710 3300039438 Bacteria 1187
167 Ga0466957_0145834 3300044842 Bacteria 1528
168 Ga0495629_0112537 3300046459 Bacteria 1897
169 Ga0495638_0070995 3300046460 Bacteria 2130
170 Ga0495605_0011248 3300046474 Bacteria 4996
171 Ga0495584_0065352 3300046491 Bacteria 1829
172 Ga0495596_0006731 3300046500 Bacteria 5256
173 Ga0495606_0047814 3300046507 Bacteria 2818
174 Ga0495616_0008458 3300046513 Bacteria 6096
175 Ga0495631_0028844 3300046518 Bacteria 2529
176 Ga0495632_0036234 3300046519 Bacteria 2510
177 Ga0495643_0009967 3300046522 Bacteria 5869
178 Ga0495642_0007048 3300046528 Bacteria 4314
179 Ga0495597_0048283 3300046542 Bacteria 1883
180 Ga0495611_0044841 3300046648 Bacteria 1978
181 Ga0495625_0158854 3300046660 Bacteria 1515
182 Ga0495659_0113145 3300046664 Bacteria 1062
183 Ga0495661_0108315 3300046665 Bacteria 1552
184 Ga0495670_0023779 3300046691 Bacteria 3025
185 Ga0495649_0079849 3300046694 Bacteria 1749
186 Ga0495672_0047216 3300047320 Bacteria 2562
187 Ga0495683_0025873 3300047323 Bacteria 3005
188 Ga0495677_0015814 3300047445 Bacteria 2740
189 Ga0495679_023796 3300047446 Bacteria 2073
190 Ga0495673_0025286 3300047469 Bacteria 2854
191 Ga0495686_0212930 3300047472 Bacteria 1103
192 Ga0496102_0019471 3300048905 Bacteria 5978
193 Ga0496102_0037931 3300048905 Bacteria 4347
194 Ga0496104_0051479 3300048907 Bacteria 3887
195 Ga0496106_0000407 3300048909 Bacteria 30533
196 Ga0496107_0125554 3300048910 Bacteria 1892
197 Ga0496111_0039545 3300048914 Bacteria 3382
198 Ga0496111_0094940 3300048914 Bacteria 2187
199 Ga0496112_0067505 3300048915 Bacteria 3530
200 Ga0496112_0106506 3300048915 Bacteria 2773
201 Ga0496113_0021668 3300048916 Bacteria 4535
202 Ga0496117_0000012 3300048920 Bacteria 608530
203 Ga0496117_0015968 3300048920 Bacteria 6361
204 Ga0496117_0108205 3300048920 Bacteria 1739
205 Ga0496118_0000003 3300048921 Bacteria 773148
206 Ga0496118_0007159 3300048921 Bacteria 11935
207 Ga0496119_0049697 3300048922 Bacteria 2591
208 Ga0496120_0015901 3300048923 Bacteria 4940
209 Ga0496121_0000353 3300048924 Bacteria 95678
210 Ga0496121_0007083 3300048924 Bacteria 13610
211 Ga0496121_0012642 3300048924 Bacteria 9170
212 Ga0496121_0022506 3300048924 Bacteria 6113
213 Ga0496121_0052661 3300048924 Bacteria 3415
214 Ga0496122_0033696 3300048925 Bacteria 4206
215 Ga0496124_0001860 3300048927 Bacteria 29134
216 Ga0496124_0035008 3300048927 Unclassified 4397
217 Ga0496125_0022715 3300048928 Bacteria 5815
218 Ga0496125_0044966 3300048928 Unclassified 3724
219 Ga0496126_0007832 3300048929 Bacteria 11644
220 Ga0496126_0026275 3300048929 Bacteria 5585
221 Ga0496126_0094634 3300048929 Bacteria 2621
222 Ga0496126_0105362 3300048929 Bacteria 2462
223 Ga0496126_0116030 3300048929 Bacteria 2327
224 Ga0495678_037770 3300049459 Bacteria 1959
225 Ga0501033_0009460 3300049570 Bacteria 7504
226 Ga0501033_0032757 3300049570 Bacteria 3903
227 Ga0501034_0003283 3300049571 Bacteria 18470
228 Ga0501034_0079570 3300049571 Bacteria 3281
229 Ga0501034_0096129 3300049571 Bacteria 2959
230 Ga0501038_0155658 3300049574 Bacteria 1861
231 Ga0501047_0001041 3300049581 Bacteria 27718
232 Ga0501035_0021635 3300049822 Bacteria 5914
233 Ga0501035_0030822 3300049822 Bacteria 4887
234 Ga0501035_0109566 3300049822 Bacteria 2420
235 Ga0501035_0183597 3300049822 Bacteria 1801
236 Ga0501044_0001441 3300049823 Bacteria 27949
237 Ga0501044_0004149 3300049823 Bacteria 16273
238 Ga0501044_0125445 3300049823 Bacteria 2565
239 Ga0501044_0179732 3300049823 Bacteria 2083
240 Ga0501044_0352568 3300049823 Bacteria 1391
241 Ga0501045_0197941 3300049824 Bacteria 1497
242 nmdc:mga00v17_27961_c1 3300050491 Bacteria 3297
243 nmdc:mga04h51_24413_c1 3300050495 Bacteria 1851
244 nmdc:mga05p37_35991_c1 3300050507 Bacteria 6074
245 nmdc:mga05p37_95897_c1 3300050507 Bacteria 3654
246 nmdc:mga09592_144172_c1 3300050508 Bacteria 2053
247 nmdc:mga0n895_115574_c1 3300050512 Bacteria 2701
248 nmdc:mga0n895_4672_c1 3300050512 Bacteria 11295
249 nmdc:mga08x19_90014_c1 3300050514 Bacteria 2024
250 nmdc:mga0a205_119645_c1 3300050515 Bacteria 2533
251 nmdc:mga0a205_84660_c1 3300050515 Bacteria 3063
252 nmdc:mga0sz30_13724_c1 3300050516 Bacteria 2603
253 Ga0500578_0067608 3300053086 Bacteria 2279
254 Ga0500581_067789 3300053089 Bacteria 1799
255 Ga0500583_0017735 3300053092 Bacteria 2877
256 Ga0500651_0131654 3300053093 Bacteria 1512
257 Ga0500641_0018265 3300053096 Bacteria 2635
258 Ga0500597_138558 3300053120 Bacteria 1049
259 Ga0500658_0016481 3300053134 Bacteria 2753
260 Ga0500568_0002029 3300053139 Bacteria 12317
261 Ga0500616_0002266 3300053153 Bacteria 16340
262 Ga0500627_0046521 3300053158 Bacteria 1880
263 Ga0500636_0053023 3300053177 Bacteria 2380
264 Ga0500637_0145501 3300053178 Bacteria 1370
265 Ga0500552_000603 3300053733 Bacteria 3378
266 Ga0501082_0036450 3300060353 Bacteria 4238

