F385988

General Info

Members Datasets Scaffolds Average Seq Length
284 168 265 244

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10407422|Ga0070658_104074221
Length 285
Sequence MAAGTCSTQDTAESAGTAWERACEELVIWFKCGMGQGHDKAGELHEPGGKLRLYVDAPLGAGAVVAAGEGQAHYLLHVMRAKPGDRVSLFNGKNGEWLAEISAAAKRGVTLMCLRQTAPQTEVPDLWLLFAPIKKTPSDYLVQKATELGAARLQPVFTRRTIVARVNDERMAANAIEAAEQSGRLSVPVIGAPLDLEKALAGWPTDRPLYFCDEGGDAKPLTEAAKPGPAAILTGPEGGFDTSERAMLRAMPFVVPVTLGPRILRADTAALAALAIWQAEAGDFR

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
3 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
4 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
5 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
6 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
7 2643221583 Caulobacter sp. Root655 Isolate Unclassified
8 2643221584 Caulobacter sp. Root656 Isolate Unclassified
9 2643221640 Caulobacter sp. Root342 Isolate Unclassified
10 2643221642 Caulobacter sp. Root343 Isolate Unclassified
11 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
12 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
13 2818991435 Caulobacter henricii 536 Isolate Unclassified
14 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
15 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
16 2849560528 Caulobacter zeae 410 Isolate Unclassified
17 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
18 2851153111 Caulobacter radicis 736 Isolate Unclassified
19 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
90 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
102 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
103 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
104 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
105 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
110 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
113 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
114 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
115 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
116 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
117 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
118 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
126 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
127 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
128 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
158 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
159 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
160 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
161 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
162 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
163 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
164 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
165 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
168 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.31
Metatranscriptomes 0
Isolates 6.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.44
Nodule 0
Rhizoplane 2.46
Rhizosphere 75.35
Stem 0
Stem Tuber 0
Unclassified 7.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10064250 3300003215 Bacteria 980
2 rootH2_10026788 3300003320 Bacteria 15311
3 Ga0055526_1015935 3300003771 Bacteria 2982
4 Ga0055537_1003120 3300003773 Bacteria 5202
5 Ga0055524_1013031 3300003775 Bacteria 3159
6 Ga0055524_1028387 3300003775 Bacteria 1677
7 Ga0055536_1000210 3300003781 Bacteria 47869
8 Ga0055528_1010396 3300003790 Bacteria 3787
9 Ga0055531_10003130 3300003794 Bacteria 10672
10 Ga0065165_1001939 3300005262 Bacteria 19705
11 Ga0070658_10002265 3300005327 Bacteria 16160
12 Ga0070658_10053444 3300005327 Bacteria 3278
13 Ga0070658_10321269 3300005327 Bacteria 1322
14 Ga0070658_10407422 3300005327 Bacteria 1168
15 Ga0070666_10000797 3300005335 Bacteria 19105
16 Ga0070680_100000199 3300005336 Bacteria 39217
17 Ga0070660_100038398 3300005339 Bacteria 3635
18 Ga0070660_100052987 3300005339 Bacteria 3129
19 Ga0070691_10003075 3300005341 Bacteria 7478
20 Ga0070711_100570823 3300005439 Bacteria 940
21 Ga0070663_100028290 3300005455 Bacteria 3815
22 Ga0070681_10000001 3300005458 Bacteria 946857
23 Ga0070681_10340383 3300005458 Bacteria 1410
24 Ga0070681_10693414 3300005458 Unclassified 934
25 Ga0070679_100000032 3300005530 Bacteria 105384
26 Ga0070679_100054275 3300005530 Bacteria 3989
27 Ga0070679_100109152 3300005530 Bacteria 2753
28 Ga0070679_100111146 3300005530 Bacteria 2726
29 Ga0068853_100004304 3300005539 Bacteria 11008
30 Ga0068853_100184543 3300005539 Bacteria 1893
31 Ga0068853_100244850 3300005539 Bacteria 1644
32 Ga0070665_100000381 3300005548 Bacteria 65638
33 Ga0068855_100009515 3300005563 Bacteria 11737
34 Ga0068855_100022075 3300005563 Bacteria 7630
35 Ga0068855_100048720 3300005563 Bacteria 4999
36 Ga0068855_100064428 3300005563 Bacteria 4274
37 Ga0068855_100215778 3300005563 Bacteria 2154
38 Ga0068855_100474736 3300005563 Bacteria 1362
39 Ga0068856_100387206 3300005614 Bacteria 1418
40 Ga0068856_100410674 3300005614 Bacteria 1374
41 Ga0070712_100001918 3300006175 Bacteria 12730
42 Ga0105240_10026618 3300009093 Bacteria 7590
43 Ga0105240_10056658 3300009093 Bacteria 4903
44 Ga0105240_10060828 3300009093 Bacteria 4708
45 Ga0105245_10004401 3300009098 Bacteria 12459
