F386103

General Info

Members Datasets Scaffolds Average Seq Length
284 142 528 361

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10007709|Ga0081455_100077094
Length 399
Sequence MLWLPSDDGLLPPSARRAPYVCTVQGRTLGGFQKYVKAPMITKAVSRRCLVARAAAGVVSFPAPAIAQGLLKLKMVTDWPGQSKGFQSSAERLARAIHAASAGRIAIEVFPANTLVKALETFDAVSAGVADMYHSAEYYWEERSPAFTFFATVPFGLSADELFAWVHYGGGQELWDALGGQFNIKPLLCLNSGVQMGGWFNGPLTSVGDFKGLRYRMPGQGGEVLRRLGATVVTLPGGDIVQALKSGAIDASEWVGPWMDMDLGLHRVASHYYYPGFHEPGTGLTVGFNRGVWDRIAPSDRRLIEDAAAAEYARGVAEFSANNAWCLRKLREEGKVKIAPFDEAVIKAFLAHSRDVVAKAATADDLSRKIYASYQDFRTAIMDWSDIAERAYLNSRGLK

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
74 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
77 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
80 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
81 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
88 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
89 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
90 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
91 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
92 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
93 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
94 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
101 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
102 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
103 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
126 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
127 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
135 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
136 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
137 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
138 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
139 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
142 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.59
Metatranscriptomes 0.7
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.52
Nodule 0
Rhizoplane 0
Rhizosphere 93.31
Stem 0
Stem Tuber 0
Unclassified 6.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10007709 3300005937 Bacteria 11292
2 JGI25405J52794_10012526 3300003911 Bacteria 1634
3 Ga0070683_100008893 3300005329 Bacteria 8556
4 Ga0070670_100330805 3300005331 Bacteria 1336
5 Ga0070680_100004631 3300005336 Bacteria 10339
6 Ga0070675_100136188 3300005354 Bacteria 2096
7 Ga0070671_100006517 3300005355 Bacteria 9333
8 Ga0070674_100097255 3300005356 Bacteria 2138
9 Ga0070673_100027591 3300005364 Bacteria 4211
10 Ga0070709_10047253 3300005434 Bacteria 2680
11 Ga0070714_100009353 3300005435 Bacteria 7700
12 Ga0070714_100263908 3300005435 Unclassified 1595
13 Ga0070713_100007902 3300005436 Bacteria 7508
14 Ga0070713_100053070 3300005436 Bacteria 3358
15 Ga0070713_100070080 3300005436 Bacteria 2959
16 Ga0070710_10006979 3300005437 Bacteria 5448
17 Ga0070710_10009786 3300005437 Bacteria 4696
18 Ga0070711_100002196 3300005439 Bacteria 11076
19 Ga0070711_100029571 3300005439 Bacteria 3617
20 Ga0070708_100185760 3300005445 Unclassified 1944
21 Ga0070663_100122450 3300005455 Bacteria 1966
22 Ga0070678_100057648 3300005456 Bacteria 2847
23 Ga0070681_10088045 3300005458 Bacteria 3058
24 Ga0070706_100009734 3300005467 Bacteria 8932