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046664 Ga0495659_0113145 Ga0495659_0113145_15_1034 336
2 3300047472 Ga0495686_0212930 Ga0495686_0212930_17_1036 336
3 3300053120 Ga0500597_138558 Ga0500597_138558_18_1028 336
4 3300035695 Ga0373927_0243595 Ga0373927_0243595_122_1168 348
5 3300053177 Ga0500636_0053023 Ga0500636_0053023_1320_2366 348
6 3300053178 Ga0500637_0145501 Ga0500637_0145501_310_1356 348
7 3300039438 Ga0436360_1148710 Ga0436360_1148710_64_1140 357
8 3300013307 Ga0157372_10088875 Ga0157372_100888754 363
9 3300028794 Ga0307515_10050889 Ga0307515_100508895 377
10 3300005445 Ga0070708_100001098 Ga0070708_1000010988 390
11 3300005518 Ga0070699_100007065 Ga0070699_1000070654 390
12 iso_pu_bacteria 2513237098 2513677350 390
13 iso_pu_bacteria 2903768456 2903771627 390
14 3300031235 Ga0265330_10017935 Ga0265330_100179353 392
15 3300031249 Ga0265339_10027203 Ga0265339_100272033 392
16 3300031250 Ga0265331_10039386 Ga0265331_100393862 392
17 3300031344 Ga0265316_10153061 Ga0265316_101530612 392
18 3300031712 Ga0265342_10007156 Ga0265342_100071564 392
19 3300048924 Ga0496121_0007083 Ga0496121_0007083_9887_11143 392
20 3300048924 Ga0496121_0012642 Ga0496121_0012642_2909_4165 392
21 3300048929 Ga0496126_0105362 Ga0496126_0105362_926_2182 392
22 3300048929 Ga0496126_0116030 Ga0496126_0116030_539_1795 392
23 3300049570 Ga0501033_0009460 Ga0501033_0009460_4184_5440 392
24 3300049822 Ga0501035_0183597 Ga0501035_0183597_171_1427 392
25 3300006852 Ga0075433_10070294 Ga0075433_100702943 393
26 3300007076 Ga0075435_100030270 Ga0075435_1000302702 393
27 3300050515 nmdc:mga0a205_84660_c1 nmdc:mga0a205_84660_c1_401_1636 393
28 3300049822 Ga0501035_0021635 Ga0501035_0021635_1730_2977 395
29 3300049823 Ga0501044_0004149 Ga0501044_0004149_3943_5190 395
30 3300005937 Ga0081455_10103775 Ga0081455_101037752 396
31 3300025922 Ga0207646_10030633 Ga0207646_100306334 401
32 iso_pu_bacteria 2721755763 2723878796 403
33 iso_pu_bacteria 2855767633 2855772668 405
34 3300005844 Ga0068862_100003768 Ga0068862_1000037686 407
35 3300009551 Ga0105238_10027801 Ga0105238_100278015 407
36 3300021388 Ga0213875_10015419 Ga0213875_100154192 407
37 3300028379 Ga0268266_10007210 Ga0268266_100072107 407
38 3300028380 Ga0268265_10104232 Ga0268265_101042322 407
39 3300037853 Ga0436364_0905943 Ga0436364_0905943_2052_3284 407
40 3300048924 Ga0496121_0022506 Ga0496121_0022506_4376_5608 407
41 iso_pu_bacteria 2643221733 2644730093 407
42 iso_pu_bacteria 2643221734 2644737387 407
43 iso_pu_bacteria 2643221736 2644744232 407
44 iso_pu_bacteria 2687453129 2687578012 407
45 iso_pu_bacteria 2818991467 2819717538 407
46 iso_pu_bacteria 2841760612 2841765472 407
47 iso_pu_bacteria 2844104063 2844107082 407
48 iso_pu_bacteria 2851182111 2851186060 407
49 iso_pu_bacteria 2851246043 2851249122 407
50 iso_pu_bacteria 2917699015 2917705381 407
