F386010

General Info

Members Datasets Scaffolds Average Seq Length
284 190 568 337

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100000001|Ga0068868_10000000182
Length 341
Sequence VSFRVRPARAGDFGAIYDMATLTGGGFTNLPADKGTLVGKLSRSEAAFASEAGAPEGDLFLFVLENAETGEIRGTCQVFSRIGIEQPFYSYRISKLTQTSPELGRTFHTEMLNLCTDFNDCSEVGGLFLHPDARAGGLGLGVLLARSRYLFIRRNRERFAGKVVAELRGVIDDDGGSPFWDAIAGRFFGMGFQEADAFNGAHGTQFIGDLMPKTPIYTAMLSAAALAVLGKPHPSGAGAMRMLEAEGFSAEGYVDIFDGGPTMSAATDKIRTIAETRELVLDGIHDGPGGERTLLAGGGLADFASAYGRLAISPQEGVTLDAGSAGLLGLAAGDSFLAVGR

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
128 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
129 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
130 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
131 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
132 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
133 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
134 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
135 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
136 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
137 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
138 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
139 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
155 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
156 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
157 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
158 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
159 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
160 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
161 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
162 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
163 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
164 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
165 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
166 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
167 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
168 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
169 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
170 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
171 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
172 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
173 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
174 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
175 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
176 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
179 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
180 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
181 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
182 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
183 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
184 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
185 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
186 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
187 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
188 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
