F385929

General Info

Members Datasets Scaffolds Average Seq Length
283 218 274 350

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2857547612|2857550853
Length 414
Sequence TFDRAANAARSASAGDPAAGAYAQACEQLSKEPRRWLVTGVAGFIGSHLLETLLKLGQEVRGLDNFMTGHRHNLEQVRASVGEQAWQRFTFIEGDIRDPQACARACGVSVQAASQAASAGYGDGEADGETEAAYGGSGSGSGSNGRLGERGRAGAGGPAAVDFVLHQAALGSVSRSLEDPLLCHAVNVSGFLNMLAAARDAGVRRFVYAASSATYGDHPALPKVEQHIGAPLSPYALSKYVNELYAQVYARCYAMQTVGLRYFNVFGPRQDPLGAYAAVIPRWIAAMLDNQAVHIHGDGATSRDFCFVHNAVQANILAATGTDPAAVNQVYNVAVNARTSLTQLHAAMQQMLLAARPQHVPLAPHYGEFRAGDVRHSQADIAKAARLLGYVPTHNLAQGLRQTIAWYVEQAERA

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
3 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
4 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
5 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
6 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
7 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
8 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
9 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
10 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
101 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
199 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
203 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.47
Metatranscriptomes 0.35
Isolates 3.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.3
Nodule 0
Rhizoplane 1.41
Rhizosphere 86.22
Stem 0
Stem Tuber 0
Unclassified 7.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000378 3300002705 Bacteria 28244
2 JGI25154J39366_1000408 3300002738 Bacteria 23290
3 JGI25157J39369_1000419 3300002741 Bacteria 28259
4 rootL2_10035342 3300003322 Bacteria 31163
5 rootL2_10081603 3300003322 Bacteria 6226
6 rootL2_10081604 3300003322 Bacteria 2942
7 rootH1_10035563 3300003323 Bacteria 11956
8 rootH1_10324902 3300003323 Bacteria 1523
9 Ga0055539_1000638 3300003752 Bacteria 9365
10 Ga0055533_1000061 3300003756 Bacteria 181542
11 Ga0055525_1001073 3300003759 Bacteria 6945
12 Ga0055535_1004183 3300003761 Bacteria 3645
13 Ga0055542_1004832 3300003762 Bacteria 3157
14 Ga0070676_10009913 3300005328 Bacteria 5157
15 Ga0070676_10074808 3300005328 Bacteria 2041
16 Ga0070683_100073963 3300005329 Bacteria 3182
17 Ga0070670_100004651 3300005331 Bacteria 11515
18 Ga0068869_100000828 3300005334 Bacteria 17665
19 Ga0068869_100081419 3300005334 Bacteria 2418
20 Ga0070680_100003378 3300005336 Bacteria 11902
21 Ga0070682_100000864 3300005337 Bacteria 17707
22 Ga0068868_100083097 3300005338 Bacteria 2570
23 Ga0070689_100003551 3300005340 Bacteria 10378
24 Ga0070689_100341036 3300005340 Bacteria 1255
25 Ga0070691_10012913 3300005341 Bacteria 3824
26 Ga0070668_100010068 3300005347 Bacteria 7008
27 Ga0070668_100083468 3300005347 Bacteria 2508
28 Ga0070675_100026355 3300005354 Bacteria 4665
29 Ga0070671_100066202 3300005355 Bacteria 3011
30 Ga0070673_100051942 3300005364 Bacteria 3214
31 Ga0070688_100021870 3300005365 Bacteria 3740
32 Ga0070667_100003401 3300005367 Bacteria 13547
33 Ga0070705_100037992 3300005440 Bacteria 2720
34 Ga0070708_100227277 3300005445 Bacteria 1751
35 Ga0070663_100023166 3300005455 Bacteria 4159
36 Ga0070681_10033739 3300005458 Bacteria 5138
37 Ga0070681_10102566 3300005458 Bacteria 2806
38 Ga0068867_100014689 3300005459 Bacteria 5549
39 Ga0070685_10014536 3300005466 Bacteria 4172
40 Ga0070706_100108416 3300005467 Bacteria 2584
41 Ga0070679_100001027 3300005530 Bacteria 24330
42 Ga0070684_100166534 3300005535 Bacteria 2001
43 Ga0068853_100006463 3300005539 Bacteria 9317
44 Ga0068853_100463672 3300005539 Bacteria 1193
45 Ga0070672_100100156 3300005543 Bacteria 2349
46 Ga0070695_100254714 3300005545 Bacteria 1279
47 Ga0070696_100191158 3300005546 Bacteria 1524
48 Ga0070693_100028697 3300005547 Bacteria 3027
49 Ga0070693_100065193 3300005547 Bacteria 2128
50 Ga0070704_100012830 3300005549 Bacteria 5182
51 Ga0068855_100002037 3300005563 Bacteria 25057
52 Ga0068855_100003021 3300005563 Bacteria 20582
53 Ga0068855_100011886 3300005563 Bacteria 10526
54 Ga0068855_100061967 3300005563 Bacteria 4368
55 Ga0068855_100208351 3300005563 Bacteria 2198
56 Ga0068857_100004157 3300005577 Bacteria 12195
57 Ga0068857_100031896 3300005577 Bacteria 4656
58 Ga0068854_100014084 3300005578 Bacteria 5264
59 Ga0068854_100197565 3300005578 Bacteria 1579
60 Ga0068856_100005784 3300005614 Bacteria 12184
61 Ga0068856_100046411 3300005614 Unclassified 4279
62 Ga0068856_100046997 3300005614 Bacteria 4252
63 Ga0068852_100233934 3300005616 Bacteria 1753
64 Ga0068859_100005800 3300005617 Bacteria 12542
65 Ga0068864_100000695 3300005618 Bacteria 28204
66 Ga0068866_10017704 3300005718 Bacteria 3208
67 Ga0068870_10083948 3300005840 Bacteria 1767
68 Ga0068863_100005718 3300005841 Bacteria 12205
69 Ga0068858_100001295 3300005842 Bacteria 25828
70 Ga0068858_100338842 3300005842 Unclassified 1439
71 Ga0068860_100002930 3300005843 Bacteria 17673