25 Ga0070706_100016756 3300005467 Bacteria 6769
26 Ga0070706_100050491 3300005467 Bacteria 3838
27 Ga0070706_100141540 3300005467 Bacteria 2245
28 Ga0070706_100375613 3300005467 Bacteria 1324
29 Ga0070707_100002314 3300005468 Bacteria 18203
30 Ga0070707_100077401 3300005468 Bacteria 3209
31 Ga0070707_100263172 3300005468 Bacteria 1677
32 Ga0070698_100062805 3300005471 Bacteria 3747
33 Ga0070699_100012341 3300005518 Bacteria 7373
34 Ga0070699_100036898 3300005518 Bacteria 4228
35 Ga0070699_100037996 3300005518 Bacteria 4168
36 Ga0070679_100094602 3300005530 Unclassified 2975
37 Ga0070679_100369968 3300005530 Bacteria 1380
38 Ga0070684_100079784 3300005535 Unclassified 2894
39 Ga0070697_100039982 3300005536 Bacteria 3793
40 Ga0070697_100051166 3300005536 Bacteria 3356
41 Ga0070697_100063249 3300005536 Bacteria 3022
42 Ga0070697_100117753 3300005536 Bacteria 2219
43 Ga0068853_100311860 3300005539 Bacteria 1456
44 Ga0068855_100069792 3300005563 Bacteria 4089
45 Ga0068857_100025035 3300005577 Bacteria 5257
46 Ga0081455_10001349 3300005937 Bacteria 30412
47 Ga0081455_10002262 3300005937 Bacteria 22944
48 Ga0081455_10002901 3300005937 Bacteria 20136
49 Ga0081455_10019790 3300005937 Bacteria 6357
50 Ga0081455_10021450 3300005937 Bacteria 6059
51 Ga0081455_10022543 3300005937 Bacteria 5884
52 Ga0081455_10046440 3300005937 Bacteria 3767
53 Ga0081455_10061252 3300005937 Unclassified 3167
54 Ga0081455_10092935 3300005937 Bacteria 2440
55 Ga0081540_1003183 3300005983 Bacteria 13074
56 Ga0081540_1003427 3300005983 Bacteria 12537
57 Ga0070717_10004059 3300006028 Bacteria 10551
58 Ga0070717_10013103 3300006028 Bacteria 6337
59 Ga0070717_10072799 3300006028 Bacteria 2870
60 Ga0070717_10075454 3300006028 Bacteria 2820
61 Ga0070717_10262945 3300006028 Unclassified 1527
62 Ga0075365_10003653 3300006038 Bacteria 7979
63 Ga0075365_10032647 3300006038 Bacteria 3349
64 Ga0075364_10046496 3300006051 Bacteria 2826
65 Ga0075432_10053683 3300006058 Bacteria 1426
66 Ga0070715_10030949 3300006163 Unclassified 2168
67 Ga0070715_10037784 3300006163 Bacteria 2000
68 Ga0070716_100022733 3300006173 Bacteria 3317
69 Ga0070712_100008777 3300006175 Bacteria 6363
70 Ga0070712_100017497 3300006175 Bacteria 4642
71 Ga0070712_100066322 3300006175 Unclassified 2565
72 Ga0070712_100093822 3300006175 Bacteria 2204
73 Ga0070712_100136873 3300006175 Bacteria 1863
74 Ga0070712_100223843 3300006175 Unclassified 1491
75 Ga0075428_100006016 3300006844 Bacteria 13478
76 Ga0075428_100064936 3300006844 Bacteria 3997
77 Ga0075430_100013323 3300006846 Bacteria 7008
78 Ga0075430_100119784 3300006846 Bacteria 2194
79 Ga0075430_100162237 3300006846 Bacteria 1860
80 Ga0075431_100005063 3300006847 Bacteria 12969
81 Ga0075431_100013330 3300006847 Bacteria 8309
82 Ga0075431_100013449 3300006847 Bacteria 8266
83 Ga0075431_100018887 3300006847 Bacteria 7022
84 Ga0075431_100045150 3300006847 Bacteria 4543
85 Ga0075431_100459316 3300006847 Bacteria 1268
86 Ga0075431_100493488 3300006847 Bacteria 1216
87 Ga0075433_10000309 3300006852 Bacteria 29591
88 Ga0075433_10008726 3300006852 Bacteria 8087
89 Ga0075434_100000317 3300006871 Bacteria 34482
90 Ga0075434_100024480 3300006871 Bacteria 5902
91 Ga0075434_100035402 3300006871 Bacteria 4936
92 Ga0075434_100038383 3300006871 Bacteria 4743