189 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
190 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.07
Metatranscriptomes 0.7
Isolates 4.23

Biome Distribution

Category Percentage (%)
Aerial Root 1.06
Bulb 0
Endosphere 16.9
Nodule 0
Rhizoplane 2.46
Rhizosphere 74.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100000001 3300005338 Bacteria 282170
2 JGI24752J21851_1006319 3300001976 Bacteria 1548
3 JGI25150J39212_1000285 3300002774 Bacteria 26336
4 JGI25151J46595_10052574 3300003187 Bacteria 1368
5 JGI25153J46596_10000044 3300003215 Bacteria 154263
6 JGI25153J46596_10018549 3300003215 Bacteria 2698
7 Ga0055526_1010816 3300003771 Bacteria 4196
8 Ga0055537_1010328 3300003773 Bacteria 1977
9 Ga0055524_1000088 3300003775 Bacteria 116065
10 Ga0055530_10000025 3300003791 Bacteria 130359
11 Ga0055530_10000195 3300003791 Bacteria 54407
12 Ga0055530_10024413 3300003791 Bacteria 1713
13 Ga0055540_1007092 3300003792 Bacteria 4302
14 Ga0055531_10000016 3300003794 Bacteria 181898
15 Ga0055531_10000840 3300003794 Bacteria 25312
16 Ga0055543_1010320 3300004625 Bacteria 1963
17 Ga0065165_1015502 3300005262 Bacteria 2902
18 Ga0070676_10011539 3300005328 Bacteria 4805
19 Ga0070676_10064248 3300005328 Bacteria 2188
20 Ga0070690_100210703 3300005330 Bacteria 1357
21 Ga0070670_100028172 3300005331 Bacteria 4834
22 Ga0070670_100072017 3300005331 Bacteria 2968
23 Ga0070677_10000358 3300005333 Bacteria 15980
24 Ga0068869_100075436 3300005334 Bacteria 2505
25 Ga0070680_100000228 3300005336 Bacteria 37094
26 Ga0070660_100000051 3300005339 Bacteria 68568
27 Ga0070660_100001801 3300005339 Bacteria 14714
28 Ga0070660_100001913 3300005339 Bacteria 14345
29 Ga0070661_100000014 3300005344 Bacteria 158652
30 Ga0070661_100078332 3300005344 Bacteria 2438
31 Ga0070692_10032060 3300005345 Bacteria 2639
32 Ga0070668_100000123 3300005347 Bacteria 48192
33 Ga0070668_100012419 3300005347 Bacteria 6343
34 Ga0070668_100045590 3300005347 Bacteria 3364
35 Ga0070669_100011675 3300005353 Bacteria 6232
36 Ga0070675_100156164 3300005354 Bacteria 1959
37 Ga0070671_100000800 3300005355 Bacteria 22726
38 Ga0070671_100213813 3300005355 Bacteria 1635
39 Ga0070673_100102813 3300005364 Bacteria 2356
40 Ga0070659_100000001 3300005366 Bacteria 576390
41 Ga0070667_100035964 3300005367 Bacteria 4150
42 Ga0070667_100141182 3300005367 Bacteria 2109
43 Ga0070667_100227645 3300005367 Bacteria 1661
44 Ga0070662_100012574 3300005457 Bacteria 5614
45 Ga0070662_100138148 3300005457 Bacteria 1886
46 Ga0068867_100009450 3300005459 Bacteria 6875
47 Ga0070707_100152148 3300005468 Bacteria 2253
48 Ga0070679_100000003 3300005530 Bacteria 307836
49 Ga0068853_100044870 3300005539 Bacteria 3785
50 Ga0070672_100361730 3300005543 Bacteria 1238
51 Ga0070686_100000387 3300005544 Bacteria 28114
52 Ga0070665_100000528 3300005548 Bacteria 53961
53 Ga0070665_100000531 3300005548 Bacteria 53926
54 Ga0070665_100019392 3300005548 Bacteria 6824
55 Ga0070665_100087524 3300005548 Bacteria 3121
56 Ga0070665_100140159 3300005548 Bacteria 2421
57 Ga0070664_100040157 3300005564 Bacteria 3944
58 Ga0068856_100475769 3300005614 Bacteria 1270
59 Ga0068852_100100245 3300005616 Bacteria 2612