72 Ga0068862_100001083 3300005844 Bacteria 25976
73 Ga0068862_100317451 3300005844 Unclassified 1437
74 Ga0097621_100014425 3300006237 Bacteria 5912
75 Ga0097621_100071301 3300006237 Bacteria 2871
76 Ga0068865_100089181 3300006881 Bacteria 2233
77 Ga0097620_100005800 3300006931 Bacteria 12542
78 Ga0075435_100371908 3300007076 Bacteria 1227
79 Ga0099794_10000172 3300007265 Bacteria 23609
80 Ga0105244_10041521 3300009036 Bacteria 2383
81 Ga0105240_10006602 3300009093 Bacteria 17029
82 Ga0105240_10040184 3300009093 Bacteria 5987
83 Ga0111539_10006025 3300009094 Bacteria 15664
84 Ga0105245_10142173 3300009098 Bacteria 2261
85 Ga0105245_10617278 3300009098 Bacteria 1112
86 Ga0105241_10000280 3300009174 Bacteria 38076
87 Ga0105241_10048136 3300009174 Bacteria 3243
88 Ga0105242_10061607 3300009176 Bacteria 3086
89 Ga0105242_10181018 3300009176 Bacteria 1859
90 Ga0105248_10021195 3300009177 Bacteria 7200
91 Ga0105248_10053492 3300009177 Bacteria 4530
92 Ga0105237_10013770 3300009545 Bacteria 8470
93 Ga0105238_10172469 3300009551 Unclassified 2139
94 Ga0105239_10039742 3300010375 Bacteria 5154
95 Ga0105239_10423910 3300010375 Bacteria 1508
96 Ga0105246_10015636 3300011119 Bacteria 4794
97 Ga0157373_10001045 3300013100 Bacteria 21327
98 Ga0157371_10001240 3300013102 Bacteria 27027
99 Ga0157371_10022167 3300013102 Bacteria 4658
100 Ga0157370_10001574 3300013104 Bacteria 28236
101 Ga0157370_10030656 3300013104 Bacteria 5268
102 Ga0157369_10003013 3300013105 Bacteria 20145
103 Ga0157369_10016819 3300013105 Bacteria 8220
104 Ga0157369_10203135 3300013105 Bacteria 2079
105 Ga0157374_10000762 3300013296 Bacteria 28119
106 Ga0157378_10036853 3300013297 Bacteria 4329
107 Ga0157372_10000010 3300013307 Bacteria 300658
108 Ga0157372_10010571 3300013307 Bacteria 9817
109 Ga0157372_10163913 3300013307 Bacteria 2570
110 Ga0157375_10032036 3300013308 Bacteria 4981
111 Ga0163163_10054101 3300014325 Bacteria 3965
112 Ga0157380_10516334 3300014326 Bacteria 1164
113 Ga0182008_10000996 3300014497 Bacteria 19695
114 Ga0157379_10000401 3300014968 Bacteria 35047
115 Ga0157376_10019424 3300014969 Bacteria 5238
116 Ga0157376_10095494 3300014969 Bacteria 2585
117 Ga0157376_10128255 3300014969 Bacteria 2259
118 Ga0157376_10227521 3300014969 Bacteria 1731
119 Ga0182006_1000006 3300015261 Bacteria 555811
120 Ga0182007_10000187 3300015262 Bacteria 41581
121 Ga0182005_1000001 3300015265 Bacteria 1014869
122 Ga0163161_10000238 3300017792 Bacteria 50049
123 Ga0209674_100003 3300025226 Bacteria 2196646
124 Ga0209563_100086 3300025230 Bacteria 182199
125 Ga0209258_100228 3300025242 Bacteria 105712
126 Ga0209258_100872 3300025242 Bacteria 15897
127 Ga0209646_1000067 3300025246 Bacteria 241595
128 Ga0209026_1000033 3300025250 Bacteria 318512
129 Ga0209677_100165 3300025253 Bacteria 57730
130 Ga0209677_101647 3300025253 Bacteria 9396
131 Ga0209148_1000204 3300025254 Bacteria 105778
132 Ga0209759_1000024 3300025256 Bacteria 318512
133 Ga0209050_1002010 3300025298 Bacteria 18995
134 Ga0209257_1001540 3300025304 Bacteria 26823
135 Ga0207697_10091595 3300025315 Bacteria 1288
136 Ga0207642_10020690 3300025899 Bacteria 2575
137 Ga0207688_10029736 3300025901 Bacteria 3009
138 Ga0207645_10004674 3300025907 Bacteria 10081
139 Ga0207645_10126192 3300025907 Bacteria 1663
140 Ga0207654_10000120 3300025911 Bacteria 50396
141 Ga0207654_10145246 3300025911 Bacteria 1517
142 Ga0207707_10000631 3300025912 Bacteria 34920
143 Ga0207695_10005325 3300025913 Bacteria 17124
144 Ga0207695_10011891 3300025913 Bacteria 10490
145 Ga0207671_10058914 3300025914 Bacteria 2847
146 Ga0207660_10002006 3300025917 Bacteria 13540
147 Ga0207652_10000699 3300025921 Bacteria 32535
148 Ga0207650_10024703 3300025925 Bacteria 4274
149 Ga0207650_10133006 3300025925 Bacteria 1948
150 Ga0207650_10266918 3300025925 Bacteria 1390
151 Ga0207659_10002358 3300025926 Bacteria 11254
152 Ga0207687_10105974 3300025927 Bacteria 2077
153 Ga0207644_10031388 3300025931 Bacteria 3701
154 Ga0207686_10027531 3300025934 Bacteria 3330
155 Ga0207670_10046982 3300025936 Bacteria 2871
156 Ga0207691_10012693 3300025940 Bacteria 8069
157 Ga0207711_10019520 3300025941 Bacteria 5642
158 Ga0207689_10000171 3300025942 Bacteria 56716
159 Ga0207661_10057787 3300025944 Bacteria 3121
160 Ga0207679_10268174 3300025945 Bacteria 1459
161 Ga0207667_10002644 3300025949 Bacteria 22147
162 Ga0207667_10004632 3300025949 Bacteria 16870
163 Ga0207667_10039993 3300025949 Bacteria 4993
164 Ga0207667_10222418 3300025949 Bacteria 1934
165 Ga0207651_10068489 3300025960 Bacteria 2502
166 Ga0207651_10254676 3300025960 Bacteria 1438
167 Ga0207640_10007530 3300025981 Bacteria 6013
168 Ga0207658_10011591 3300025986 Bacteria 6001
169 Ga0207677_10031083 3300026023 Bacteria 3417
170 Ga0207703_10000464 3300026035 Bacteria 42704
171 Ga0207639_10030552 3300026041 Bacteria 3951
172 Ga0207639_10159207 3300026041 Bacteria 1901