51 iso_pu_bacteria 8054563764 8054564700 407
52 iso_pu_bacteria 8054563764 8054564701 407
53 iso_pu_bacteria 8057529695 8057532358 407
54 3300003763 Ga0055529_1001227 Ga0055529_10012275 408
55 3300005548 Ga0070665_100001451 Ga0070665_1000014512 408
56 3300025272 Ga0209455_1001756 Ga0209455_10017563 408
57 3300028379 Ga0268266_10054239 Ga0268266_100542393 408
58 3300030521 Ga0307511_10059567 Ga0307511_100595672 408
59 3300031507 Ga0307509_10000118 Ga0307509_1000011835 408
60 3300048905 Ga0496102_0019471 Ga0496102_0019471_1530_2756 408
61 3300048920 Ga0496117_0000012 Ga0496117_0000012_2745_3971 408
62 3300048921 Ga0496118_0000003 Ga0496118_0000003_407137_408363 408
63 3300048923 Ga0496120_0015901 Ga0496120_0015901_1645_2871 408
64 3300048927 Ga0496124_0035008 Ga0496124_0035008_2031_3257 408
65 3300048928 Ga0496125_0044966 Ga0496125_0044966_734_1960 408
66 3300050514 nmdc:mga08x19_90014_c1 nmdc:mga08x19_90014_c1_713_1945 408
67 3300003187 JGI25151J46595_10000052 JGI25151J46595_10000052108 409
68 3300003187 JGI25151J46595_10000075 JGI25151J46595_1000007543 409
69 3300003203 JGI25406J46586_10029026 JGI25406J46586_100290262 409
70 3300003215 JGI25153J46596_10005584 JGI25153J46596_100055844 409
71 3300003771 Ga0055526_1002207 Ga0055526_100220712 409
72 3300003775 Ga0055524_1000014 Ga0055524_100001451 409
73 3300005262 Ga0065165_1000026 Ga0065165_100002614 409
74 3300005290 Ga0065712_10071782 Ga0065712_100717824 409
75 3300005327 Ga0070658_10013107 Ga0070658_100131078 409
76 3300005336 Ga0070680_100043577 Ga0070680_1000435772 409
77 3300005353 Ga0070669_100101061 Ga0070669_1001010612 409
78 3300005435 Ga0070714_100024960 Ga0070714_1000249603 409
79 3300005436 Ga0070713_100011632 Ga0070713_1000116323 409
80 3300005445 Ga0070708_100037599 Ga0070708_1000375994 409
81 3300005445 Ga0070708_100099986 Ga0070708_1000999861 409
82 3300005445 Ga0070708_100166245 Ga0070708_1001662452 409
83 3300005458 Ga0070681_10017518 Ga0070681_100175182 409
84 3300005467 Ga0070706_100000058 Ga0070706_10000005888 409
85 3300005467 Ga0070706_100044910 Ga0070706_1000449104 409
86 3300005467 Ga0070706_100358637 Ga0070706_1003586371 409
87 3300005468 Ga0070707_100065031 Ga0070707_1000650312 409
88 3300005468 Ga0070707_100093539 Ga0070707_1000935391 409
89 3300005468 Ga0070707_100093673 Ga0070707_1000936732 409
90 3300005471 Ga0070698_100056286 Ga0070698_1000562863 409
91 3300005471 Ga0070698_100418657 Ga0070698_1004186571 409
92 3300005518 Ga0070699_100010386 Ga0070699_10001038610 409
93 3300005518 Ga0070699_100172192 Ga0070699_1001721921 409
94 3300005530 Ga0070679_100028597 Ga0070679_1000285971 409
95 3300005536 Ga0070697_100001145 Ga0070697_10000114521 409
96 3300005536 Ga0070697_100078724 Ga0070697_1000787242 409
97 3300005536 Ga0070697_100090507 Ga0070697_1000905072 409
98 3300005539 Ga0068853_100074269 Ga0068853_1000742692 409