93 Ga0075434_100078918 3300006871 Bacteria 3288
94 Ga0075434_100134610 3300006871 Bacteria 2491
95 Ga0075434_100215203 3300006871 Bacteria 1941
96 Ga0075434_100282600 3300006871 Unclassified 1679
97 Ga0075429_100007428 3300006880 Bacteria 9512
98 Ga0075429_100016139 3300006880 Bacteria 6471
99 Ga0075429_100028270 3300006880 Bacteria 4869
100 Ga0075429_100066686 3300006880 Bacteria 3134
101 Ga0075435_100011011 3300007076 Bacteria 6632
102 Ga0075435_100021585 3300007076 Bacteria 4955
103 Ga0075435_100028607 3300007076 Bacteria 4372
104 Ga0075435_100207452 3300007076 Bacteria 1661
105 Ga0099794_10008183 3300007265 Bacteria 4334
106 Ga0111539_10000072 3300009094 Bacteria 100461
107 Ga0111539_10018412 3300009094 Bacteria 8652
108 Ga0111539_10079294 3300009094 Bacteria 3863
109 Ga0111539_10102401 3300009094 Bacteria 3361
110 Ga0111539_10376594 3300009094 Bacteria 1653
111 Ga0111539_10692627 3300009094 Bacteria 1186
112 Ga0114129_10000134 3300009147 Bacteria 76265
113 Ga0114129_10035357 3300009147 Bacteria 7057
114 Ga0157373_10013370 3300013100 Bacteria 6020
115 Ga0157370_10132204 3300013104 Bacteria 2327
116 Ga0157374_10338203 3300013296 Bacteria 1494
117 Ga0157372_10296498 3300013307 Bacteria 1881
118 Ga0157372_10515829 3300013307 Unclassified 1393
119 Ga0157375_10176392 3300013308 Bacteria 2287
120 Ga0207692_10015184 3300025898 Bacteria 3383
121 Ga0207692_10067083 3300025898 Bacteria 1877
122 Ga0207685_10008082 3300025905 Bacteria 2975
123 Ga0207685_10044211 3300025905 Bacteria 1682
124 Ga0207699_10048472 3300025906 Bacteria 2496
125 Ga0207699_10131085 3300025906 Unclassified 1635
126 Ga0207684_10026722 3300025910 Bacteria 4920
127 Ga0207684_10042946 3300025910 Bacteria 3832
128 Ga0207684_10061927 3300025910 Bacteria 3177
129 Ga0207684_10093452 3300025910 Bacteria 2565
130 Ga0207684_10114315 3300025910 Unclassified 2311
131 Ga0207707_10263686 3300025912 Bacteria 1494
132 Ga0207693_10006176 3300025915 Bacteria 9937
133 Ga0207693_10013627 3300025915 Bacteria 6551
134 Ga0207693_10017095 3300025915 Bacteria 5788
135 Ga0207693_10018204 3300025915 Bacteria 5597
136 Ga0207693_10054700 3300025915 Unclassified 3130
137 Ga0207693_10065164 3300025915 Bacteria 2853
138 Ga0207663_10040029 3300025916 Unclassified 2845
139 Ga0207660_10089842 3300025917 Bacteria 2275
140 Ga0207657_10009887 3300025919 Bacteria 9550
141 Ga0207646_10021747 3300025922 Bacteria 5920
142 Ga0207650_10370625 3300025925 Bacteria 1181
143 Ga0207659_10083474 3300025926 Bacteria 2368
144 Ga0207700_10039860 3300025928 Bacteria 3423
145 Ga0207700_10172431 3300025928 Bacteria 1806
146 Ga0207709_10217968 3300025935 Bacteria 1374
147 Ga0207669_10014429 3300025937 Bacteria 3959
148 Ga0207665_10019759 3300025939 Bacteria 4427
149 Ga0207665_10032715 3300025939 Bacteria 3444
150 Ga0207661_10010135 3300025944 Bacteria 6774
151 Ga0207667_10034272 3300025949 Bacteria 5453
152 Ga0207675_100223245 3300026118 Bacteria 1816
153 Ga0207683_10070388 3300026121 Bacteria 3090
154 Ga0207428_10000295 3300027907 Bacteria 66554
155 Ga0207428_10004940 3300027907 Bacteria 12560
156 Ga0207428_10015097 3300027907 Bacteria 6688
157 Ga0265325_10000349 3300031241 Bacteria 32663
158 Ga0316593_10009595 3300032168 Bacteria 2741
159 Ga0316596_1031312 3300033541 Bacteria 1381