173 Ga0207702_10000145 3300026078 Bacteria 83991
174 Ga0207702_10027373 3300026078 Unclassified 4734
175 Ga0207702_10092490 3300026078 Bacteria 2650
176 Ga0207641_10017859 3300026088 Bacteria 5811
177 Ga0207648_10023108 3300026089 Bacteria 5577
178 Ga0207676_10002704 3300026095 Bacteria 12617
179 Ga0207674_10026370 3300026116 Bacteria 6174
180 Ga0207675_100070141 3300026118 Bacteria 3276
181 Ga0207675_100083510 3300026118 Bacteria 2996
182 Ga0207698_10025547 3300026142 Bacteria 4163
183 Ga0207428_10072811 3300027907 Bacteria 2696
184 Ga0268265_10002333 3300028380 Bacteria 14411
185 Ga0268264_10002323 3300028381 Bacteria 16821
186 Ga0307405_10002861 3300031731 Bacteria 7760
187 Ga0307414_10044600 3300032004 Bacteria 3030
188 Ga0373934_0095271 3300035086 Bacteria 1202
189 Ga0373936_0014170 3300035113 Bacteria 3046
190 Ga0373954_0000398 3300035118 Bacteria 16290
191 Ga0373954_0135660 3300035118 Bacteria 1199
192 Ga0373956_0144029 3300035119 Bacteria 1120
193 Ga0373924_0010709 3300035410 Bacteria 3392
194 Ga0373935_0029319 3300035692 Bacteria 3405
195 Ga0373933_0014565 3300035724 Bacteria 4375
196 Ga0373947_0107259 3300035725 Bacteria 1761
197 Ga0373937_0009756 3300036401 Bacteria 8370
198 Ga0395899_0000405 3300037312 Bacteria 50426
199 Ga0395899_0202375 3300037312 Bacteria 1384
200 Ga0395900_0034860 3300037418 Bacteria 5185
201 Ga0395898_0006091 3300037466 Bacteria 12942
202 Ga0395905_0076931 3300037471 Bacteria 3127
203 Ga0395901_0002606 3300038443 Bacteria 18256
204 Ga0451853_0873336 3300041512 Bacteria 1122
205 Ga0451577_0002857 3300042876 Bacteria 19857
206 Ga0466966_0013271 3300044684 Bacteria 5455
207 Ga0453684_0002387 3300044712 Bacteria 45815
208 Ga0453684_0004185 3300044712 Bacteria 31074
209 Ga0453684_0132327 3300044712 Bacteria 2991
210 Ga0453684_0154273 3300044712 Bacteria 2725
211 Ga0466960_0062215 3300044901 Bacteria 1834
212 Ga0466959_0015601 3300045049 Bacteria 5539
213 Ga0451576_0441217 3300045051 Bacteria 1366
214 Ga0451576_0635715 3300045051 Bacteria 1121
215 Ga0466958_0011920 3300045836 Bacteria 4910
216 Ga0495629_0098103 3300046459 Bacteria 2044
217 Ga0495638_0000030 3300046460 Bacteria 318183
218 Ga0495653_0228046 3300046463 Bacteria 1248
219 Ga0495580_0019317 3300046472 Bacteria 5063
220 Ga0495580_0112523 3300046472 Bacteria 1890
221 Ga0495582_0072297 3300046473 Bacteria 1908
222 Ga0495662_0117795 3300046476 Bacteria 1303
223 Ga0495662_0142679 3300046476 Bacteria 1179
224 Ga0495664_0203919 3300046477 Bacteria 1198
225 Ga0495583_0000073 3300046506 Bacteria 178177
226 Ga0495630_0000096 3300046517 Bacteria 68453
227 Ga0495666_0048029 3300046526 Bacteria 2056
228 Ga0495652_0009830 3300046529 Bacteria 8671
229 Ga0495665_0037006 3300046531 Unclassified 2605
230 Ga0495586_0000043 3300046535 Bacteria 74540
231 Ga0495587_0001319 3300046536 Bacteria 16480
232 Ga0495609_0045897 3300046538 Bacteria 1957
233 Ga0495633_0000684 3300046558 Bacteria 31187
234 Ga0495667_0207453 3300046559 Bacteria 1253
235 Ga0495634_0010635 3300046642 Bacteria 6736
236 Ga0495635_0101380 3300046663 Bacteria 1967
237 Ga0495658_0036455 3300046683 Bacteria 2713
238 Ga0495658_0189648 3300046683 Bacteria 1277
239 Ga0495613_0084392 3300046689 Unclassified 2306
240 Ga0495624_0052749 3300046690 Unclassified 2569
241 Ga0495649_0001355 3300046694 Bacteria 18642
242 Ga0495674_0007245 3300047319 Bacteria 10616
243 Ga0495676_0059670 3300047321 Bacteria 2994
244 Ga0495675_0108499 3300047444 Bacteria 1734
245 Ga0495684_0032481 3300047471 Unclassified 4008
246 Ga0496101_0017090 3300048904 Bacteria 4914
247 Ga0496103_0114288 3300048906 Bacteria 1716
248 Ga0496108_0101763 3300048911 Bacteria 2451
249 Ga0496117_0000001 3300048920 Bacteria 2526244
250 Ga0496118_0000002 3300048921 Bacteria 1690764
251 Ga0496121_0002029 3300048924 Bacteria 32075
252 Ga0496121_0015072 3300048924 Bacteria 8134
253 Ga0496121_0226372 3300048924 Bacteria 1313
254 Ga0496122_0002570 3300048925 Bacteria 25500
255 Ga0495682_0015082 3300049460 Bacteria 2929
256 Ga0501315_001237 3300049531 Bacteria 2123
257 Ga0501033_0042482 3300049570 Bacteria 3389
258 Ga0501037_0060659 3300049573 Bacteria 2759
259 Ga0501046_0000334 3300049580 Bacteria 47461
260 Ga0501046_0105772 3300049580 Bacteria 2155
261 Ga0501047_0021105 3300049581 Bacteria 6253
262 Ga0501073_0055041 3300049589 Bacteria 2784
263 Ga0501080_0113370 3300049742 Bacteria 2513
264 Ga0501080_0194858 3300049742 Bacteria 1861
265 Ga0501241_002146 3300049758 Bacteria 3851
266 Ga0501035_0016955 3300049822 Bacteria 6714
267 Ga0501044_0001498 3300049823 Bacteria 27366
268 Ga0501044_0074208 3300049823 Bacteria 3457
269 nmdc:mga08y16_39652_c1 3300050511 Bacteria 4941
270 nmdc:mga0rr50_358375_c1 3300050513 Bacteria 1227
271 Ga0495619_0037903 3300053085 Unclassified 3144
272 Ga0500618_002376 3300053125 Bacteria 7180
273 Ga0501084_0033198 3300054114 Bacteria 4317
274 Ga0501082_0170468 3300060353 Bacteria 1892