99 3300005548 Ga0070665_100009504 Ga0070665_1000095048 409
100 3300005548 Ga0070665_100146091 Ga0070665_1001460912 409
101 3300005563 Ga0068855_100163996 Ga0068855_1001639962 409
102 3300005616 Ga0068852_100159399 Ga0068852_1001593992 409
103 3300005617 Ga0068859_100220199 Ga0068859_1002201992 409
104 3300005842 Ga0068858_100044944 Ga0068858_1000449442 409
105 3300005843 Ga0068860_100179338 Ga0068860_1001793382 409
106 3300005844 Ga0068862_100121468 Ga0068862_1001214682 409
107 3300005937 Ga0081455_10007592 Ga0081455_100075929 409
108 3300005937 Ga0081455_10042808 Ga0081455_100428082 409
109 3300005981 Ga0081538_10023146 Ga0081538_100231464 409
110 3300005983 Ga0081540_1003437 Ga0081540_10034379 409
111 3300005983 Ga0081540_1034098 Ga0081540_10340983 409
112 3300005985 Ga0081539_10018439 Ga0081539_100184394 409
113 3300006028 Ga0070717_10001753 Ga0070717_100017539 409
114 3300006051 Ga0075364_10087591 Ga0075364_100875912 409
115 3300006175 Ga0070712_100014074 Ga0070712_1000140743 409
116 3300006237 Ga0097621_100216189 Ga0097621_1002161892 409
117 3300006844 Ga0075428_100028733 Ga0075428_1000287335 409
118 3300006844 Ga0075428_100092567 Ga0075428_1000925672 409
119 3300006844 Ga0075428_100260718 Ga0075428_1002607182 409
120 3300006846 Ga0075430_100035697 Ga0075430_1000356972 409
121 3300006847 Ga0075431_100037851 Ga0075431_1000378513 409
122 3300006847 Ga0075431_100234169 Ga0075431_1002341692 409
123 3300006852 Ga0075433_10067495 Ga0075433_100674952 409
124 3300006871 Ga0075434_100010673 Ga0075434_1000106734 409
125 3300006931 Ga0097620_100220192 Ga0097620_1002201922 409
126 3300007265 Ga0099794_10000061 Ga0099794_1000006137 409
127 3300007265 Ga0099794_10011956 Ga0099794_100119562 409
128 3300009093 Ga0105240_10002521 Ga0105240_100025217 409
129 3300009093 Ga0105240_10017319 Ga0105240_100173192 409
130 3300009093 Ga0105240_10422907 Ga0105240_104229071 409
131 3300009147 Ga0114129_10007423 Ga0114129_1000742310 409
132 3300009147 Ga0114129_10100257 Ga0114129_101002573 409
133 3300009148 Ga0105243_10138874 Ga0105243_101388742 409
134 3300009148 Ga0105243_10145255 Ga0105243_101452552 409
135 3300009174 Ga0105241_10085165 Ga0105241_100851651 409
136 3300009545 Ga0105237_10017156 Ga0105237_100171565 409
137 3300009551 Ga0105238_10153750 Ga0105238_101537504 409
138 3300010375 Ga0105239_10103473 Ga0105239_101034732 409
139 3300013250 Ga0171462_1012 Ga0171462_1012172 409
140 3300013297 Ga0157378_10288694 Ga0157378_102886942 409
141 3300014968 Ga0157379_10077558 Ga0157379_100775582 409
142 3300014968 Ga0157379_10126470 Ga0157379_101264702 409
143 3300025284 Ga0209130_1000024 Ga0209130_1000024307 409
144 3300025291 Ga0209675_1002662 Ga0209675_10026623 409
145 3300025292 Ga0209676_1015023 Ga0209676_10150232 409
146 3300025294 Ga0209025_1000017 Ga0209025_100001763 409
147 3300025294 Ga0209025_1000027 Ga0209025_1000027283 409