60 Ga0068859_100014974 3300005617 Bacteria 7786
61 Ga0068859_100019855 3300005617 Bacteria 6746
62 Ga0068859_100051730 3300005617 Bacteria 4130
63 Ga0068861_100000198 3300005719 Bacteria 32191
64 Ga0068861_100128504 3300005719 Bacteria 2054
65 Ga0068861_100217761 3300005719 Bacteria 1612
66 Ga0068863_100000020 3300005841 Bacteria 198519
67 Ga0068863_100014949 3300005841 Bacteria 7455
68 Ga0068863_100092538 3300005841 Bacteria 2868
69 Ga0068858_100004961 3300005842 Bacteria 13037
70 Ga0068860_100075309 3300005843 Bacteria 3210
71 Ga0068860_100076916 3300005843 Bacteria 3173
72 Ga0068860_100185723 3300005843 Bacteria 2010
73 Ga0068860_100526573 3300005843 Bacteria 1182
74 Ga0068862_100019379 3300005844 Bacteria 5678
75 Ga0068862_100167959 3300005844 Bacteria 1962
76 Ga0097621_100282873 3300006237 Bacteria 1460
77 Ga0068871_100006307 3300006358 Bacteria 8380
78 Ga0068871_100033128 3300006358 Bacteria 4088
79 Ga0068871_100518143 3300006358 Bacteria 1076
80 Ga0068865_100120221 3300006881 Bacteria 1952
81 Ga0097620_100014974 3300006931 Bacteria 7786
82 Ga0097620_100019855 3300006931 Bacteria 6746
83 Ga0097620_100051729 3300006931 Bacteria 4130
84 Ga0105245_10024672 3300009098 Bacteria 5282
85 Ga0105245_10059004 3300009098 Bacteria 3455
86 Ga0105248_10009045 3300009177 Bacteria 10955
87 Ga0105248_10104588 3300009177 Bacteria 3192
88 Ga0105248_10164867 3300009177 Bacteria 2498
89 Ga0105248_10313401 3300009177 Bacteria 1767
90 Ga0105248_10315769 3300009177 Bacteria 1760
91 Ga0105248_10613864 3300009177 Bacteria 1227
92 Ga0105237_10038730 3300009545 Bacteria 4814
93 Ga0105238_10169810 3300009551 Bacteria 2157
94 Ga0105249_10010075 3300009553 Bacteria 8295
95 Ga0157371_10122609 3300013102 Bacteria 1848
96 Ga0157369_10010603 3300013105 Bacteria 10489
97 Ga0157374_10004659 3300013296 Bacteria 11506
98 Ga0163162_10005381 3300013306 Bacteria 12360
99 Ga0157375_10005325 3300013308 Bacteria 11180
100 Ga0157375_10711585 3300013308 Bacteria 1157
101 Ga0163163_10005031 3300014325 Bacteria 11393
102 Ga0157380_10165752 3300014326 Bacteria 1925
103 Ga0206354_10674928 3300020081 Bacteria 6934
104 Ga0206353_10506404 3300020082 Bacteria 9344
105 Ga0213873_10000007 3300021358 Bacteria 309961
106 Ga0213876_10000005 3300021384 Bacteria 727326
107 Ga0213876_10005827 3300021384 Bacteria 6746
108 Ga0213876_10053009 3300021384 Bacteria 2143
109 Ga0207425_1000026 3300025245 Bacteria 301303
110 Ga0209565_1000010 3300025263 Bacteria 687724
111 Ga0209565_1000064 3300025263 Bacteria 180732
112 Ga0209673_1003595 3300025273 Bacteria 9012
113 Ga0209673_1022538 3300025273 Bacteria 2170
114 Ga0209675_1000169 3300025291 Bacteria 78355
115 Ga0209676_1000930 3300025292 Bacteria 36172
116 Ga0209676_1051140 3300025292 Bacteria 1085
117 Ga0209025_1000726 3300025294 Bacteria 55863
118 Ga0209564_1002791 3300025295 Bacteria 13034
119 Ga0209758_1000004 3300025297 Bacteria 1375322
120 Ga0209758_1016380 3300025297 Bacteria 3770
121 Ga0209050_1000001 3300025298 Bacteria 3563507
122 Ga0209050_1000026 3300025298 Bacteria 499134
123 Ga0209050_1000047 3300025298 Bacteria 380561
124 Ga0209050_1006856 3300025298 Bacteria 6614
125 Ga0209050_1006887 3300025298 Bacteria 6590