160 Ga0373944_0012401 3300035089 Bacteria 2348
161 Ga0373956_0112700 3300035119 Bacteria 1267
162 Ga0373943_0004378 3300035170 Bacteria 6404
163 Ga0373946_0023485 3300035171 Bacteria 2409
164 Ga0373955_0043235 3300035172 Bacteria 2423
165 Ga0316574_0077958 3300035398 Bacteria 2101
166 Ga0373927_0010158 3300035695 Bacteria 6293
167 Ga0373933_0013232 3300035724 Bacteria 4571
168 Ga0316584_0128330 3300036712 Unclassified 1894
169 Ga0373925_0042017 3300037068 Bacteria 3391
170 Ga0395905_0435705 3300037471 Bacteria 1208
171 Ga0400490_09187 3300038726 Bacteria 13138
172 Ga0400485_14620 3300038735 Bacteria 15556
173 Ga0400488_20997 3300038741 Bacteria 8292
174 Ga0400486_03899 3300038742 Bacteria 26107
175 Ga0400486_22995 3300038742 Bacteria 12314
176 Ga0400483_073372 3300039062 Bacteria 7837
177 Ga0400487_18909 3300039110 Bacteria 13007
178 Ga0400487_35870 3300039110 Bacteria 16516
179 Ga0495592_0082725 3300046454 Bacteria 2319
180 Ga0495603_0013144 3300046455 Bacteria 5004
181 Ga0495629_0037162 3300046459 Bacteria 3432
182 Ga0495641_0016989 3300046461 Bacteria 3810
183 Ga0495651_0102949 3300046462 Bacteria 2122
184 Ga0495653_0006262 3300046463 Bacteria 9765
185 Ga0495582_0019412 3300046473 Bacteria 3716
186 Ga0495639_0039092 3300046475 Bacteria 2132
187 Ga0495662_0038586 3300046476 Bacteria 2308
188 Ga0495664_0039149 3300046477 Bacteria 2801
189 Ga0495594_0061126 3300046499 Bacteria 2084
190 Ga0495618_0002747 3300046514 Bacteria 11192
191 Ga0495628_0040599 3300046516 Bacteria 3718
192 Ga0495630_0005471 3300046517 Bacteria 8968
193 Ga0495666_0005373 3300046526 Bacteria 6453
194 Ga0495652_0009788 3300046529 Bacteria 8693
195 Ga0495640_0005792 3300046533 Bacteria 9811
196 Ga0495667_0002217 3300046559 Bacteria 13009
197 Ga0495634_0009776 3300046642 Bacteria 7058
198 Ga0495588_0132828 3300046674 Bacteria 1313
199 Ga0495657_0096410 3300046675 Unclassified 1890
200 Ga0495613_0035096 3300046689 Bacteria 3723
201 Ga0495624_0040442 3300046690 Bacteria 2986
202 Ga0495600_0003558 3300046809 Bacteria 9166
203 Ga0495581_0011140 3300047315 Bacteria 5196
204 Ga0495581_0021468 3300047315 Bacteria 3743
205 Ga0495604_0003514 3300047317 Bacteria 12484
206 Ga0495604_0179675 3300047317 Bacteria 1481
207 Ga0495674_0026129 3300047319 Bacteria 5344
208 Ga0495676_0020034 3300047321 Bacteria 5876
209 Ga0495680_0005523 3300047322 Bacteria 11871
210 Ga0495684_0001316 3300047471 Bacteria 19988
211 Ga0495602_0035907 3300048088 Bacteria 4618
212 Ga0501047_0080565 3300049581 Bacteria 3129
213 nmdc:mga03683_81189_c1 3300050489 Bacteria 1400
214 nmdc:mga00v17_41847_c1 3300050491 Bacteria 2753
215 nmdc:mga0yw44_71489_c1 3300050492 Bacteria 2154
216 nmdc:mga0yw44_7529_c1 3300050492 Bacteria 5364
217 nmdc:mga05p37_166314_c1 3300050507 Bacteria 2692
218 nmdc:mga05p37_509_c2 3300050507 Bacteria 24814
219 nmdc:mga05p37_51_c1 3300050507 Bacteria 103396
220 nmdc:mga05p37_59282_c1 3300050507 Bacteria 4714
221 nmdc:mga05p37_66171_c1 3300050507 Bacteria 4445
222 nmdc:mga09592_2096_c1 3300050508 Bacteria 16096
223 nmdc:mga09592_31778_c1 3300050508 Bacteria 4400
224 nmdc:mga09592_7343_c1 3300050508 Bacteria 8958
225 nmdc:mga0qj67_111497_c1 3300050509 Bacteria 2209
226 nmdc:mga0qj67_1438_c1 3300050509 Bacteria 16682
227 nmdc:mga0qj67_24941_c1 3300050509 Bacteria 4615