148 3300025294 Ga0209025_1002185 Ga0209025_100218514 409
149 3300025295 Ga0209564_1000074 Ga0209564_1000074233 409
150 3300025295 Ga0209564_1000082 Ga0209564_1000082176 409
151 3300025297 Ga0209758_1003296 Ga0209758_10032967 409
152 3300025299 Ga0209256_1000033 Ga0209256_1000033297 409
153 3300025302 Ga0207426_1005970 Ga0207426_10059704 409
154 3300025304 Ga0209257_1032576 Ga0209257_10325761 409
155 3300025900 Ga0207710_10053052 Ga0207710_100530522 409
156 3300025901 Ga0207688_10061209 Ga0207688_100612092 409
157 3300025909 Ga0207705_10008325 Ga0207705_100083253 409
158 3300025910 Ga0207684_10000066 Ga0207684_1000006634 409
159 3300025913 Ga0207695_10021699 Ga0207695_100216995 409
160 3300025914 Ga0207671_10020014 Ga0207671_100200142 409
161 3300025914 Ga0207671_10100664 Ga0207671_101006642 409
162 3300025918 Ga0207662_10005426 Ga0207662_100054262 409
163 3300025918 Ga0207662_10088714 Ga0207662_100887141 409
164 3300025920 Ga0207649_10022820 Ga0207649_100228203 409
165 3300025921 Ga0207652_10009999 Ga0207652_100099993 409
166 3300025922 Ga0207646_10030255 Ga0207646_100302552 409
167 3300025922 Ga0207646_10061481 Ga0207646_100614813 409
168 3300025923 Ga0207681_10098761 Ga0207681_100987613 409
169 3300025924 Ga0207694_10095486 Ga0207694_100954862 409
170 3300025928 Ga0207700_10013617 Ga0207700_100136173 409
171 3300025928 Ga0207700_10028948 Ga0207700_100289484 409
172 3300025928 Ga0207700_10132205 Ga0207700_101322052 409
173 3300025933 Ga0207706_10270864 Ga0207706_102708641 409
174 3300025938 Ga0207704_10024293 Ga0207704_100242933 409
175 3300025942 Ga0207689_10263304 Ga0207689_102633042 409
176 3300025949 Ga0207667_10025602 Ga0207667_100256025 409
177 3300025961 Ga0207712_10177539 Ga0207712_101775391 409
178 3300025981 Ga0207640_10101350 Ga0207640_101013502 409
179 3300026023 Ga0207677_10085475 Ga0207677_100854752 409
180 3300026035 Ga0207703_10272072 Ga0207703_102720721 409
181 3300026067 Ga0207678_10169390 Ga0207678_101693902 409
182 3300026075 Ga0207708_10138027 Ga0207708_101380272 409
183 3300026078 Ga0207702_10031661 Ga0207702_100316614 409
184 3300026142 Ga0207698_10091569 Ga0207698_100915691 409
185 3300026142 Ga0207698_10348114 Ga0207698_103481141 409
186 3300027671 Ga0209588_1000039 Ga0209588_100003941 409
187 3300028379 Ga0268266_10033142 Ga0268266_100331423 409
188 3300028379 Ga0268266_10124023 Ga0268266_101240232 409
189 3300028380 Ga0268265_10021737 Ga0268265_100217376 409
190 3300031239 Ga0265328_10043013 Ga0265328_100430132 409
191 3300031240 Ga0265320_10010896 Ga0265320_100108963 409
192 3300031247 Ga0265340_10023374 Ga0265340_100233742 409
193 3300031616 Ga0307508_10238075 Ga0307508_102380752 409
194 3300031712 Ga0265342_10020568 Ga0265342_100205684 409
195 3300031712 Ga0265342_10024705 Ga0265342_100247052 409
196 3300035121 Ga0373960_0001728 Ga0373960_0001728_3298_4545 409