126 Ga0209256_1000034 3300025299 Bacteria 388475
127 Ga0209051_1000793 3300025303 Bacteria 33269
128 Ga0209257_1000009 3300025304 Bacteria 1205047
129 Ga0209257_1000076 3300025304 Bacteria 324617
130 Ga0209257_1000617 3300025304 Bacteria 57694
131 Ga0209257_1000633 3300025304 Bacteria 56365
132 Ga0209257_1002745 3300025304 Bacteria 16681
133 Ga0207697_10025450 3300025315 Bacteria 2419
134 Ga0207682_10000643 3300025893 Bacteria 16285
135 Ga0207688_10035073 3300025901 Bacteria 2779
136 Ga0207680_10073380 3300025903 Bacteria 2128
137 Ga0207645_10007154 3300025907 Bacteria 7916
138 Ga0207671_10021471 3300025914 Bacteria 4899
139 Ga0207660_10000692 3300025917 Bacteria 22532
140 Ga0207657_10000262 3300025919 Bacteria 55933
141 Ga0207657_10003882 3300025919 Bacteria 15855
142 Ga0207657_10008356 3300025919 Bacteria 10511
143 Ga0207649_10000055 3300025920 Bacteria 103054
144 Ga0207652_10000004 3300025921 Bacteria 436303
145 Ga0207646_10136249 3300025922 Bacteria 2211
146 Ga0207681_10129072 3300025923 Bacteria 1866
147 Ga0207650_10017923 3300025925 Bacteria 4962
148 Ga0207659_10264084 3300025926 Bacteria 1402
149 Ga0207687_10038965 3300025927 Bacteria 3251
150 Ga0207644_10000919 3300025931 Bacteria 18675
151 Ga0207690_10000051 3300025932 Bacteria 107367
152 Ga0207690_10004884 3300025932 Bacteria 7909
153 Ga0207706_10013991 3300025933 Bacteria 7276
154 Ga0207706_10275962 3300025933 Bacteria 1466
155 Ga0207691_10211442 3300025940 Bacteria 1684
156 Ga0207691_10293454 3300025940 Bacteria 1398
157 Ga0207711_10008293 3300025941 Bacteria 8697
158 Ga0207711_10027294 3300025941 Bacteria 4795
159 Ga0207711_10066183 3300025941 Bacteria 3125
160 Ga0207711_10109358 3300025941 Bacteria 2456
161 Ga0207689_10112112 3300025942 Bacteria 2242
162 Ga0207679_10005532 3300025945 Bacteria 7916
163 Ga0207651_10002142 3300025960 Bacteria 9331
164 Ga0207712_10027552 3300025961 Bacteria 3795
165 Ga0207668_10000085 3300025972 Bacteria 70401
166 Ga0207668_10000610 3300025972 Bacteria 22233
167 Ga0207668_10217654 3300025972 Bacteria 1531
168 Ga0207640_10056665 3300025981 Bacteria 2574
169 Ga0207658_10009299 3300025986 Bacteria 6666
170 Ga0207658_10037265 3300025986 Bacteria 3492
171 Ga0207658_10049919 3300025986 Bacteria 3076
172 Ga0207677_10000013 3300026023 Bacteria 186519
173 Ga0207703_10061726 3300026035 Bacteria 3069
174 Ga0207639_10013359 3300026041 Bacteria 5747
175 Ga0207641_10008697 3300026088 Bacteria 8384
176 Ga0207641_10026543 3300026088 Bacteria 4781
177 Ga0207641_10168959 3300026088 Bacteria 1994
178 Ga0207648_10011402 3300026089 Bacteria 8376
179 Ga0207674_10185997 3300026116 Bacteria 2028
180 Ga0207675_100000671 3300026118 Bacteria 33681
181 Ga0207675_100122868 3300026118 Bacteria 2458
182 Ga0207675_100124297 3300026118 Bacteria 2443
183 Ga0207683_10150320 3300026121 Bacteria 2102
184 Ga0207683_10419148 3300026121 Bacteria 1233
185 Ga0207698_10078072 3300026142 Bacteria 2657
186 Ga0268266_10000187 3300028379 Bacteria 110229
187 Ga0268266_10000518 3300028379 Bacteria 54434
188 Ga0268266_10026865 3300028379 Bacteria 4897
189 Ga0268266_10128552 3300028379 Bacteria 2264
190 Ga0268266_10188431 3300028379 Bacteria 1882
