F385929
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 283 | 218 | 274 | 350 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2857547612|2857550853 |
| Length | 414 |
| Sequence | TFDRAANAARSASAGDPAAGAYAQACEQLSKEPRRWLVTGVAGFIGSHLLETLLKLGQEVRGLDNFMTGHRHNLEQVRASVGEQAWQRFTFIEGDIRDPQACARACGVSVQAASQAASAGYGDGEADGETEAAYGGSGSGSGSNGRLGERGRAGAGGPAAVDFVLHQAALGSVSRSLEDPLLCHAVNVSGFLNMLAAARDAGVRRFVYAASSATYGDHPALPKVEQHIGAPLSPYALSKYVNELYAQVYARCYAMQTVGLRYFNVFGPRQDPLGAYAAVIPRWIAAMLDNQAVHIHGDGATSRDFCFVHNAVQANILAATGTDPAAVNQVYNVAVNARTSLTQLHAAMQQMLLAARPQHVPLAPHYGEFRAGDVRHSQADIAKAARLLGYVPTHNLAQGLRQTIAWYVEQAERA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 2 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 3 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 4 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 5 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 6 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 7 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 8 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 9 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 10 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 11 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 12 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 68 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 100 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 145 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 146 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 147 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 148 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 149 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 150 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 151 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 152 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 153 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 154 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 156 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 157 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 158 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 159 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 160 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 161 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 162 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 163 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 164 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 165 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 166 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 167 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 168 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 197 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 199 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 200 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 201 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 202 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 211 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 217 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.47 |
| Metatranscriptomes | 0.35 |
| Isolates | 3.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.3 |
| Nodule | 0 |
| Rhizoplane | 1.41 |
| Rhizosphere | 86.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000378 | 3300002705 | Bacteria | 28244 |
| 2 | JGI25154J39366_1000408 | 3300002738 | Bacteria | 23290 |
| 3 | JGI25157J39369_1000419 | 3300002741 | Bacteria | 28259 |
| 4 | rootL2_10035342 | 3300003322 | Bacteria | 31163 |
| 5 | rootL2_10081603 | 3300003322 | Bacteria | 6226 |
| 6 | rootL2_10081604 | 3300003322 | Bacteria | 2942 |
| 7 | rootH1_10035563 | 3300003323 | Bacteria | 11956 |
| 8 | rootH1_10324902 | 3300003323 | Bacteria | 1523 |
| 9 | Ga0055539_1000638 | 3300003752 | Bacteria | 9365 |
| 10 | Ga0055533_1000061 | 3300003756 | Bacteria | 181542 |
| 11 | Ga0055525_1001073 | 3300003759 | Bacteria | 6945 |
| 12 | Ga0055535_1004183 | 3300003761 | Bacteria | 3645 |
| 13 | Ga0055542_1004832 | 3300003762 | Bacteria | 3157 |
| 14 | Ga0070676_10009913 | 3300005328 | Bacteria | 5157 |
| 15 | Ga0070676_10074808 | 3300005328 | Bacteria | 2041 |
| 16 | Ga0070683_100073963 | 3300005329 | Bacteria | 3182 |
| 17 | Ga0070670_100004651 | 3300005331 | Bacteria | 11515 |
| 18 | Ga0068869_100000828 | 3300005334 | Bacteria | 17665 |
| 19 | Ga0068869_100081419 | 3300005334 | Bacteria | 2418 |
| 20 | Ga0070680_100003378 | 3300005336 | Bacteria | 11902 |
| 21 | Ga0070682_100000864 | 3300005337 | Bacteria | 17707 |
| 22 | Ga0068868_100083097 | 3300005338 | Bacteria | 2570 |
| 23 | Ga0070689_100003551 | 3300005340 | Bacteria | 10378 |