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035119 Ga0373956_0144029 Ga0373956_0144029_194_1075 288
2 3300046559 Ga0495667_0207453 Ga0495667_0207453_34_915 288
3 3300035725 Ga0373947_0107259 Ga0373947_0107259_807_1748 296
4 3300048904 Ga0496101_0017090 Ga0496101_0017090_3951_4871 296
5 3300037471 Ga0395905_0076931 Ga0395905_0076931_1923_2924 304
6 iso_pu_bacteria 2739367866 2740032199 315
7 iso_pu_bacteria 2910245624 2910250878 315
8 3300037418 Ga0395900_0034860 Ga0395900_0034860_185_1183 317
9 3300014497 Ga0182008_10000996 Ga0182008_1000099614 318
10 3300017792 Ga0163161_10000238 Ga0163161_1000023841 318
11 3300035118 Ga0373954_0135660 Ga0373954_0135660_136_1158 318
12 3300046463 Ga0495653_0228046 Ga0495653_0228046_202_1224 318
13 3300046683 Ga0495658_0189648 Ga0495658_0189648_212_1234 318
14 3300049758 Ga0501241_002146 Ga0501241_002146_676_1662 318
15 3300014969 Ga0157376_10019424 Ga0157376_100194244 319
16 3300025298 Ga0209050_1002010 Ga0209050_10020104 319
17 3300025304 Ga0209257_1001540 Ga0209257_10015407 319
18 3300053125 Ga0500618_002376 Ga0500618_002376_5111_6118 319
19 3300003322 rootL2_10035342 rootL2_1003534215 320
20 3300005614 Ga0068856_100046411 Ga0068856_1000464113 320
21 3300013100 Ga0157373_10001045 Ga0157373_1000104518 320
22 3300026078 Ga0207702_10027373 Ga0207702_100273732 320
23 3300046538 Ga0495609_0045897 Ga0495609_0045897_604_1593 320
24 3300013307 Ga0157372_10010571 Ga0157372_100105713 323
25 3300005355 Ga0070671_100066202 Ga0070671_1000662024 325
26 3300005546 Ga0070696_100191158 Ga0070696_1001911582 325
27 3300005547 Ga0070693_100028697 Ga0070693_1000286973 325
28 3300006237 Ga0097621_100014425 Ga0097621_1000144252 325
29 3300007076 Ga0075435_100371908 Ga0075435_1003719081 325
30 3300014969 Ga0157376_10095494 Ga0157376_100954942 325
31 3300025931 Ga0207644_10031388 Ga0207644_100313884 325
32 3300025936 Ga0207670_10046982 Ga0207670_100469822 325
33 3300050513 nmdc:mga0rr50_358375_c1 nmdc:mga0rr50_358375_c1_74_1129 325
34 3300005328 Ga0070676_10074808 Ga0070676_100748082 326
35 3300005340 Ga0070689_100003551 Ga0070689_1000035512 326
36 3300005354 Ga0070675_100026355 Ga0070675_1000263551 326
37 3300005365 Ga0070688_100021870 Ga0070688_1000218703 326
38 3300005455 Ga0070663_100023166 Ga0070663_1000231664 326
39 3300005466 Ga0070685_10014536 Ga0070685_100145363 326
40 3300005543 Ga0070672_100100156 Ga0070672_1001001561 326
41 3300005616 Ga0068852_100233934 Ga0068852_1002339342 326
42 3300005840 Ga0068870_10083948 Ga0068870_100839482 326
43 3300025315 Ga0207697_10091595 Ga0207697_100915951 326
44 3300025901 Ga0207688_10029736 Ga0207688_100297362 326
45 3300025907 Ga0207645_10126192 Ga0207645_101261922 326
46 3300025925 Ga0207650_10266918 Ga0207650_102669182 326
47 3300025926 Ga0207659_10002358 Ga0207659_100023582 326
48 3300025940 Ga0207691_10012693 Ga0207691_100126932 326
49 3300025945 Ga0207679_10268174 Ga0207679_102681742 326
50 3300025960 Ga0207651_10254676 Ga0207651_102546762 326
51 3300041512 Ga0451853_0873336 Ga0451853_0873336_57_1091 326
52 3300003761 Ga0055535_1004183 Ga0055535_10041833 327
53 3300003762 Ga0055542_1004832 Ga0055542_10048321 327
54 3300005336 Ga0070680_100003378 Ga0070680_1000033788 327
55 3300005337 Ga0070682_100000864 Ga0070682_1000008643 327
56 3300005341 Ga0070691_10012913 Ga0070691_100129134 327
57 3300005458 Ga0070681_10033739 Ga0070681_100337394 327
58 3300005530 Ga0070679_100001027 Ga0070679_10000102719 327
59 3300005539 Ga0068853_100006463 Ga0068853_1000064635 327
60 3300005547 Ga0070693_100065193 Ga0070693_1000651932 327
61 3300005563 Ga0068855_100011886 Ga0068855_1000118866 327
62 3300009093 Ga0105240_10006602 Ga0105240_100066028 327
63 3300009174 Ga0105241_10000280 Ga0105241_100002807 327
64 3300013102 Ga0157371_10022167 Ga0157371_100221675 327
65 3300013104 Ga0157370_10001574 Ga0157370_100015747 327
66 3300013307 Ga0157372_10163913 Ga0157372_101639132 327
67 3300014969 Ga0157376_10128255 Ga0157376_101282553 327
68 3300025242 Ga0209258_100228 Ga0209258_10022847 327
69 3300025254 Ga0209148_1000204 Ga0209148_100020445 327
70 3300025911 Ga0207654_10000120 Ga0207654_1000012025 327
71 3300025912 Ga0207707_10000631 Ga0207707_100006318 327
72 3300025913 Ga0207695_10011891 Ga0207695_100118917 327