228 nmdc:mga0qj67_24969_c1 3300050509 Bacteria 4612
229 nmdc:mga06r32_20033_c1 3300050510 Bacteria 6150
230 nmdc:mga06r32_340313_c1 3300050510 Bacteria 1485
231 nmdc:mga06r32_4023_c1 3300050510 Bacteria 13177
232 nmdc:mga06r32_42016_c1 3300050510 Bacteria 4345
233 nmdc:mga06r32_459814_c1 3300050510 Bacteria 1252
234 nmdc:mga06r32_536_c1 3300050510 Bacteria 32887
235 nmdc:mga06r32_85870_c1 3300050510 Bacteria 3069
236 nmdc:mga06r32_94396_c1 3300050510 Bacteria 2927
237 nmdc:mga08y16_2584_c1 3300050511 Bacteria 18614
238 nmdc:mga08y16_421880_c1 3300050511 Bacteria 1363
239 nmdc:mga08y16_454377_c1 3300050511 Bacteria 1306
240 nmdc:mga08y16_6849_c1 3300050511 Bacteria 11949
241 nmdc:mga08y16_82402_c1 3300050511 Bacteria 3353
242 nmdc:mga08y16_91743_c1 3300050511 Bacteria 3166
243 nmdc:mga0n895_10635_c1 3300050512 Bacteria 8148
244 nmdc:mga0n895_132623_c1 3300050512 Bacteria 2517
245 nmdc:mga0n895_29795_c1 3300050512 Bacteria 5207
246 nmdc:mga0n895_3039_c1 3300050512 Bacteria 13353
247 nmdc:mga0n895_9755_c1 3300050512 Plasmid 3013
248 nmdc:mga0rr50_195748_c1 3300050513 Bacteria 1659
249 nmdc:mga0rr50_2155_c1 3300050513 Bacteria 11006
250 nmdc:mga0rr50_251483_c1 3300050513 Bacteria 1468
251 nmdc:mga0rr50_36915_c1 3300050513 Plasmid 3523
252 nmdc:mga08x19_140976_c1 3300050514 Bacteria 1628
253 nmdc:mga0a205_2138_c1 3300050515 Bacteria 17353
254 nmdc:mga0a205_217839_c1 3300050515 Bacteria 1795
255 nmdc:mga0a205_44515_c1 3300050515 Bacteria 4279
256 Ga0495601_0002640 3300053077 Bacteria 10174
257 Ga0495601_0005426 3300053077 Bacteria 7424
258 Ga0495612_0022707 3300053078 Bacteria 2514
259 Ga0495595_0001449 3300053084 Bacteria 9253
260 Ga0495595_0015305 3300053084 Bacteria 3270
261 Ga0495619_0004723 3300053085 Bacteria 8670
262 Ga0495619_0187273 3300053085 Bacteria 1432
263 2885382531 2885374607 Bacteria 8927485
264 2894775988 2894772417 Bacteria 5305674
265 Ga0081455_10007709
266 JGI25405J52794_10012526
267 Ga0070683_100008893
268 Ga0070670_100330805
269 Ga0070680_100004631
270 Ga0070675_100136188
271 Ga0070671_100006517
272 Ga0070674_100097255
273 Ga0070673_100027591
274 Ga0070709_10047253
275 Ga0070714_100009353
276 Ga0070714_100263908
277 Ga0070713_100007902
278 Ga0070713_100053070
279 Ga0070713_100070080
280 Ga0070710_10006979
281 Ga0070710_10009786
282 Ga0070711_100002196
283 Ga0070711_100029571
284 Ga0070708_100185760
285 Ga0070663_100122450
286 Ga0070678_100057648
287 Ga0070681_10088045
288 Ga0070706_100009734
289 Ga0070706_100016756
290 Ga0070706_100050491
291 Ga0070706_100141540
292 Ga0070706_100375613
293 Ga0070707_100002314
294 Ga0070707_100077401
295 Ga0070707_100263172
296 Ga0070698_100062805
297 Ga0070699_100012341
298 Ga0070699_100036898
299 Ga0070699_100037996
300 Ga0070679_100094602
301 Ga0070679_100369968
302 Ga0070684_100079784
303 Ga0070697_100039982
304 Ga0070697_100051166
305 Ga0070697_100063249
306 Ga0070697_100117753
307 Ga0068853_100311860
308 Ga0068855_100069792
309 Ga0068857_100025035
310 Ga0081455_10001349
311 Ga0081455_10002262
312 Ga0081455_10002901
313 Ga0081455_10019790
314 Ga0081455_10021450
315 Ga0081455_10022543
316 Ga0081455_10046440
317 Ga0081455_10061252
318 Ga0081455_10092935
319 Ga0081540_1003183
320 Ga0081540_1003427
321 Ga0070717_10004059
322 Ga0070717_10013103
323 Ga0070717_10072799