191 Ga0268265_10012360 3300028380 Bacteria 5785
192 Ga0268265_10019606 3300028380 Bacteria 4704
193 Ga0268265_10143654 3300028380 Bacteria 2001
194 Ga0268264_10001849 3300028381 Bacteria 19271
195 Ga0268264_10050638 3300028381 Bacteria 3459
196 Ga0268264_10068067 3300028381 Bacteria 3007
197 Ga0268264_10339385 3300028381 Bacteria 1427
198 Ga0268264_10580217 3300028381 Bacteria 1103
199 Ga0307413_10081803 3300031824 Bacteria 2072
200 Ga0307413_10092520 3300031824 Bacteria 1974
201 Ga0307410_10238997 3300031852 Bacteria 1407
202 Ga0307412_10157623 3300031911 Bacteria 1682
203 Ga0307416_100410279 3300032002 Bacteria 1395
204 Ga0307414_10040637 3300032004 Bacteria 3143
205 Ga0307414_10149762 3300032004 Bacteria 1839
206 Ga0307414_10243430 3300032004 Bacteria 1490
207 Ga0307414_10247013 3300032004 Bacteria 1481
208 Ga0307411_10064678 3300032005 Bacteria 2450
209 Ga0307415_100288177 3300032126 Bacteria 1354
210 Ga0436364_0696173 3300037853 Bacteria 2114
211 Ga0436365_0393854 3300039437 Bacteria 34290
212 Ga0436362_0976836 3300039453 Bacteria 135942
213 Ga0439439_0012872 3300041406 Bacteria 2023
214 Ga0439439_0021495 3300041406 Bacteria 1608
215 Ga0439461_0000048 3300041410 Bacteria 14369
216 Ga0439465_0000449 3300041413 Bacteria 12073
217 Ga0439465_0001934 3300041413 Bacteria 6790
218 Ga0439431_0000076 3300041997 Bacteria 15680
219 Ga0439431_0003582 3300041997 Bacteria 3424
220 Ga0439442_005474 3300042002 Bacteria 2539
221 Ga0439445_0002020 3300042004 Bacteria 4479
222 Ga0439432_000326 3300042006 Bacteria 17281
223 Ga0439452_014152 3300042010 Bacteria 2223
224 Ga0439462_0000207 3300042015 Bacteria 10252
225 Ga0439462_0003297 3300042015 Bacteria 3860
226 Ga0439462_0011273 3300042015 Bacteria 2274
227 Ga0450920_003658 3300042122 Bacteria 2675
228 Ga0439434_0000713 3300042435 Bacteria 9557
229 Ga0439434_0051425 3300042435 Bacteria 1277
230 Ga0439464_0000495 3300042439 Bacteria 7990
231 Ga0495668_0007666 3300046616 Bacteria 6867
232 Ga0495625_0000443 3300046660 Bacteria 62139
233 Ga0495669_0000854 3300046684 Bacteria 12893
234 Ga0495669_0007738 3300046684 Bacteria 4510
235 Ga0495670_0000009 3300046691 Bacteria 210956
236 Ga0495686_0027124 3300047472 Bacteria 3742
237 Ga0496100_0092175 3300048903 Bacteria 2070
238 Ga0496108_0030270 3300048911 Bacteria 4486
239 Ga0496110_0001813 3300048913 Bacteria 15734
240 Ga0496111_0013763 3300048914 Bacteria 5512
241 Ga0496112_0066909 3300048915 Bacteria 3545
242 Ga0496115_0000446 3300048918 Bacteria 33518
243 Ga0496121_0274525 3300048924 Bacteria 1157
244 Ga0496123_0032444 3300048926 Bacteria 3781
245 Ga0496123_0102628 3300048926 Bacteria 1659
246 Ga0496124_0002087 3300048927 Bacteria 26981
247 Ga0496124_0028447 3300048927 Bacteria 5000
248 Ga0501290_000412 3300049513 Bacteria 6809
249 Ga0501292_000047 3300049515 Bacteria 25835
250 Ga0501300_002582 3300049523 Bacteria 2715
251 Ga0501202_004478 3300049652 Bacteria 2447
252 Ga0501206_002783 3300049653 Bacteria 2201
253 Ga0501222_001250 3300049662 Bacteria 3580
254 Ga0501223_000369 3300049663 Bacteria 11098
255 Ga0501233_001538 3300049668 Bacteria 3946
256 Ga0501261_000519 3300049690 Bacteria 4936
257 Ga0501221_004896 3300049704 Bacteria 2230