73 3300025917 Ga0207660_10002006 Ga0207660_100020069 327
74 3300025921 Ga0207652_10000699 Ga0207652_100006999 327
75 3300025949 Ga0207667_10039993 Ga0207667_100399934 327
76 3300026041 Ga0207639_10030552 Ga0207639_100305524 327
77 3300035086 Ga0373934_0095271 Ga0373934_0095271_11_1018 327
78 3300044712 Ga0453684_0004185 Ga0453684_0004185_8174_9178 327
79 3300046459 Ga0495629_0098103 Ga0495629_0098103_505_1512 327
80 3300046472 Ga0495580_0019317 Ga0495580_0019317_624_1631 327
81 3300046476 Ga0495662_0117795 Ga0495662_0117795_156_1163 327
82 3300046477 Ga0495664_0203919 Ga0495664_0203919_181_1188 327
83 3300046531 Ga0495665_0037006 Ga0495665_0037006_1446_2453 327
84 3300046663 Ga0495635_0101380 Ga0495635_0101380_178_1185 327
85 3300046683 Ga0495658_0036455 Ga0495658_0036455_884_1891 327
86 3300046689 Ga0495613_0084392 Ga0495613_0084392_937_1944 327
87 3300046690 Ga0495624_0052749 Ga0495624_0052749_213_1220 327
88 3300047471 Ga0495684_0032481 Ga0495684_0032481_151_1158 327
89 3300049589 Ga0501073_0055041 Ga0501073_0055041_580_1602 327
90 3300049742 Ga0501080_0194858 Ga0501080_0194858_705_1727 327
91 3300049823 Ga0501044_0074208 Ga0501044_0074208_1610_2632 327
92 3300053085 Ga0495619_0037903 Ga0495619_0037903_170_1177 327
93 3300054114 Ga0501084_0033198 Ga0501084_0033198_3227_4249 327
94 3300060353 Ga0501082_0170468 Ga0501082_0170468_696_1718 327
95 3300045051 Ga0451576_0441217 Ga0451576_0441217_26_1147 329
96 3300013102 Ga0157371_10001240 Ga0157371_100012402 330
97 3300013104 Ga0157370_10030656 Ga0157370_100306562 330
98 3300013105 Ga0157369_10003013 Ga0157369_1000301314 330
99 3300013307 Ga0157372_10000010 Ga0157372_10000010146 330
100 3300037312 Ga0395899_0000405 Ga0395899_0000405_21220_22257 330
101 3300044684 Ga0466966_0013271 Ga0466966_0013271_53_1090 330
102 3300045049 Ga0466959_0015601 Ga0466959_0015601_3385_4422 330
103 3300045836 Ga0466958_0011920 Ga0466958_0011920_1522_2559 330
104 iso_pu_bacteria 2896429255 2896430138 330
105 3300049580 Ga0501046_0105772 Ga0501046_0105772_211_1335 332
106 iso_pu_bacteria 3007866637 3007870309 332
107 3300005844 Ga0068862_100317451 Ga0068862_1003174512 333
108 3300026142 Ga0207698_10025547 Ga0207698_100255473 333
109 3300007265 Ga0099794_10000172 Ga0099794_100001727 334
110 3300005549 Ga0070704_100012830 Ga0070704_1000128303 335
111 3300013105 Ga0157369_10203135 Ga0157369_102031352 335
112 3300025925 Ga0207650_10133006 Ga0207650_101330062 335
113 3300046529 Ga0495652_0009830 Ga0495652_0009830_6793_7812 335
114 3300005563 Ga0068855_100002037 Ga0068855_1000020373 336
115 3300005614 Ga0068856_100046997 Ga0068856_1000469973 336
116 3300014326 Ga0157380_10516334 Ga0157380_105163341 336
117 3300025949 Ga0207667_10002644 Ga0207667_100026443 336
118 3300026078 Ga0207702_10092490 Ga0207702_100924903 336
119 3300031731 Ga0307405_10002861 Ga0307405_100028615 336
120 3300032004 Ga0307414_10044600 Ga0307414_100446003 336
121 3300046536 Ga0495587_0001319 Ga0495587_0001319_9393_10439 336
122 3300005458 Ga0070681_10102566 Ga0070681_101025662 337
123 3300005535 Ga0070684_100166534 Ga0070684_1001665342 337
124 3300005563 Ga0068855_100003021 Ga0068855_1000030219 337
125 3300005563 Ga0068855_100061967 Ga0068855_1000619673 337
126 3300006237 Ga0097621_100071301 Ga0097621_1000713014 337
127 3300009094 Ga0111539_10006025 Ga0111539_100060253 337
128 3300009098 Ga0105245_10142173 Ga0105245_101421732 337
129 3300009176 Ga0105242_10181018 Ga0105242_101810182 337
130 3300009177 Ga0105248_10053492 Ga0105248_100534922 337
131 3300009551 Ga0105238_10172469 Ga0105238_101724692 337
132 3300014969 Ga0157376_10227521 Ga0157376_102275211 337
133 3300025927 Ga0207687_10105974 Ga0207687_101059741 337
134 3300026118 Ga0207675_100070141 Ga0207675_1000701413 337
135 3300027907 Ga0207428_10072811 Ga0207428_100728112 337
136 3300035118 Ga0373954_0000398 Ga0373954_0000398_9808_10866 337
137 3300035410 Ga0373924_0010709 Ga0373924_0010709_1602_2660 337
138 3300035724 Ga0373933_0014565 Ga0373933_0014565_707_1765 337
139 3300036401 Ga0373937_0009756 Ga0373937_0009756_2123_3181 337
140 3300042876 Ga0451577_0002857 Ga0451577_0002857_14362_15390 337
141 3300044712 Ga0453684_0002387 Ga0453684_0002387_18215_19243 337
142 3300046473 Ga0495582_0072297 Ga0495582_0072297_510_1538 337