46 Ga0105248_10000005 3300009177 Bacteria 673111
47 Ga0105248_10300938 3300009177 Bacteria 1806
48 Ga0105237_10027270 3300009545 Bacteria 5832
49 Ga0105237_10081867 3300009545 Bacteria 3219
50 Ga0105238_10030373 3300009551 Bacteria 5500
51 Ga0105238_10067241 3300009551 Bacteria 3585
52 Ga0105238_10129607 3300009551 Bacteria 2501
53 Ga0105238_10589467 3300009551 Bacteria 1119
54 Ga0105239_10002618 3300010375 Bacteria 22756
55 Ga0105239_10016438 3300010375 Bacteria 8181
56 Ga0105239_10025799 3300010375 Bacteria 6472
57 Ga0105239_10105973 3300010375 Bacteria 3114
58 Ga0157371_10091117 3300013102 Bacteria 2159
59 Ga0157370_10039391 3300013104 Bacteria 4567
60 Ga0157370_10050691 3300013104 Bacteria 3967
61 Ga0157370_10180222 3300013104 Bacteria 1963
62 Ga0157372_10013011 3300013307 Bacteria 8876
63 Ga0163163_10336302 3300014325 Unclassified 1565
64 Ga0157376_10378606 3300014969 Bacteria 1363
65 Ga0213876_10005871 3300021384 Bacteria 6720
66 Ga0209233_1015746 3300025261 Bacteria 2098
67 Ga0209565_1000213 3300025263 Bacteria 66481
68 Ga0209673_1000487 3300025273 Bacteria 65950
69 Ga0209675_1035494 3300025291 Bacteria 1136
70 Ga0209676_1000230 3300025292 Bacteria 121783
71 Ga0209676_1051715 3300025292 Bacteria 1076
72 Ga0209564_1001588 3300025295 Bacteria 22203
73 Ga0209564_1012157 3300025295 Bacteria 3778
74 Ga0209758_1000779 3300025297 Bacteria 45780
75 Ga0209758_1001770 3300025297 Bacteria 23938
76 Ga0209050_1000233 3300025298 Bacteria 121806
77 Ga0209050_1018099 3300025298 Bacteria 2760
78 Ga0209256_1001012 3300025299 Bacteria 33185
79 Ga0209256_1010987 3300025299 Bacteria 3694
80 Ga0209051_1002281 3300025303 Bacteria 14016
81 Ga0209257_1000186 3300025304 Bacteria 154365
82 Ga0209257_1007985 3300025304 Bacteria 6183
83 Ga0207680_10017277 3300025903 Bacteria 3808
84 Ga0207705_10000248 3300025909 Bacteria 53180
85 Ga0207705_10015787 3300025909 Bacteria 5423
86 Ga0207705_10026787 3300025909 Bacteria 4109
87 Ga0207707_10000001 3300025912 Bacteria 1212482
88 Ga0207707_10001773 3300025912 Bacteria 19815
89 Ga0207707_10597221 3300025912 Unclassified 935
90 Ga0207695_10006501 3300025913 Bacteria 15139
91 Ga0207695_10057458 3300025913 Bacteria 4041
92 Ga0207695_10150538 3300025913 Bacteria 2266
93 Ga0207695_10155253 3300025913 Bacteria 2224
94 Ga0207695_10343548 3300025913 Bacteria 1380
95 Ga0207695_10397893 3300025913 Bacteria 1262
96 Ga0207695_10634858 3300025913 Bacteria 949
97 Ga0207693_10000488 3300025915 Bacteria 35928
98 Ga0207693_10229397 3300025915 Bacteria 1458
99 Ga0207663_10018304 3300025916 Bacteria 3924
100 Ga0207663_10103900 3300025916 Unclassified 1915
101 Ga0207660_10000280 3300025917 Bacteria 33705
102 Ga0207660_10001164 3300025917 Bacteria 17576
103 Ga0207657_10000541 3300025919 Bacteria 40337
104 Ga0207652_10000571 3300025921 Bacteria 37063
105 Ga0207652_10064767 3300025921 Bacteria 3163
106 Ga0207694_10188528 3300025924 Bacteria 1675
107 Ga0207687_10045569 3300025927 Bacteria 3032
108 Ga0207711_10000002 3300025941 Bacteria 1228676
109 Ga0207661_10092368 3300025944 Bacteria 2523
110 Ga0207667_10075272 3300025949 Bacteria 3505
111 Ga0207667_10082606 3300025949 Bacteria 3327
112 Ga0207639_10002843 3300026041 Bacteria 11620
113 Ga0207678_10339316 3300026067 Bacteria 1295
114 Ga0207702_10330035 3300026078 Bacteria 1455
115 Ga0207674_10171488 3300026116 Bacteria 2123
116 Ga0207683_10081487 3300026121 Bacteria 2873
117 Ga0268266_10002150 3300028379 Bacteria 21661
118 Ga0265318_10001817 3300028577 Bacteria 12121
119 Ga0307515_10020029 3300028794 Bacteria 11978
120 Ga0307515_10475672 3300028794 Bacteria 862
121 Ga0265338_10046080 3300028800 Bacteria 3999
122 Ga0265332_10137875 3300031238 Bacteria 1023
123 Ga0265340_10004366 3300031247 Bacteria 7916
124 Ga0265340_10018731 3300031247 Bacteria 3569
125 Ga0265331_10000003 3300031250 Bacteria 499358
126 Ga0265331_10009723 3300031250 Bacteria 5374
127 Ga0265331_10018646 3300031250 Bacteria 3594
128 Ga0265327_10001228 3300031251 Bacteria 34414
129 Ga0265316_10085791 3300031344 Bacteria 2408
130 Ga0265316_10174747 3300031344 Bacteria 1601
131 Ga0265316_10232058 3300031344 Bacteria 1359
132 Ga0265313_10003218 3300031595 Bacteria 13427
133 Ga0265313_10007956 3300031595 Bacteria 7121
134 Ga0265314_10033605 3300031711 Bacteria 3757
135 Ga0265314_10049911 3300031711 Bacteria 2926
136 Ga0265314_10066998 3300031711 Bacteria 2420
137 Ga0265314_10074955 3300031711 Bacteria 2252
138 Ga0265342_10036161 3300031712 Bacteria 3018
139 Ga0265342_10100051 3300031712 Bacteria 1653
140 Ga0395900_0096406 3300037418 Bacteria 3039
141 Ga0395898_0095570 3300037466 Bacteria 2855
142 Ga0395901_0151800 3300038443 Bacteria 2434
143 Ga0436365_1627614 3300039437 Bacteria 14353
144 Ga0439465_0033059 3300041413 Bacteria 1653
145 Ga0451791_0380145 3300041451 Bacteria 758
146 Ga0451807_0976884 3300041486 Bacteria 803
147 Ga0439446_0025343 3300042156 Bacteria 1695
148 Ga0439435_0061765 3300042436 Bacteria 1093
149 Ga0466963_0210670 3300044694 Bacteria 1360
150 Ga0495627_001379 3300046453 Bacteria 14442
151 Ga0495638_0000310 3300046460 Bacteria 62919
152 Ga0495638_0001082 3300046460 Bacteria 26547
153 Ga0495638_0010952 3300046460 Bacteria 6271
154 Ga0495638_0036784 3300046460 Bacteria 3116