197 3300035691 Ga0373931_0016827 Ga0373931_0016827_108_1349 409
198 3300037312 Ga0395899_0004614 Ga0395899_0004614_7881_9137 409
199 3300037418 Ga0395900_0006806 Ga0395900_0006806_9602_10843 409
200 3300037418 Ga0395900_0025067 Ga0395900_0025067_383_1639 409
201 3300037418 Ga0395900_0115708 Ga0395900_0115708_623_1879 409
202 3300037466 Ga0395898_0025644 Ga0395898_0025644_283_1539 409
203 3300038443 Ga0395901_0026772 Ga0395901_0026772_461_1717 409
204 3300038443 Ga0395901_0042132 Ga0395901_0042132_2962_4203 409
205 3300039438 Ga0436360_0736765 Ga0436360_0736765_3583_4821 409
206 3300044842 Ga0466957_0145834 Ga0466957_0145834_129_1370 409
207 3300046459 Ga0495629_0112537 Ga0495629_0112537_160_1407 409
208 3300046460 Ga0495638_0070995 Ga0495638_0070995_768_2015 409
209 3300046474 Ga0495605_0011248 Ga0495605_0011248_324_1571 409
210 3300046491 Ga0495584_0065352 Ga0495584_0065352_85_1332 409
211 3300046500 Ga0495596_0006731 Ga0495596_0006731_266_1513 409
212 3300046507 Ga0495606_0047814 Ga0495606_0047814_862_2109 409
213 3300046513 Ga0495616_0008458 Ga0495616_0008458_396_1643 409
214 3300046518 Ga0495631_0028844 Ga0495631_0028844_486_1733 409
215 3300046519 Ga0495632_0036234 Ga0495632_0036234_1205_2452 409
216 3300046522 Ga0495643_0009967 Ga0495643_0009967_4518_5765 409
217 3300046528 Ga0495642_0007048 Ga0495642_0007048_22_1269 409
218 3300046542 Ga0495597_0048283 Ga0495597_0048283_380_1627 409
219 3300046648 Ga0495611_0044841 Ga0495611_0044841_235_1482 409
220 3300046660 Ga0495625_0158854 Ga0495625_0158854_76_1323 409
221 3300046665 Ga0495661_0108315 Ga0495661_0108315_186_1433 409
222 3300046691 Ga0495670_0023779 Ga0495670_0023779_863_2110 409
223 3300046694 Ga0495649_0079849 Ga0495649_0079849_430_1677 409
224 3300047320 Ga0495672_0047216 Ga0495672_0047216_10_1257 409
225 3300047323 Ga0495683_0025873 Ga0495683_0025873_205_1452 409
226 3300047445 Ga0495677_0015814 Ga0495677_0015814_1084_2331 409
227 3300047446 Ga0495679_023796 Ga0495679_023796_171_1418 409
228 3300047469 Ga0495673_0025286 Ga0495673_0025286_303_1550 409
229 3300048905 Ga0496102_0037931 Ga0496102_0037931_163_1410 409
230 3300048907 Ga0496104_0051479 Ga0496104_0051479_1629_2864 409
231 3300048909 Ga0496106_0000407 Ga0496106_0000407_28728_29969 409
232 3300048910 Ga0496107_0125554 Ga0496107_0125554_136_1383 409
233 3300048914 Ga0496111_0039545 Ga0496111_0039545_798_2033 409
234 3300048914 Ga0496111_0094940 Ga0496111_0094940_185_1432 409
235 3300048915 Ga0496112_0067505 Ga0496112_0067505_1459_2694 409
236 3300048915 Ga0496112_0106506 Ga0496112_0106506_840_2087 409
237 3300048916 Ga0496113_0021668 Ga0496113_0021668_3120_4367 409
238 3300048920 Ga0496117_0015968 Ga0496117_0015968_5098_6339 409
239 3300048920 Ga0496117_0108205 Ga0496117_0108205_13_1248 409
240 3300048921 Ga0496118_0007159 Ga0496118_0007159_6939_8180 409
241 3300048922 Ga0496119_0049697 Ga0496119_0049697_692_1939 409