324 Ga0070717_10075454
325 Ga0070717_10262945
326 Ga0075365_10003653
327 Ga0075365_10032647
328 Ga0075364_10046496
329 Ga0075432_10053683
330 Ga0070715_10030949
331 Ga0070715_10037784
332 Ga0070716_100022733
333 Ga0070712_100008777
334 Ga0070712_100017497
335 Ga0070712_100066322
336 Ga0070712_100093822
337 Ga0070712_100136873
338 Ga0070712_100223843
339 Ga0075428_100006016
340 Ga0075428_100064936
341 Ga0075430_100013323
342 Ga0075430_100119784
343 Ga0075430_100162237
344 Ga0075431_100005063
345 Ga0075431_100013330
346 Ga0075431_100013449
347 Ga0075431_100018887
348 Ga0075431_100045150
349 Ga0075431_100459316
350 Ga0075431_100493488
351 Ga0075433_10000309
352 Ga0075433_10008726
353 Ga0075434_100000317
354 Ga0075434_100024480
355 Ga0075434_100035402
356 Ga0075434_100038383
357 Ga0075434_100078918
358 Ga0075434_100134610
359 Ga0075434_100215203
360 Ga0075434_100282600
361 Ga0075429_100007428
362 Ga0075429_100016139
363 Ga0075429_100028270
364 Ga0075429_100066686
365 Ga0075435_100011011
366 Ga0075435_100021585
367 Ga0075435_100028607
368 Ga0075435_100207452
369 Ga0099794_10008183
370 Ga0111539_10000072
371 Ga0111539_10018412
372 Ga0111539_10079294
373 Ga0111539_10102401
374 Ga0111539_10376594
375 Ga0111539_10692627
376 Ga0114129_10000134
377 Ga0114129_10035357
378 Ga0157373_10013370
379 Ga0157370_10132204
380 Ga0157374_10338203
381 Ga0157372_10296498
382 Ga0157372_10515829
383 Ga0157375_10176392
384 Ga0207692_10015184
385 Ga0207692_10067083
386 Ga0207685_10008082
387 Ga0207685_10044211
388 Ga0207699_10048472
389 Ga0207699_10131085
390 Ga0207684_10026722
391 Ga0207684_10042946
392 Ga0207684_10061927
393 Ga0207684_10093452
394 Ga0207684_10114315
395 Ga0207707_10263686
396 Ga0207693_10006176
397 Ga0207693_10013627
398 Ga0207693_10017095
399 Ga0207693_10018204
400 Ga0207693_10054700
401 Ga0207693_10065164
402 Ga0207663_10040029
403 Ga0207660_10089842
404 Ga0207657_10009887
405 Ga0207646_10021747
406 Ga0207650_10370625
407 Ga0207659_10083474
408 Ga0207700_10039860
409 Ga0207700_10172431
410 Ga0207709_10217968
411 Ga0207669_10014429
412 Ga0207665_10019759
413 Ga0207665_10032715
414 Ga0207661_10010135
415 Ga0207667_10034272
416 Ga0207675_100223245
417 Ga0207683_10070388
418 Ga0207428_10000295
419 Ga0207428_10004940
420 Ga0207428_10015097
421 Ga0265325_10000349
422 Ga0316593_10009595
423 Ga0316596_1031312
424 Ga0373944_0012401
425 Ga0373956_0112700
426 Ga0373943_0004378
427 Ga0373946_0023485
428 Ga0373955_0043235
429 Ga0316574_0077958
430 Ga0373927_0010158
431 Ga0373933_0013232
432 Ga0316584_0128330
433 Ga0373925_0042017
434 Ga0395905_0435705
435 Ga0400490_09187
436 Ga0400485_14620
437 Ga0400488_20997
438 Ga0400486_03899
439 Ga0400486_22995
440 Ga0400483_073372
441 Ga0400487_18909
442 Ga0400487_35870
443 Ga0495592_0082725
444 Ga0495603_0013144
445 Ga0495629_0037162
446 Ga0495641_0016989
447 Ga0495651_0102949
448 Ga0495653_0006262
449 Ga0495582_0019412
450 Ga0495639_0039092
451 Ga0495662_0038586
452 Ga0495664_0039149
453 Ga0495594_0061126
454 Ga0495618_0002747
455 Ga0495628_0040599
456 Ga0495630_0005471
457 Ga0495666_0005373
458 Ga0495652_0009788
459 Ga0495640_0005792
460 Ga0495667_0002217
461 Ga0495634_0009776
462 Ga0495588_0132828
463 Ga0495657_0096410
464 Ga0495613_0035096
465 Ga0495624_0040442
466 Ga0495600_0003558