155 Ga0495650_0000046 3300046471 Bacteria 342987
156 Ga0495583_0000005 3300046506 Bacteria 636894
157 Ga0495583_0134043 3300046506 Bacteria 1035
158 Ga0495606_0002480 3300046507 Bacteria 21351
159 Ga0495610_0000779 3300046512 Bacteria 29994
160 Ga0495616_0003007 3300046513 Bacteria 10942
161 Ga0495620_0023685 3300046515 Bacteria 2931
162 Ga0495620_0064632 3300046515 Bacteria 1512
163 Ga0495632_0011031 3300046519 Bacteria 5295
164 Ga0495632_0191679 3300046519 Bacteria 933
165 Ga0495637_0009567 3300046520 Bacteria 4724
166 Ga0495643_0108844 3300046522 Bacteria 1411
167 Ga0495654_0000023 3300046530 Bacteria 243798
168 Ga0495654_0144258 3300046530 Bacteria 1058
169 Ga0495645_0002146 3300046543 Bacteria 13389
170 Ga0495625_0000384 3300046660 Bacteria 67484
171 Ga0495625_0001472 3300046660 Bacteria 28466
172 Ga0495625_0002912 3300046660 Bacteria 17885
173 Ga0495625_0016618 3300046660 Bacteria 5783
174 Ga0495625_0018502 3300046660 Bacteria 5437
175 Ga0495670_0069143 3300046691 Bacteria 1785
176 Ga0495589_0023989 3300046794 Bacteria 3102
177 Ga0495660_0005724 3300046810 Bacteria 7421
178 Ga0495672_0000311 3300047320 Bacteria 65012
179 Ga0495675_0026730 3300047444 Bacteria 3680
180 Ga0495679_004262 3300047446 Bacteria 6641
181 Ga0495673_0000025 3300047469 Bacteria 512352
182 Ga0495673_0003907 3300047469 Bacteria 9579
183 Ga0495681_0128888 3300047470 Bacteria 1079
184 Ga0495686_0007034 3300047472 Bacteria 8496
185 Ga0495686_0022983 3300047472 Bacteria 4118
186 Ga0496101_0289557 3300048904 Bacteria 1281
187 Ga0496106_0011964 3300048909 Bacteria 6406
188 Ga0496107_0000112 3300048910 Bacteria 39450
189 Ga0496107_0237710 3300048910 Bacteria 1356
190 Ga0496115_0197015 3300048918 Bacteria 1664
191 Ga0496121_0001796 3300048924 Bacteria 34668
192 Ga0496121_0101196 3300048924 Bacteria 2223
193 Ga0496123_0114602 3300048926 Bacteria 1532
194 Ga0496126_0000373 3300048929 Bacteria 92552
195 Ga0496126_0640116 3300048929 Bacteria 833
196 Ga0501031_0040079 3300049568 Bacteria 3058
197 Ga0501033_0005825 3300049570 Bacteria 9692
198 Ga0501033_0010556 3300049570 Bacteria 7081
199 Ga0501033_0027568 3300049570 Bacteria 4271
200 Ga0501033_0055376 3300049570 Bacteria 2932
201 Ga0501033_0056923 3300049570 Bacteria 2889
202 Ga0501033_0058450 3300049570 Bacteria 2848
203 Ga0501033_0405590 3300049570 Bacteria 950
204 Ga0501033_0532990 3300049570 Bacteria 810
205 Ga0501034_0095501 3300049571 Bacteria 2969
206 Ga0501034_0211965 3300049571 Bacteria 1892
207 Ga0501036_0141376 3300049572 Bacteria 2031
208 Ga0501036_0201291 3300049572 Bacteria 1675
209 Ga0501036_0389894 3300049572 Bacteria 1162
210 Ga0501037_0104578 3300049573 Bacteria 2041
211 Ga0501037_0323519 3300049573 Bacteria 1067
212 Ga0501038_0033501 3300049574 Bacteria 4526
213 Ga0501039_0103040 3300049575 Bacteria 2228
214 Ga0501043_0049982 3300049579 Bacteria 3287
215 Ga0501043_0075157 3300049579 Bacteria 2654
216 Ga0501043_0204777 3300049579 Bacteria 1530
217 Ga0501043_0248962 3300049579 Unclassified 1369
218 Ga0501046_0030919 3300049580 Bacteria 4345
219 Ga0501047_0009625 3300049581 Bacteria 9138
220 Ga0501047_0034691 3300049581 Bacteria 4871
221 Ga0501047_0073912 3300049581 Bacteria 3282
222 Ga0501047_0074074 3300049581 Bacteria 3278
223 Ga0501047_0696667 3300049581 Bacteria 833
224 Ga0501067_0023670 3300049583 Bacteria 3404
225 Ga0501069_0453652 3300049585 Bacteria 762
226 Ga0501070_0000002 3300049586 Bacteria 347524
227 Ga0501070_0133712 3300049586 Bacteria 2048
228 Ga0501070_0265617 3300049586 Bacteria 1402
229 Ga0501070_0620357 3300049586 Bacteria 861
230 Ga0501073_0119846 3300049589 Bacteria 1823
231 Ga0501074_0010879 3300049590 Bacteria 6607
232 Ga0501080_0000769 3300049742 Bacteria 26052
233 Ga0501080_0173556 3300049742 Bacteria 1987
234 Ga0501080_0606842 3300049742 Bacteria 971
235 Ga0501083_0155003 3300049744 Bacteria 1500
236 Ga0501083_0286324 3300049744 Bacteria 1072
237 Ga0501035_0002787 3300049822 Bacteria 16898
238 Ga0501035_0017211 3300049822 Bacteria 6663
239 Ga0501035_0029441 3300049822 Bacteria 5007
240 Ga0501035_0067933 3300049822 Bacteria 3161
241 Ga0501035_0086156 3300049822 Bacteria 2768
242 Ga0501044_0001264 3300049823 Bacteria 29871
243 Ga0501044_0002956 3300049823 Bacteria 19339
244 Ga0501044_0008437 3300049823 Bacteria 11299
245 Ga0501044_0021064 3300049823 Bacteria 6960
246 Ga0501044_0046328 3300049823 Bacteria 4502
247 Ga0501044_0085983 3300049823 Bacteria 3177
248 Ga0501044_0104310 3300049823 Bacteria 2849
249 Ga0501044_0111706 3300049823 Bacteria 2740
250 Ga0501044_0120102 3300049823 Bacteria 2630
251 nmdc:mga0k408_25263_c1 3300050493 Bacteria 3363
252 Ga0500578_0220543 3300053086 Bacteria 1153
253 Ga0500554_000976 3300053102 Bacteria 5570
254 Ga0500556_0001878 3300053104 Bacteria 7542
255 Ga0500595_029928 3300053119 Bacteria 1842
256 Ga0500595_049374 3300053119 Bacteria 1311
257 Ga0500608_138665 3300053122 Bacteria 1081
258 Ga0500614_006301 3300053123 Bacteria 2492
259 Ga0500618_000554 3300053125 Bacteria 23221
260 Ga0500658_0019357 3300053134 Bacteria 2561
261 Ga0500559_0000046 3300053136 Bacteria 98853
262 Ga0500559_0001854 3300053136 Bacteria 11523
263 Ga0500616_0013742 3300053153 Bacteria 4683
264 Ga0500627_0005414 3300053158 Bacteria 4241
265 Ga0500645_002689 3300053730 Bacteria 7730