258 Ga0501245_000511 3300049708 Bacteria 4724
259 Ga0501279_000059 3300049775 Bacteria 20336
260 Ga0501280_000080 3300049776 Bacteria 25836
261 Ga0501281_00220 3300049777 Bacteria 6401
262 Ga0501282_000089 3300049778 Bacteria 10524
263 Ga0501283_000731 3300049779 Bacteria 4309
264 nmdc:mga07m45_131163_c1 3300050496 Bacteria 1450
265 Ga0500641_0009901 3300053096 Bacteria 3435
266 Ga0500592_000030 3300053116 Bacteria 48033
267 Ga0500595_000690 3300053119 Bacteria 20152
268 Ga0500658_0000329 3300053134 Bacteria 21052
269 Ga0500568_0011554 3300053139 Bacteria 4088
270 Ga0500604_0000003 3300053151 Bacteria 148800
271 Ga0500616_0000087 3300053153 Bacteria 192225
272 Ga0500627_0000205 3300053158 Bacteria 17177
273 2600224820 2599185359 Bacteria 4772316
274 2643949946 2643221588 Bacteria 3692460
275 2644126450 2643221622 Bacteria 4212502
276 2819713013 2818991466 Bacteria 4748179
277 2879164625 2879163058 Bacteria 4223965
278 2928027678 2928027323 Bacteria 4382488
279 2928527550 2928526807 Bacteria 4760224
280 2928968960 2928968154 Bacteria 4633371
281 2984558029 2984555340 Bacteria 4247089
282 2984567604 2984564862 Bacteria 4339992
283 2993358656 2993356040 Bacteria 4247105
284 8057105796 8057101203 Bacteria 5034064
285 Ga0068868_100000001
286 JGI24752J21851_1006319
287 JGI25150J39212_1000285
288 JGI25151J46595_10052574
289 JGI25153J46596_10000044
290 JGI25153J46596_10018549
291 Ga0055526_1010816
292 Ga0055537_1010328
293 Ga0055524_1000088
294 Ga0055530_10000025
295 Ga0055530_10000195
296 Ga0055530_10024413
297 Ga0055540_1007092
298 Ga0055531_10000016
299 Ga0055531_10000840
300 Ga0055543_1010320
301 Ga0065165_1015502
302 Ga0070676_10011539
303 Ga0070676_10064248
304 Ga0070690_100210703
305 Ga0070670_100028172
306 Ga0070670_100072017
307 Ga0070677_10000358
308 Ga0068869_100075436
309 Ga0070680_100000228
310 Ga0070660_100000051
311 Ga0070660_100001801
312 Ga0070660_100001913
313 Ga0070661_100000014
314 Ga0070661_100078332
315 Ga0070692_10032060
316 Ga0070668_100000123
317 Ga0070668_100012419
318 Ga0070668_100045590
319 Ga0070669_100011675
320 Ga0070675_100156164
321 Ga0070671_100000800
322 Ga0070671_100213813
323 Ga0070673_100102813
324 Ga0070659_100000001
325 Ga0070667_100035964
326 Ga0070667_100141182
327 Ga0070667_100227645
328 Ga0070662_100012574
329 Ga0070662_100138148
330 Ga0068867_100009450
331 Ga0070707_100152148
332 Ga0070679_100000003
333 Ga0068853_100044870
334 Ga0070672_100361730
335 Ga0070686_100000387
336 Ga0070665_100000528
337 Ga0070665_100000531
338 Ga0070665_100019392
339 Ga0070665_100087524
340 Ga0070665_100140159
341 Ga0070664_100040157
342 Ga0068856_100475769
343 Ga0068852_100100245
344 Ga0068859_100014974
345 Ga0068859_100019855
346 Ga0068859_100051730
347 Ga0068861_100000198
348 Ga0068861_100128504
349 Ga0068861_100217761
350 Ga0068863_100000020
351 Ga0068863_100014949
352 Ga0068863_100092538
353 Ga0068858_100004961
354 Ga0068860_100075309
355 Ga0068860_100076916
356 Ga0068860_100185723
357 Ga0068860_100526573
358 Ga0068862_100019379
359 Ga0068862_100167959
360 Ga0097621_100282873
361 Ga0068871_100006307
362 Ga0068871_100033128
363 Ga0068871_100518143
364 Ga0068865_100120221