242 3300048924 Ga0496121_0000353 Ga0496121_0000353_35403_36644 409
243 3300048924 Ga0496121_0052661 Ga0496121_0052661_338_1585 409
244 3300048925 Ga0496122_0033696 Ga0496122_0033696_1164_2399 409
245 3300048927 Ga0496124_0001860 Ga0496124_0001860_4376_5617 409
246 3300048928 Ga0496125_0022715 Ga0496125_0022715_4066_5307 409
247 3300048929 Ga0496126_0007832 Ga0496126_0007832_9173_10435 409
248 3300048929 Ga0496126_0026275 Ga0496126_0026275_3550_4791 409
249 3300048929 Ga0496126_0094634 Ga0496126_0094634_188_1435 409
250 3300049459 Ga0495678_037770 Ga0495678_037770_175_1422 409
251 3300049570 Ga0501033_0032757 Ga0501033_0032757_599_1837 409
252 3300049571 Ga0501034_0003283 Ga0501034_0003283_9707_10948 409
253 3300049571 Ga0501034_0079570 Ga0501034_0079570_263_1498 409
254 3300049571 Ga0501034_0096129 Ga0501034_0096129_1165_2403 409
255 3300049574 Ga0501038_0155658 Ga0501038_0155658_394_1632 409
256 3300049581 Ga0501047_0001041 Ga0501047_0001041_15023_16261 409
257 3300049822 Ga0501035_0030822 Ga0501035_0030822_1499_2737 409
258 3300049822 Ga0501035_0109566 Ga0501035_0109566_46_1281 409
259 3300049823 Ga0501044_0001441 Ga0501044_0001441_20319_21557 409
260 3300049823 Ga0501044_0125445 Ga0501044_0125445_671_1909 409
261 3300049823 Ga0501044_0179732 Ga0501044_0179732_560_1795 409
262 3300049823 Ga0501044_0352568 Ga0501044_0352568_38_1273 409
263 3300049824 Ga0501045_0197941 Ga0501045_0197941_49_1284 409
264 3300050491 nmdc:mga00v17_27961_c1 nmdc:mga00v17_27961_c1_1745_2983 409
265 3300050495 nmdc:mga04h51_24413_c1 nmdc:mga04h51_24413_c1_572_1819 409
266 3300050507 nmdc:mga05p37_35991_c1 nmdc:mga05p37_35991_c1_942_2171 409
267 3300050507 nmdc:mga05p37_95897_c1 nmdc:mga05p37_95897_c1_1191_2474 409
268 3300050508 nmdc:mga09592_144172_c1 nmdc:mga09592_144172_c1_751_2019 409
269 3300050512 nmdc:mga0n895_115574_c1 nmdc:mga0n895_115574_c1_1367_2659 409
270 3300050512 nmdc:mga0n895_4672_c1 nmdc:mga0n895_4672_c1_1460_2695 409
271 3300050515 nmdc:mga0a205_119645_c1 nmdc:mga0a205_119645_c1_517_1746 409
272 3300050516 nmdc:mga0sz30_13724_c1 nmdc:mga0sz30_13724_c1_721_1959 409
273 3300053086 Ga0500578_0067608 Ga0500578_0067608_694_1941 409
274 3300053089 Ga0500581_067789 Ga0500581_067789_439_1686 409
275 3300053092 Ga0500583_0017735 Ga0500583_0017735_1491_2735 409
276 3300053093 Ga0500651_0131654 Ga0500651_0131654_205_1452 409
277 3300053096 Ga0500641_0018265 Ga0500641_0018265_947_2191 409
278 3300053134 Ga0500658_0016481 Ga0500658_0016481_1046_2284 409
279 3300053139 Ga0500568_0002029 Ga0500568_0002029_5184_6422 409
280 3300053153 Ga0500616_0002266 Ga0500616_0002266_15082_16320 409
281 3300053158 Ga0500627_0046521 Ga0500627_0046521_316_1563 409
282 3300053733 Ga0500552_000603 Ga0500552_000603_1145_2383 409
283 3300060353 Ga0501082_0036450 Ga0501082_0036450_856_2091 409
284 iso_pu_bacteria 2855730933 2855735730 409