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041451 Ga0451791_0380145 Ga0451791_0380145_30_689 172
2 3300049583 Ga0501067_0023670 Ga0501067_0023670_33_671 206
3 3300049585 Ga0501069_0453652 Ga0501069_0453652_116_745 207
4 3300049573 Ga0501037_0323519 Ga0501037_0323519_358_1053 220
5 3300049590 Ga0501074_0010879 Ga0501074_0010879_33_713 220
6 3300028794 Ga0307515_10020029 Ga0307515_100200299 223
7 3300041413 Ga0439465_0033059 Ga0439465_0033059_640_1356 223
8 3300046660 Ga0495625_0000384 Ga0495625_0000384_24144_24860 223
9 3300031238 Ga0265332_10137875 Ga0265332_101378751 225
10 3300049570 Ga0501033_0056923 Ga0501033_0056923_2003_2743 225
11 3300049572 Ga0501036_0141376 Ga0501036_0141376_977_1717 225
12 3300049579 Ga0501043_0049982 Ga0501043_0049982_1837_2577 225
13 3300049581 Ga0501047_0034691 Ga0501047_0034691_2377_3117 225
14 3300049822 Ga0501035_0086156 Ga0501035_0086156_860_1600 225
15 3300049823 Ga0501044_0002956 Ga0501044_0002956_9550_10290 225
16 3300053136 Ga0500559_0001854 Ga0500559_0001854_10175_10891 226
17 3300005327 Ga0070658_10002265 Ga0070658_100022653 227
18 3300005339 Ga0070660_100052987 Ga0070660_1000529872 227
19 3300005458 Ga0070681_10340383 Ga0070681_103403832 227
20 3300005530 Ga0070679_100111146 Ga0070679_1001111463 227
21 3300005548 Ga0070665_100000381 Ga0070665_10000038122 227
22 3300005563 Ga0068855_100048720 Ga0068855_1000487206 227
23 3300005563 Ga0068855_100064428 Ga0068855_1000644282 227
24 3300005563 Ga0068855_100215778 Ga0068855_1002157782 227
25 3300009093 Ga0105240_10056658 Ga0105240_100566586 227
26 3300009093 Ga0105240_10060828 Ga0105240_100608286 227
27 3300009551 Ga0105238_10067241 Ga0105238_100672415 227
28 3300009551 Ga0105238_10589467 Ga0105238_105894672 227
29 3300013104 Ga0157370_10050691 Ga0157370_100506916 227
30 3300013104 Ga0157370_10180222 Ga0157370_101802222 227
31 3300025909 Ga0207705_10015787 Ga0207705_100157875 227
32 3300025913 Ga0207695_10150538 Ga0207695_101505382 227
33 3300025913 Ga0207695_10343548 Ga0207695_103435482 227
34 3300025913 Ga0207695_10397893 Ga0207695_103978932 227
35 3300025924 Ga0207694_10188528 Ga0207694_101885282 227
36 3300025944 Ga0207661_10092368 Ga0207661_100923683 227
37 3300025949 Ga0207667_10075272 Ga0207667_100752725 227
38 3300028379 Ga0268266_10002150 Ga0268266_100021502 227
39 3300031247 Ga0265340_10018731 Ga0265340_100187312 227
40 3300031344 Ga0265316_10085791 Ga0265316_100857913 227
41 3300031711 Ga0265314_10074955 Ga0265314_100749553 227
42 3300031712 Ga0265342_10036161 Ga0265342_100361613 227
43 3300037418 Ga0395900_0096406 Ga0395900_0096406_1719_2465 227
44 3300037466 Ga0395898_0095570 Ga0395898_0095570_1148_1894 227
45 3300038443 Ga0395901_0151800 Ga0395901_0151800_862_1608 227
46 3300044694 Ga0466963_0210670 Ga0466963_0210670_458_1204 227
47 3300049570 Ga0501033_0005825 Ga0501033_0005825_3176_3919 228
48 3300049581 Ga0501047_0009625 Ga0501047_0009625_390_1133 228
49 3300049822 Ga0501035_0029441 Ga0501035_0029441_1661_2404 228
50 3300049823 Ga0501044_0008437 Ga0501044_0008437_5873_6616 228
51 3300041486 Ga0451807_0976884 Ga0451807_0976884_21_716 230
52 iso_pu_bacteria 2510917020 2511122632 234
53 iso_pu_bacteria 2582581280 2585153730 234
54 iso_pu_bacteria 2582581293 2585195325 234
55 iso_pu_bacteria 2585428106 2587919065 234
56 iso_pu_bacteria 2643221545 2643749129 234
57 iso_pu_bacteria 2643221552 2643783121 234
58 iso_pu_bacteria 2643221583 2643922827 234
59 iso_pu_bacteria 2643221584 2643930929 234
60 iso_pu_bacteria 2643221640 2644227524 234
61 iso_pu_bacteria 2643221642 2644236958 234
62 iso_pu_bacteria 2643221691 2644509096 234
63 iso_pu_bacteria 2791355048 2792461793 234
64 iso_pu_bacteria 2818991435 2819536139 234
65 iso_pu_bacteria 2818991454 2819644532 234
66 iso_pu_bacteria 2843744320 2843745845 234
67 iso_pu_bacteria 2849560528 2849562242 234
68 iso_pu_bacteria 2849573788 2849577163 234
69 iso_pu_bacteria 2851153111 2851156897 234
70 iso_pu_bacteria 2898329390 2898331173 234
71 3300005327 Ga0070658_10321269 Ga0070658_103212692 235
72 3300005327 Ga0070658_10407422 Ga0070658_104074221 235
73 3300009098 Ga0105245_10004401 Ga0105245_100044012 235
74 3300021384 Ga0213876_10005871 Ga0213876_100058717 235
75 3300025261 Ga0209233_1015746 Ga0209233_10157462 235
76 3300025913 Ga0207695_10634858 Ga0207695_106348581 235