365 Ga0097620_100014974
366 Ga0097620_100019855
367 Ga0097620_100051729
368 Ga0105245_10024672
369 Ga0105245_10059004
370 Ga0105248_10009045
371 Ga0105248_10104588
372 Ga0105248_10164867
373 Ga0105248_10313401
374 Ga0105248_10315769
375 Ga0105248_10613864
376 Ga0105237_10038730
377 Ga0105238_10169810
378 Ga0105249_10010075
379 Ga0157371_10122609
380 Ga0157369_10010603
381 Ga0157374_10004659
382 Ga0163162_10005381
383 Ga0157375_10005325
384 Ga0157375_10711585
385 Ga0163163_10005031
386 Ga0157380_10165752
387 Ga0206354_10674928
388 Ga0206353_10506404
389 Ga0213873_10000007
390 Ga0213876_10000005
391 Ga0213876_10005827
392 Ga0213876_10053009
393 Ga0207425_1000026
394 Ga0209565_1000010
395 Ga0209565_1000064
396 Ga0209673_1003595
397 Ga0209673_1022538
398 Ga0209675_1000169
399 Ga0209676_1000930
400 Ga0209676_1051140
401 Ga0209025_1000726
402 Ga0209564_1002791
403 Ga0209758_1000004
404 Ga0209758_1016380
405 Ga0209050_1000001
406 Ga0209050_1000026
407 Ga0209050_1000047
408 Ga0209050_1006856
409 Ga0209050_1006887
410 Ga0209256_1000034
411 Ga0209051_1000793
412 Ga0209257_1000009
413 Ga0209257_1000076
414 Ga0209257_1000617
415 Ga0209257_1000633
416 Ga0209257_1002745
417 Ga0207697_10025450
418 Ga0207682_10000643
419 Ga0207688_10035073
420 Ga0207680_10073380
421 Ga0207645_10007154
422 Ga0207671_10021471
423 Ga0207660_10000692
424 Ga0207657_10000262
425 Ga0207657_10003882
426 Ga0207657_10008356
427 Ga0207649_10000055
428 Ga0207652_10000004
429 Ga0207646_10136249
430 Ga0207681_10129072
431 Ga0207650_10017923
432 Ga0207659_10264084
433 Ga0207687_10038965
434 Ga0207644_10000919
435 Ga0207690_10000051
436 Ga0207690_10004884
437 Ga0207706_10013991
438 Ga0207706_10275962
439 Ga0207691_10211442
440 Ga0207691_10293454
441 Ga0207711_10008293
442 Ga0207711_10027294
443 Ga0207711_10066183
444 Ga0207711_10109358
445 Ga0207689_10112112
446 Ga0207679_10005532
447 Ga0207651_10002142
448 Ga0207712_10027552
449 Ga0207668_10000085
450 Ga0207668_10000610
451 Ga0207668_10217654
452 Ga0207640_10056665
453 Ga0207658_10009299
454 Ga0207658_10037265
455 Ga0207658_10049919
456 Ga0207677_10000013
457 Ga0207703_10061726
458 Ga0207639_10013359
459 Ga0207641_10008697
460 Ga0207641_10026543
461 Ga0207641_10168959
462 Ga0207648_10011402
463 Ga0207674_10185997
464 Ga0207675_100000671
465 Ga0207675_100122868
466 Ga0207675_100124297
467 Ga0207683_10150320
468 Ga0207683_10419148
469 Ga0207698_10078072
470 Ga0268266_10000187
471 Ga0268266_10000518
472 Ga0268266_10026865
473 Ga0268266_10128552
474 Ga0268266_10188431
475 Ga0268265_10012360
476 Ga0268265_10019606
477 Ga0268265_10143654
478 Ga0268264_10001849
479 Ga0268264_10050638
480 Ga0268264_10068067
481 Ga0268264_10339385
482 Ga0268264_10580217
483 Ga0307413_10081803
484 Ga0307413_10092520
485 Ga0307410_10238997
486 Ga0307412_10157623
487 Ga0307416_100410279
488 Ga0307414_10040637
489 Ga0307414_10149762
490 Ga0307414_10243430
491 Ga0307414_10247013
492 Ga0307411_10064678
493 Ga0307415_100288177
494 Ga0436364_0696173
495 Ga0436365_0393854
496 Ga0436362_0976836
497 Ga0439439_0012872
498 Ga0439439_0021495
499 Ga0439461_0000048
500 Ga0439465_0000449
501 Ga0439465_0001934
502 Ga0439431_0000076