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01979

Amidohydro_1

Amidohydrolase family

94

447

0.88

PF07969

Amidohydro_3

Amidohydrolase family

108

426

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mkv-assembly1.cif.gz_G crystal structure of amidohydrolase eaj56179 0.9757 2 409
3feq-assembly2.cif.gz_O crystal structure of uncharacterized protein eah89906 0.9752 2 406
3feq-assembly2.cif.gz_M crystal structure of uncharacterized protein eah89906 0.9744 2 406
3feq-assembly2.cif.gz_J crystal structure of uncharacterized protein eah89906 0.974 2 406
3feq-assembly2.cif.gz_N crystal structure of uncharacterized protein eah89906 0.9731 2 406
ID Description Score Start End Superfamily
2r8cG02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9663 57 359 3.20.20.140
2r8cA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9648 2 55 2.30.40.10
af_P40896_13_285_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9648 89 357 3.20.20.140
2r8cG02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.954 57 359 3.20.20.140
af_P40896_13_285_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9475 89 357 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A536S0Y8-F1-model_v4 Amidohydrolase family protein 0.9943 2 409 GO:0016810
AF-A0A7V8FNN0-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9925 2 408 GO:0016810
AF-A0A536S0Y8-F1-model_v4 Amidohydrolase family protein 0.9895 2 409 GO:0016810
AF-A0A8B3LH30-F1-model_v4 Amidohydrolase family protein 0.9875 328 409 GO:0016810
AF-A0A4Q4VY74-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9869 163 266 GO:0016787

Feature Viewer

pLDDT pTM Quality
94.74 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map