77 3300025915 Ga0207693_10229397 Ga0207693_102293972 235
78 3300025927 Ga0207687_10045569 Ga0207687_100455694 235
79 3300026121 Ga0207683_10081487 Ga0207683_100814873 235
80 3300028577 Ga0265318_10001817 Ga0265318_1000181710 235
81 3300031344 Ga0265316_10232058 Ga0265316_102320582 235
82 3300031595 Ga0265313_10003218 Ga0265313_100032186 235
83 3300031595 Ga0265313_10007956 Ga0265313_100079564 235
84 3300031711 Ga0265314_10033605 Ga0265314_100336053 235
85 3300031711 Ga0265314_10066998 Ga0265314_100669984 235
86 3300039437 Ga0436365_1627614 Ga0436365_1627614_10127_10873 235
87 3300049570 Ga0501033_0027568 Ga0501033_0027568_1995_2741 235
88 3300049570 Ga0501033_0055376 Ga0501033_0055376_624_1370 235
89 3300049570 Ga0501033_0532990 Ga0501033_0532990_25_783 235
90 3300049571 Ga0501034_0211965 Ga0501034_0211965_1102_1842 235
91 3300049572 Ga0501036_0201291 Ga0501036_0201291_569_1315 235
92 3300049572 Ga0501036_0389894 Ga0501036_0389894_51_791 235
93 3300049575 Ga0501039_0103040 Ga0501039_0103040_977_1723 235
94 3300049579 Ga0501043_0075157 Ga0501043_0075157_1092_1838 235
95 3300049580 Ga0501046_0030919 Ga0501046_0030919_946_1686 235
96 3300049581 Ga0501047_0074074 Ga0501047_0074074_1123_1869 235
97 3300049581 Ga0501047_0696667 Ga0501047_0696667_15_764 235
98 3300049586 Ga0501070_0133712 Ga0501070_0133712_209_958 235
99 3300049589 Ga0501073_0119846 Ga0501073_0119846_620_1360 235
100 3300049742 Ga0501080_0606842 Ga0501080_0606842_143_892 235
101 3300049744 Ga0501083_0155003 Ga0501083_0155003_357_1103 235
102 3300049744 Ga0501083_0286324 Ga0501083_0286324_192_932 235
103 3300049822 Ga0501035_0067933 Ga0501035_0067933_1079_1825 235
104 3300049823 Ga0501044_0021064 Ga0501044_0021064_3212_3970 235
105 3300049823 Ga0501044_0085983 Ga0501044_0085983_556_1296 235
106 3300003320 rootH2_10026788 rootH2_1002678815 236
107 3300005339 Ga0070660_100038398 Ga0070660_1000383984 236
108 3300005341 Ga0070691_10003075 Ga0070691_100030752 236
109 3300005455 Ga0070663_100028290 Ga0070663_1000282904 236
110 3300005530 Ga0070679_100054275 Ga0070679_1000542754 236
111 3300005539 Ga0068853_100004304 Ga0068853_10000430412 236
112 3300005539 Ga0068853_100244850 Ga0068853_1002448502 236
113 3300005563 Ga0068855_100009515 Ga0068855_10000951514 236
114 3300009551 Ga0105238_10030373 Ga0105238_100303735 236
115 3300013102 Ga0157371_10091117 Ga0157371_100911172 236
116 3300013104 Ga0157370_10039391 Ga0157370_100393914 236
117 3300013307 Ga0157372_10013011 Ga0157372_1001301111 236
118 3300025909 Ga0207705_10000248 Ga0207705_1000024814 236
119 3300025912 Ga0207707_10001773 Ga0207707_1000177320 236
120 3300025917 Ga0207660_10001164 Ga0207660_100011643 236
121 3300025919 Ga0207657_10000541 Ga0207657_1000054130 236
122 3300025921 Ga0207652_10064767 Ga0207652_100647672 236
123 3300025949 Ga0207667_10082606 Ga0207667_100826064 236
124 3300026041 Ga0207639_10002843 Ga0207639_100028435 236
125 3300026067 Ga0207678_10339316 Ga0207678_103393162 236
126 3300031711 Ga0265314_10049911 Ga0265314_100499112 236
127 3300049568 Ga0501031_0040079 Ga0501031_0040079_1538_2323 236
128 3300049570 Ga0501033_0405590 Ga0501033_0405590_73_858 236
129 3300049573 Ga0501037_0104578 Ga0501037_0104578_1024_1809 236
130 3300049574 Ga0501038_0033501 Ga0501038_0033501_2359_3144 236
131 3300049579 Ga0501043_0248962 Ga0501043_0248962_389_1165 236
132 3300049586 Ga0501070_0000002 Ga0501070_0000002_329927_330712 236
133 3300049742 Ga0501080_0000769 Ga0501080_0000769_10237_11022 236
134 3300049822 Ga0501035_0002787 Ga0501035_0002787_1832_2617 236
135 3300049823 Ga0501044_0001264 Ga0501044_0001264_6214_6999 236
136 3300049823 Ga0501044_0046328 Ga0501044_0046328_746_1489 236
137 3300049823 Ga0501044_0120102 Ga0501044_0120102_34_786 236
138 3300005327 Ga0070658_10053444 Ga0070658_100534444 237
139 3300005336 Ga0070680_100000199 Ga0070680_10000019934 237
140 3300005439 Ga0070711_100570823 Ga0070711_1005708231 237
141 3300005458 Ga0070681_10000001 Ga0070681_10000001472 237
142 3300005458 Ga0070681_10693414 Ga0070681_106934141 237
143 3300005530 Ga0070679_100000032 Ga0070679_10000003284 237
144 3300005530 Ga0070679_100109152 Ga0070679_1001091522 237
145 3300005539 Ga0068853_100184543 Ga0068853_1001845432 237
146 3300005563 Ga0068855_100022075 Ga0068855_1000220755 237