503 Ga0439431_0003582
504 Ga0439442_005474
505 Ga0439445_0002020
506 Ga0439432_000326
507 Ga0439452_014152
508 Ga0439462_0000207
509 Ga0439462_0003297
510 Ga0439462_0011273
511 Ga0450920_003658
512 Ga0439434_0000713
513 Ga0439434_0051425
514 Ga0439464_0000495
515 Ga0495668_0007666
516 Ga0495625_0000443
517 Ga0495669_0000854
518 Ga0495669_0007738
519 Ga0495670_0000009
520 Ga0495686_0027124
521 Ga0496100_0092175
522 Ga0496108_0030270
523 Ga0496110_0001813
524 Ga0496111_0013763
525 Ga0496112_0066909
526 Ga0496115_0000446
527 Ga0496121_0274525
528 Ga0496123_0032444
529 Ga0496123_0102628
530 Ga0496124_0002087
531 Ga0496124_0028447
532 Ga0501290_000412
533 Ga0501292_000047
534 Ga0501300_002582
535 Ga0501202_004478
536 Ga0501206_002783
537 Ga0501222_001250
538 Ga0501223_000369
539 Ga0501233_001538
540 Ga0501261_000519
541 Ga0501221_004896
542 Ga0501245_000511
543 Ga0501279_000059
544 Ga0501280_000080
545 Ga0501281_00220
546 Ga0501282_000089
547 Ga0501283_000731
548 nmdc:mga07m45_131163_c1
549 Ga0500641_0009901
550 Ga0500592_000030
551 Ga0500595_000690
552 Ga0500658_0000329
553 Ga0500568_0011554
554 Ga0500604_0000003
555 Ga0500616_0000087
556 Ga0500627_0000205
557 2600224820
558 2643949946
559 2644126450
560 2819713013
561 2879164625
562 2928027678
563 2928527550
564 2928968960
565 2984558029
566 2984567604
567 2993358656
568 8057105796

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04958

AstA

Arginine N-succinyltransferase beta subunit

2

339

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yle-assembly1.cif.gz_A the structure of arginine/ornithine succinyltransferase subunit ai from pseudomonas aeruginosa. 0.9253 2 335
1yle-assembly1.cif.gz_A the structure of arginine/ornithine succinyltransferase subunit ai from pseudomonas aeruginosa. 0.9092 2 335
6add-assembly1.cif.gz_B the crystal structure of rv2747 from mycobacterium tuberculosis in complex with coa and nlq 0.8089 5 163
7daj-assembly1.cif.gz_B the crystal structure of serotonin n-acetyltransferase in complex with acetyl-coa from oryza sativa 0.8072 13 153
2cnt-assembly4.cif.gz_D rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with coenzymea. 0.7923 3 165
ID Description Score Start End Superfamily
af_P0AE37_1_272_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9551 3 271 3.40.630.30
af_P0AE37_1_272_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9414 3 271 3.40.630.30
3pp9C00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8201 59 163 3.40.630.30
6ao7A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7709 59 171 3.40.630.30
4xpdC00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7674 1 169 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A3A1PBW0-F1-model_v4 Arginine N-succinyltransferase 0.9801 1 336 GO:0006527
GO:0008791
AF-A0A095VTQ1-F1-model_v4 Arginine N-succinyltransferase (EC 2.3.1.109) 0.9785 3 336 GO:0006527
GO:0008791
AF-A0A3A1PBW0-F1-model_v4 Arginine N-succinyltransferase 0.9772 1 336 GO:0006527
GO:0008791
AF-G2IP29-F1-model_v4 Arginine N-succinyltransferase (EC 2.3.1.109) 0.9768 2 336 GO:0006527
GO:0008791
AF-A0A520GU45-F1-model_v4 Arginine N-succinyltransferase 0.9763 1 263 GO:0006527
GO:0008791

Map