143 3300046476 Ga0495662_0142679 Ga0495662_0142679_110_1138 337
144 3300046517 Ga0495630_0000096 Ga0495630_0000096_48998_50026 337
145 3300046526 Ga0495666_0048029 Ga0495666_0048029_474_1502 337
146 3300046535 Ga0495586_0000043 Ga0495586_0000043_52073_53101 337
147 3300046642 Ga0495634_0010635 Ga0495634_0010635_5268_6296 337
148 3300046694 Ga0495649_0001355 Ga0495649_0001355_3434_4459 337
149 3300047319 Ga0495674_0007245 Ga0495674_0007245_3103_4131 337
150 3300047321 Ga0495676_0059670 Ga0495676_0059670_1710_2738 337
151 3300047444 Ga0495675_0108499 Ga0495675_0108499_372_1430 337
152 3300049531 Ga0501315_001237 Ga0501315_001237_161_1246 337
153 3300049580 Ga0501046_0000334 Ga0501046_0000334_23185_24213 337
154 3300049742 Ga0501080_0113370 Ga0501080_0113370_34_1119 337
155 3300050511 nmdc:mga08y16_39652_c1 nmdc:mga08y16_39652_c1_690_1727 337
156 3300009098 Ga0105245_10617278 Ga0105245_106172781 338
157 iso_pu_bacteria 2600255292 2601668622 338
158 iso_pu_bacteria 2857547612 2857550853 338
159 iso_pu_bacteria 2932410948 2932414175 338
160 iso_pu_bacteria 2932416698 2932416784 338
161 3300003323 rootH1_10035563 rootH1_100355632 339
162 3300003752 Ga0055539_1000638 Ga0055539_10006386 339
163 3300003756 Ga0055533_1000061 Ga0055533_100006155 339
164 3300003759 Ga0055525_1001073 Ga0055525_10010732 339
165 3300025226 Ga0209674_100003 Ga0209674_100003109 339
166 3300025230 Ga0209563_100086 Ga0209563_10008656 339
167 3300025253 Ga0209677_100165 Ga0209677_1001656 339
168 iso_pu_bacteria 2885080285 2885082987 339
169 3300044901 Ga0466960_0062215 Ga0466960_0062215_168_1232 340
170 3300003322 rootL2_10081603 rootL2_100816032 341
171 3300003322 rootL2_10081604 rootL2_100816043 341
172 3300003323 rootH1_10324902 rootH1_103249022 341
173 3300005445 Ga0070708_100227277 Ga0070708_1002272771 341
174 3300015261 Ga0182006_1000006 Ga0182006_1000006264 341
175 3300015262 Ga0182007_10000187 Ga0182007_1000018731 341
176 3300015265 Ga0182005_1000001 Ga0182005_1000001513 341
177 3300046460 Ga0495638_0000030 Ga0495638_0000030_263746_264819 341
178 3300048920 Ga0496117_0000001 Ga0496117_0000001_408668_409861 341
179 3300048921 Ga0496118_0000002 Ga0496118_0000002_408668_409861 341
180 3300048924 Ga0496121_0002029 Ga0496121_0002029_319_1512 341
181 3300048924 Ga0496121_0015072 Ga0496121_0015072_5413_6666 341
182 3300048924 Ga0496121_0226372 Ga0496121_0226372_158_1246 341
183 3300048925 Ga0496122_0002570 Ga0496122_0002570_23828_24997 341
184 3300049570 Ga0501033_0042482 Ga0501033_0042482_292_1380 341
185 3300049573 Ga0501037_0060659 Ga0501037_0060659_1118_2206 341
186 3300049581 Ga0501047_0021105 Ga0501047_0021105_922_2010 341
187 3300049822 Ga0501035_0016955 Ga0501035_0016955_698_1786 341
188 3300049823 Ga0501044_0001498 Ga0501044_0001498_10858_11946 341
189 3300005539 Ga0068853_100463672 Ga0068853_1004636721 342
190 3300005563 Ga0068855_100208351 Ga0068855_1002083512 342
191 3300025949 Ga0207667_10004632 Ga0207667_100046328 342
192 3300002705 JGI25156J39149_1000378 JGI25156J39149_100037811 343
193 3300002738 JGI25154J39366_1000408 JGI25154J39366_100040811 343
194 3300002741 JGI25157J39369_1000419 JGI25157J39369_100041913 343
195 3300005328 Ga0070676_10009913 Ga0070676_100099135 343
196 3300005329 Ga0070683_100073963 Ga0070683_1000739632 343
197 3300005331 Ga0070670_100004651 Ga0070670_1000046512 343
198 3300005334 Ga0068869_100000828 Ga0068869_1000008287 343
199 3300005334 Ga0068869_100081419 Ga0068869_1000814192 343
200 3300005338 Ga0068868_100083097 Ga0068868_1000830972 343
201 3300005340 Ga0070689_100341036 Ga0070689_1003410362 343
202 3300005347 Ga0070668_100010068 Ga0070668_1000100682 343
203 3300005347 Ga0070668_100083468 Ga0070668_1000834682 343
204 3300005364 Ga0070673_100051942 Ga0070673_1000519422 343
205 3300005367 Ga0070667_100003401 Ga0070667_1000034013 343
206 3300005440 Ga0070705_100037992 Ga0070705_1000379922 343
207 3300005459 Ga0068867_100014689 Ga0068867_1000146893 343
208 3300005467 Ga0070706_100108416 Ga0070706_1001084162 343
209 3300005545 Ga0070695_100254714 Ga0070695_1002547141 343
210 3300005577 Ga0068857_100004157 Ga0068857_1000041576 343
211 3300005577 Ga0068857_100031896 Ga0068857_1000318963 343
212 3300005578 Ga0068854_100014084 Ga0068854_1000140845 343