147 3300005614 Ga0068856_100387206 Ga0068856_1003872062 237
148 3300005614 Ga0068856_100410674 Ga0068856_1004106742 237
149 3300006175 Ga0070712_100001918 Ga0070712_1000019185 237
150 3300009093 Ga0105240_10026618 Ga0105240_100266187 237
151 3300009177 Ga0105248_10000005 Ga0105248_10000005612 237
152 3300009545 Ga0105237_10027270 Ga0105237_1002727010 237
153 3300009545 Ga0105237_10081867 Ga0105237_100818674 237
154 3300009551 Ga0105238_10129607 Ga0105238_101296075 237
155 3300010375 Ga0105239_10002618 Ga0105239_1000261812 237
156 3300010375 Ga0105239_10016438 Ga0105239_1001643812 237
157 3300010375 Ga0105239_10025799 Ga0105239_100257995 237
158 3300010375 Ga0105239_10105973 Ga0105239_101059735 237
159 3300014325 Ga0163163_10336302 Ga0163163_103363023 237
160 3300014969 Ga0157376_10378606 Ga0157376_103786062 237
161 3300025909 Ga0207705_10026787 Ga0207705_100267874 237
162 3300025912 Ga0207707_10000001 Ga0207707_10000001157 237
163 3300025912 Ga0207707_10597221 Ga0207707_105972212 237
164 3300025913 Ga0207695_10006501 Ga0207695_1000650111 237
165 3300025913 Ga0207695_10057458 Ga0207695_100574582 237
166 3300025913 Ga0207695_10155253 Ga0207695_101552534 237
167 3300025915 Ga0207693_10000488 Ga0207693_1000048830 237
168 3300025916 Ga0207663_10018304 Ga0207663_100183043 237
169 3300025916 Ga0207663_10103900 Ga0207663_101039001 237
170 3300025917 Ga0207660_10000280 Ga0207660_100002803 237
171 3300025921 Ga0207652_10000571 Ga0207652_1000057111 237
172 3300025941 Ga0207711_10000002 Ga0207711_10000002610 237
173 3300026078 Ga0207702_10330035 Ga0207702_103300352 237
174 3300026116 Ga0207674_10171488 Ga0207674_101714882 237
175 3300028800 Ga0265338_10046080 Ga0265338_100460806 237
176 3300031247 Ga0265340_10004366 Ga0265340_100043662 237
177 3300031250 Ga0265331_10000003 Ga0265331_10000003212 237
178 3300031250 Ga0265331_10009723 Ga0265331_100097235 237
179 3300031250 Ga0265331_10018646 Ga0265331_100186462 237
180 3300031251 Ga0265327_10001228 Ga0265327_1000122814 237
181 3300031344 Ga0265316_10174747 Ga0265316_101747472 237
182 3300031712 Ga0265342_10100051 Ga0265342_101000512 237
183 3300046543 Ga0495645_0002146 Ga0495645_0002146_3879_4631 237
184 3300047444 Ga0495675_0026730 Ga0495675_0026730_669_1421 237
185 3300048910 Ga0496107_0237710 Ga0496107_0237710_98_856 237
186 3300048929 Ga0496126_0000373 Ga0496126_0000373_13776_14528 237
187 3300049570 Ga0501033_0010556 Ga0501033_0010556_600_1367 237
188 3300049570 Ga0501033_0058450 Ga0501033_0058450_1998_2744 237
189 3300049571 Ga0501034_0095501 Ga0501034_0095501_427_1173 237
190 3300049579 Ga0501043_0204777 Ga0501043_0204777_602_1369 237
191 3300049581 Ga0501047_0073912 Ga0501047_0073912_1231_1998 237
192 3300049586 Ga0501070_0265617 Ga0501070_0265617_605_1351 237
193 3300049586 Ga0501070_0620357 Ga0501070_0620357_52_819 237
194 3300049742 Ga0501080_0173556 Ga0501080_0173556_834_1586 237
195 3300049822 Ga0501035_0017211 Ga0501035_0017211_3999_4766 237
196 3300049823 Ga0501044_0104310 Ga0501044_0104310_1524_2291 237
197 3300049823 Ga0501044_0111706 Ga0501044_0111706_1759_2505 237
198 3300053119 Ga0500595_029928 Ga0500595_029928_533_1297 237
199 3300053119 Ga0500595_049374 Ga0500595_049374_276_1025 237
200 3300003215 JGI25153J46596_10064250 JGI25153J46596_100642502 238
201 3300003771 Ga0055526_1015935 Ga0055526_10159351 238
202 3300003773 Ga0055537_1003120 Ga0055537_10031206 238
203 3300003775 Ga0055524_1013031 Ga0055524_10130312 238
204 3300003775 Ga0055524_1028387 Ga0055524_10283872 238
205 3300003781 Ga0055536_1000210 Ga0055536_100021041 238
206 3300003790 Ga0055528_1010396 Ga0055528_10103965 238
207 3300003794 Ga0055531_10003130 Ga0055531_1000313013 238
208 3300005262 Ga0065165_1001939 Ga0065165_10019392 238
209 3300005335 Ga0070666_10000797 Ga0070666_1000079713 238
210 3300005563 Ga0068855_100474736 Ga0068855_1004747362 238
211 3300009177 Ga0105248_10300938 Ga0105248_103009381 238
212 3300025263 Ga0209565_1000213 Ga0209565_100021357 238
213 3300025273 Ga0209673_1000487 Ga0209673_100048750 238
214 3300025291 Ga0209675_1035494 Ga0209675_10354942 238
215 3300025292 Ga0209676_1000230 Ga0209676_100023012 238
216 3300025292 Ga0209676_1051715 Ga0209676_10517151 238
217 3300025295 Ga0209564_1001588 Ga0209564_100158814 238