467 Ga0495581_0011140
468 Ga0495581_0021468
469 Ga0495604_0003514
470 Ga0495604_0179675
471 Ga0495674_0026129
472 Ga0495676_0020034
473 Ga0495680_0005523
474 Ga0495684_0001316
475 Ga0495602_0035907
476 Ga0501047_0080565
477 nmdc:mga03683_81189_c1
478 nmdc:mga00v17_41847_c1
479 nmdc:mga0yw44_71489_c1
480 nmdc:mga0yw44_7529_c1
481 nmdc:mga05p37_166314_c1
482 nmdc:mga05p37_509_c2
483 nmdc:mga05p37_51_c1
484 nmdc:mga05p37_59282_c1
485 nmdc:mga05p37_66171_c1
486 nmdc:mga09592_2096_c1
487 nmdc:mga09592_31778_c1
488 nmdc:mga09592_7343_c1
489 nmdc:mga0qj67_111497_c1
490 nmdc:mga0qj67_1438_c1
491 nmdc:mga0qj67_24941_c1
492 nmdc:mga0qj67_24969_c1
493 nmdc:mga06r32_20033_c1
494 nmdc:mga06r32_340313_c1
495 nmdc:mga06r32_4023_c1
496 nmdc:mga06r32_42016_c1
497 nmdc:mga06r32_459814_c1
498 nmdc:mga06r32_536_c1
499 nmdc:mga06r32_85870_c1
500 nmdc:mga06r32_94396_c1
501 nmdc:mga08y16_2584_c1
502 nmdc:mga08y16_421880_c1
503 nmdc:mga08y16_454377_c1
504 nmdc:mga08y16_6849_c1
505 nmdc:mga08y16_82402_c1
506 nmdc:mga08y16_91743_c1
507 nmdc:mga0n895_10635_c1
508 nmdc:mga0n895_132623_c1
509 nmdc:mga0n895_29795_c1
510 nmdc:mga0n895_3039_c1
511 nmdc:mga0n895_9755_c1
512 nmdc:mga0rr50_195748_c1
513 nmdc:mga0rr50_2155_c1
514 nmdc:mga0rr50_251483_c1
515 nmdc:mga0rr50_36915_c1
516 nmdc:mga08x19_140976_c1
517 nmdc:mga0a205_2138_c1
518 nmdc:mga0a205_217839_c1
519 nmdc:mga0a205_44515_c1
520 Ga0495601_0002640
521 Ga0495601_0005426
522 Ga0495612_0022707
523 Ga0495595_0001449
524 Ga0495595_0015305
525 Ga0495619_0004723
526 Ga0495619_0187273
527 2885382531
528 2894775988

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

77

364

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hzl-assembly1.cif.gz_A crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms 0.9718 31 355
7ug8-assembly1.cif.gz_A crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium 0.9711 29 353
4yzz-assembly1.cif.gz_A crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi-500035) mixed occupancy dimer, copurified calcium and picolinate bound active site versus apo site 0.9675 29 355
4pet-assembly1.cif.gz_B crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate 0.9657 30 354
5cm6-assembly1.cif.gz_B crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate 0.9647 30 353
ID Description Score Start End Superfamily
2hzkC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9377 32 353 3.40.190.170
4yzzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9371 29 355 3.40.190.170
4x26B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9346 29 354 3.40.190.170
2zzxA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9278 30 339 3.40.190.170
4yicB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.919 152 322 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A0S8FCY8-F1-model_v4 ABC transporter substrate-binding protein 0.9883 39 359 GO:0031317
GO:0046872
GO:0055085
AF-A0A0S8FCY8-F1-model_v4 ABC transporter substrate-binding protein 0.9823 39 359 GO:0031317
GO:0046872
GO:0055085
AF-A0A7C1VVG7-F1-model_v4 ABC transporter substrate-binding protein 0.9791 60 358 GO:0055085
AF-R7U7F0-F1-model_v4 ABC transporter substrate-binding protein 0.9781 60 195 GO:0055085
AF-A0A3N5FTX4-F1-model_v4 ABC transporter substrate-binding protein 0.9754 49 359 GO:0055085

Map