213 3300005578 Ga0068854_100197565 Ga0068854_1001975652 343
214 3300005614 Ga0068856_100005784 Ga0068856_1000057845 343
215 3300005617 Ga0068859_100005800 Ga0068859_1000058004 343
216 3300005618 Ga0068864_100000695 Ga0068864_10000069516 343
217 3300005718 Ga0068866_10017704 Ga0068866_100177042 343
218 3300005841 Ga0068863_100005718 Ga0068863_1000057183 343
219 3300005842 Ga0068858_100001295 Ga0068858_1000012956 343
220 3300005842 Ga0068858_100338842 Ga0068858_1003388421 343
221 3300005843 Ga0068860_100002930 Ga0068860_1000029307 343
222 3300005844 Ga0068862_100001083 Ga0068862_1000010838 343
223 3300006881 Ga0068865_100089181 Ga0068865_1000891812 343
224 3300006931 Ga0097620_100005800 Ga0097620_1000058004 343
225 3300009036 Ga0105244_10041521 Ga0105244_100415212 343
226 3300009093 Ga0105240_10040184 Ga0105240_100401843 343
227 3300009174 Ga0105241_10048136 Ga0105241_100481362 343
228 3300009176 Ga0105242_10061607 Ga0105242_100616072 343
229 3300009177 Ga0105248_10021195 Ga0105248_100211952 343
230 3300009545 Ga0105237_10013770 Ga0105237_100137703 343
231 3300010375 Ga0105239_10039742 Ga0105239_100397425 343
232 3300010375 Ga0105239_10423910 Ga0105239_104239102 343
233 3300011119 Ga0105246_10015636 Ga0105246_100156365 343
234 3300013105 Ga0157369_10016819 Ga0157369_100168192 343
235 3300013296 Ga0157374_10000762 Ga0157374_1000076216 343
236 3300013297 Ga0157378_10036853 Ga0157378_100368533 343
237 3300013308 Ga0157375_10032036 Ga0157375_100320363 343
238 3300014325 Ga0163163_10054101 Ga0163163_100541012 343
239 3300014968 Ga0157379_10000401 Ga0157379_100004018 343
240 3300025242 Ga0209258_100872 Ga0209258_1008725 343
241 3300025246 Ga0209646_1000067 Ga0209646_1000067216 343
242 3300025250 Ga0209026_1000033 Ga0209026_100003313 343
243 3300025253 Ga0209677_101647 Ga0209677_1016476 343
244 3300025256 Ga0209759_1000024 Ga0209759_100002413 343
245 3300025899 Ga0207642_10020690 Ga0207642_100206902 343
246 3300025907 Ga0207645_10004674 Ga0207645_100046742 343
247 3300025911 Ga0207654_10145246 Ga0207654_101452462 343
248 3300025913 Ga0207695_10005325 Ga0207695_100053252 343
249 3300025914 Ga0207671_10058914 Ga0207671_100589141 343
250 3300025925 Ga0207650_10024703 Ga0207650_100247032 343
251 3300025934 Ga0207686_10027531 Ga0207686_100275312 343
252 3300025941 Ga0207711_10019520 Ga0207711_100195203 343
253 3300025942 Ga0207689_10000171 Ga0207689_1000017129 343
254 3300025944 Ga0207661_10057787 Ga0207661_100577872 343
255 3300025949 Ga0207667_10222418 Ga0207667_102224182 343
256 3300025960 Ga0207651_10068489 Ga0207651_100684893 343
257 3300025981 Ga0207640_10007530 Ga0207640_100075305 343
258 3300025986 Ga0207658_10011591 Ga0207658_100115913 343
259 3300026023 Ga0207677_10031083 Ga0207677_100310832 343
260 3300026035 Ga0207703_10000464 Ga0207703_100004648 343
261 3300026041 Ga0207639_10159207 Ga0207639_101592072 343
262 3300026078 Ga0207702_10000145 Ga0207702_1000014551 343
263 3300026088 Ga0207641_10017859 Ga0207641_100178593 343
264 3300026089 Ga0207648_10023108 Ga0207648_100231083 343
265 3300026095 Ga0207676_10002704 Ga0207676_100027047 343
266 3300026116 Ga0207674_10026370 Ga0207674_100263704 343
267 3300026118 Ga0207675_100083510 Ga0207675_1000835102 343
268 3300028380 Ga0268265_10002333 Ga0268265_100023335 343
269 3300028381 Ga0268264_10002323 Ga0268264_100023236 343
270 3300035113 Ga0373936_0014170 Ga0373936_0014170_176_1288 343
271 3300035692 Ga0373935_0029319 Ga0373935_0029319_81_1193 343
272 3300037312 Ga0395899_0202375 Ga0395899_0202375_314_1345 343
273 3300037466 Ga0395898_0006091 Ga0395898_0006091_2376_3407 343
274 3300038443 Ga0395901_0002606 Ga0395901_0002606_14059_15090 343
275 3300044712 Ga0453684_0132327 Ga0453684_0132327_1266_2324 343
276 3300044712 Ga0453684_0154273 Ga0453684_0154273_67_1221 343
277 3300045051 Ga0451576_0635715 Ga0451576_0635715_40_1110 343
278 3300046472 Ga0495580_0112523 Ga0495580_0112523_112_1206 343
279 3300046506 Ga0495583_0000073 Ga0495583_0000073_105771_106826 343
280 3300046558 Ga0495633_0000684 Ga0495633_0000684_349_1620 343
281 3300048906 Ga0496103_0114288 Ga0496103_0114288_541_1638 343
282 3300048911 Ga0496108_0101763 Ga0496108_0101763_402_1499 343
283 3300049460 Ga0495682_0015082 Ga0495682_0015082_807_2078 343