218 3300025295 Ga0209564_1012157 Ga0209564_10121572 238
219 3300025297 Ga0209758_1000779 Ga0209758_100077925 238
220 3300025297 Ga0209758_1001770 Ga0209758_100177020 238
221 3300025298 Ga0209050_1000233 Ga0209050_100023312 238
222 3300025298 Ga0209050_1018099 Ga0209050_10180992 238
223 3300025299 Ga0209256_1001012 Ga0209256_100101221 238
224 3300025299 Ga0209256_1010987 Ga0209256_10109874 238
225 3300025303 Ga0209051_1002281 Ga0209051_10022815 238
226 3300025304 Ga0209257_1000186 Ga0209257_1000186108 238
227 3300025304 Ga0209257_1007985 Ga0209257_10079855 238
228 3300025903 Ga0207680_10017277 Ga0207680_100172775 238
229 3300028794 Ga0307515_10475672 Ga0307515_104756721 238
230 3300042156 Ga0439446_0025343 Ga0439446_0025343_711_1427 238
231 3300042436 Ga0439435_0061765 Ga0439435_0061765_152_868 238
232 3300046453 Ga0495627_001379 Ga0495627_001379_4771_5487 238
233 3300046460 Ga0495638_0000310 Ga0495638_0000310_9481_10197 238
234 3300046460 Ga0495638_0001082 Ga0495638_0001082_9986_10702 238
235 3300046460 Ga0495638_0010952 Ga0495638_0010952_58_774 238
236 3300046460 Ga0495638_0036784 Ga0495638_0036784_1593_2309 238
237 3300046471 Ga0495650_0000046 Ga0495650_0000046_307855_308571 238
238 3300046506 Ga0495583_0000005 Ga0495583_0000005_36091_36807 238
239 3300046506 Ga0495583_0134043 Ga0495583_0134043_108_824 238
240 3300046507 Ga0495606_0002480 Ga0495606_0002480_9316_10032 238
241 3300046512 Ga0495610_0000779 Ga0495610_0000779_17083_17799 238
242 3300046513 Ga0495616_0003007 Ga0495616_0003007_4645_5361 238
243 3300046515 Ga0495620_0023685 Ga0495620_0023685_1557_2273 238
244 3300046515 Ga0495620_0064632 Ga0495620_0064632_221_937 238
245 3300046519 Ga0495632_0011031 Ga0495632_0011031_3680_4396 238
246 3300046519 Ga0495632_0191679 Ga0495632_0191679_30_746 238
247 3300046520 Ga0495637_0009567 Ga0495637_0009567_3904_4620 238
248 3300046522 Ga0495643_0108844 Ga0495643_0108844_526_1242 238
249 3300046530 Ga0495654_0000023 Ga0495654_0000023_70302_71018 238
250 3300046530 Ga0495654_0144258 Ga0495654_0144258_133_849 238
251 3300046660 Ga0495625_0001472 Ga0495625_0001472_15961_16677 238
252 3300046660 Ga0495625_0002912 Ga0495625_0002912_877_1593 238
253 3300046660 Ga0495625_0016618 Ga0495625_0016618_3991_4707 238
254 3300046660 Ga0495625_0018502 Ga0495625_0018502_498_1214 238
255 3300046691 Ga0495670_0069143 Ga0495670_0069143_646_1362 238
256 3300046794 Ga0495589_0023989 Ga0495589_0023989_837_1553 238
257 3300046810 Ga0495660_0005724 Ga0495660_0005724_4598_5314 238
258 3300047320 Ga0495672_0000311 Ga0495672_0000311_8054_8770 238
259 3300047446 Ga0495679_004262 Ga0495679_004262_486_1226 238
260 3300047469 Ga0495673_0000025 Ga0495673_0000025_76616_77332 238
261 3300047469 Ga0495673_0003907 Ga0495673_0003907_3220_3936 238
262 3300047470 Ga0495681_0128888 Ga0495681_0128888_203_919 238
263 3300047472 Ga0495686_0007034 Ga0495686_0007034_4443_5159 238
264 3300047472 Ga0495686_0022983 Ga0495686_0022983_551_1267 238
265 3300048904 Ga0496101_0289557 Ga0496101_0289557_37_753 238
266 3300048909 Ga0496106_0011964 Ga0496106_0011964_942_1658 238
267 3300048910 Ga0496107_0000112 Ga0496107_0000112_32441_33157 238
268 3300048918 Ga0496115_0197015 Ga0496115_0197015_410_1141 238
269 3300048924 Ga0496121_0001796 Ga0496121_0001796_32557_33273 238
270 3300048924 Ga0496121_0101196 Ga0496121_0101196_1485_2201 238
271 3300048926 Ga0496123_0114602 Ga0496123_0114602_805_1521 238
272 3300048929 Ga0496126_0640116 Ga0496126_0640116_13_729 238
273 3300050493 nmdc:mga0k408_25263_c1 nmdc:mga0k408_25263_c1_2626_3342 238
274 3300053086 Ga0500578_0220543 Ga0500578_0220543_320_1036 238
275 3300053102 Ga0500554_000976 Ga0500554_000976_4824_5555 238
276 3300053104 Ga0500556_0001878 Ga0500556_0001878_109_825 238
277 3300053122 Ga0500608_138665 Ga0500608_138665_296_1012 238
278 3300053123 Ga0500614_006301 Ga0500614_006301_1173_1904 238
279 3300053125 Ga0500618_000554 Ga0500618_000554_17020_17760 238
280 3300053134 Ga0500658_0019357 Ga0500658_0019357_534_1250 238
281 3300053136 Ga0500559_0000046 Ga0500559_0000046_36603_37319 238
282 3300053153 Ga0500616_0013742 Ga0500616_0013742_1922_2638 238
283 3300053158 Ga0500627_0005414 Ga0500627_0005414_2174_2890 238
284 3300053730 Ga0500645_002689 Ga0500645_002689_613_1329 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20260