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

155

334

0.97

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

37

107

0.92

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

158

403

0.89

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

36

134

0.85

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

158

344

0.8

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

37

131

0.74

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

157

360

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ru9-assembly1.cif.gz_A specific recognition of n-acetylated substrates and domain flexibility in wbgu: a udp-galnac 4-epimerase 0.9809 5 343
1sb8-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4-epimerase complexed with udp-n-acetylgalactosamine 0.9808 10 343
3ruc-assembly1.cif.gz_A specific recognition of n-acetylated substrates and domain flexibility in wbgu: a udp-galnac 4-epimerase 0.9782 7 343
3ru9-assembly1.cif.gz_A specific recognition of n-acetylated substrates and domain flexibility in wbgu: a udp-galnac 4-epimerase 0.9607 5 343
3ruc-assembly1.cif.gz_A specific recognition of n-acetylated substrates and domain flexibility in wbgu: a udp-galnac 4-epimerase 0.9581 7 343
ID Description Score Start End Superfamily
3ru7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9738 7 269 3.40.50.720
6dntA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9549 20 270 3.40.50.720
3lu1B02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9468 199 343 3.90.25.10
6dntA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9457 20 270 3.40.50.720
af_Q2G289_4_319_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9339 22 341 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A259D8D1-F1-model_v4 LPS biosynthesis protein WbpP 0.987 10 213
AF-A0A3D2H7C2-F1-model_v4 LPS biosynthesis protein WbpP 0.9813 10 343
AF-A0A842W9Y4-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.977 23 342
AF-A0A7T9IE08-F1-model_v4 deleted 0.9767 23 343
AF-A0A1F3T5J3-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9758 18 342

Feature Viewer

pLDDT pTM Quality
93.69 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map