PUA_4

RNA methyltransferase PUA domain

68

111

0.94

PF04452

Methyltrans_RNA

RNA methyltransferase domain

119

278

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j3c-assembly1.cif.gz_B crystal structure of 16s ribosomal rna methyltransferase rsme 0.9048 1 238
4j3c-assembly1.cif.gz_B crystal structure of 16s ribosomal rna methyltransferase rsme 0.9012 1 238
4j3c-assembly1.cif.gz_A crystal structure of 16s ribosomal rna methyltransferase rsme 0.8894 1 238
4j3c-assembly1.cif.gz_A crystal structure of 16s ribosomal rna methyltransferase rsme 0.8858 1 238
5vm8-assembly3.cif.gz_B crystal structure of a ribosomal rna small subunit methyltransferase e from neisseria gonorrhoeae bound to s-adenosyl methionine 0.8807 1 238
ID Description Score Start End Superfamily
4j3cB02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9033 71 238 3.40.1280.10
4j3cB02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8981 71 238 3.40.1280.10
af_Q54SC0_1_67_2.40.240.20 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 0.8914 1 66 2.40.240.20
5o95A01 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 0.8805 2 66 2.40.240.20
4j3cA01 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Hypothetical PUA domain-like; domain 1 0.8726 3 69 2.40.240.20
ID Description Score Start End GO Terms
AF-A0A259D9P5-F1-model_v4 16S rRNA (Uracil(1498)-N(3))-methyltransferase 0.9771 2 68 GO:0008168
GO:0032259
AF-A0A259IDN6-F1-model_v4 deleted 0.9725 1 186
AF-A0A259IDN6-F1-model_v4 deleted 0.9674 1 186
AF-A0A7X6GM50-F1-model_v4 deleted 0.9605 2 76
AF-A0A2P2EAI5-F1-model_v4 Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.193) 0.9594 2 238 GO:0005737
GO:0070042
GO:0070475

Feature Viewer

pLDDT pTM Quality
90.14 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map