| 24 | Ga0070689_100341036 | 3300005340 | Bacteria | 1255 |
| 25 | Ga0070691_10012913 | 3300005341 | Bacteria | 3824 |
| 26 | Ga0070668_100010068 | 3300005347 | Bacteria | 7008 |
| 27 | Ga0070668_100083468 | 3300005347 | Bacteria | 2508 |
| 28 | Ga0070675_100026355 | 3300005354 | Bacteria | 4665 |
| 29 | Ga0070671_100066202 | 3300005355 | Bacteria | 3011 |
| 30 | Ga0070673_100051942 | 3300005364 | Bacteria | 3214 |
| 31 | Ga0070688_100021870 | 3300005365 | Bacteria | 3740 |
| 32 | Ga0070667_100003401 | 3300005367 | Bacteria | 13547 |
| 33 | Ga0070705_100037992 | 3300005440 | Bacteria | 2720 |
| 34 | Ga0070708_100227277 | 3300005445 | Bacteria | 1751 |
| 35 | Ga0070663_100023166 | 3300005455 | Bacteria | 4159 |
| 36 | Ga0070681_10033739 | 3300005458 | Bacteria | 5138 |
| 37 | Ga0070681_10102566 | 3300005458 | Bacteria | 2806 |
| 38 | Ga0068867_100014689 | 3300005459 | Bacteria | 5549 |
| 39 | Ga0070685_10014536 | 3300005466 | Bacteria | 4172 |
| 40 | Ga0070706_100108416 | 3300005467 | Bacteria | 2584 |
| 41 | Ga0070679_100001027 | 3300005530 | Bacteria | 24330 |
| 42 | Ga0070684_100166534 | 3300005535 | Bacteria | 2001 |
| 43 | Ga0068853_100006463 | 3300005539 | Bacteria | 9317 |
| 44 | Ga0068853_100463672 | 3300005539 | Bacteria | 1193 |
| 45 | Ga0070672_100100156 | 3300005543 | Bacteria | 2349 |
| 46 | Ga0070695_100254714 | 3300005545 | Bacteria | 1279 |
| 47 | Ga0070696_100191158 | 3300005546 | Bacteria | 1524 |
| 48 | Ga0070693_100028697 | 3300005547 | Bacteria | 3027 |
| 49 | Ga0070693_100065193 | 3300005547 | Bacteria | 2128 |
| 50 | Ga0070704_100012830 | 3300005549 | Bacteria | 5182 |
| 51 | Ga0068855_100002037 | 3300005563 | Bacteria | 25057 |
| 52 | Ga0068855_100003021 | 3300005563 | Bacteria | 20582 |
| 53 | Ga0068855_100011886 | 3300005563 | Bacteria | 10526 |
| 54 | Ga0068855_100061967 | 3300005563 | Bacteria | 4368 |
| 55 | Ga0068855_100208351 | 3300005563 | Bacteria | 2198 |
| 56 | Ga0068857_100004157 | 3300005577 | Bacteria | 12195 |
| 57 | Ga0068857_100031896 | 3300005577 | Bacteria | 4656 |
| 58 | Ga0068854_100014084 | 3300005578 | Bacteria | 5264 |
| 59 | Ga0068854_100197565 | 3300005578 | Bacteria | 1579 |
| 60 | Ga0068856_100005784 | 3300005614 | Bacteria | 12184 |
| 61 | Ga0068856_100046411 | 3300005614 | Unclassified | 4279 |
| 62 | Ga0068856_100046997 | 3300005614 | Bacteria | 4252 |
| 63 | Ga0068852_100233934 | 3300005616 | Bacteria | 1753 |
| 64 | Ga0068859_100005800 | 3300005617 | Bacteria | 12542 |
| 65 | Ga0068864_100000695 | 3300005618 | Bacteria | 28204 |
| 66 | Ga0068866_10017704 | 3300005718 | Bacteria | 3208 |
| 67 | Ga0068870_10083948 | 3300005840 | Bacteria | 1767 |
| 68 | Ga0068863_100005718 | 3300005841 | Bacteria | 12205 |
| 69 | Ga0068858_100001295 | 3300005842 | Bacteria | 25828 |
| 70 | Ga0068858_100338842 | 3300005842 | Unclassified | 1439 |
| 71 | Ga0068860_100002930 | 3300005843 | Bacteria | 17673 |
| 72 | Ga0068862_100001083 | 3300005844 | Bacteria | 25976 |
| 73 | Ga0068862_100317451 | 3300005844 | Unclassified | 1437 |
| 74 | Ga0097621_100014425 | 3300006237 | Bacteria | 5912 |
| 75 | Ga0097621_100071301 | 3300006237 | Bacteria | 2871 |
| 76 | Ga0068865_100089181 | 3300006881 | Bacteria | 2233 |
| 77 | Ga0097620_100005800 | 3300006931 | Bacteria | 12542 |
| 78 | Ga0075435_100371908 | 3300007076 | Bacteria | 1227 |
| 79 | Ga0099794_10000172 | 3300007265 | Bacteria | 23609 |
| 80 | Ga0105244_10041521 | 3300009036 | Bacteria | 2383 |
| 81 | Ga0105240_10006602 | 3300009093 | Bacteria | 17029 |
| 82 | Ga0105240_10040184 | 3300009093 | Bacteria | 5987 |
| 83 | Ga0111539_10006025 | 3300009094 | Bacteria | 15664 |
| 84 | Ga0105245_10142173 | 3300009098 | Bacteria | 2261 |
| 85 | Ga0105245_10617278 | 3300009098 | Bacteria | 1112 |
| 86 | Ga0105241_10000280 | 3300009174 | Bacteria | 38076 |
| 87 | Ga0105241_10048136 | 3300009174 | Bacteria | 3243 |
| 88 | Ga0105242_10061607 | 3300009176 | Bacteria | 3086 |
| 89 | Ga0105242_10181018 | 3300009176 | Bacteria | 1859 |
| 90 | Ga0105248_10021195 | 3300009177 | Bacteria | 7200 |
| 91 | Ga0105248_10053492 | 3300009177 | Bacteria | 4530 |
| 92 | Ga0105237_10013770 | 3300009545 | Bacteria | 8470 |
| 93 | Ga0105238_10172469 | 3300009551 | Unclassified | 2139 |
| 94 | Ga0105239_10039742 | 3300010375 | Bacteria | 5154 |
| 95 | Ga0105239_10423910 | 3300010375 | Bacteria | 1508 |
| 96 | Ga0105246_10015636 | 3300011119 | Bacteria | 4794 |
| 97 | Ga0157373_10001045 | 3300013100 | Bacteria | 21327 |
| 98 | Ga0157371_10001240 | 3300013102 | Bacteria | 27027 |
| 99 | Ga0157371_10022167 | 3300013102 | Bacteria | 4658 |
| 100 | Ga0157370_10001574 | 3300013104 | Bacteria | 28236 |
| 101 | Ga0157370_10030656 | 3300013104 | Bacteria | 5268 |
| 102 | Ga0157369_10003013 | 3300013105 | Bacteria | 20145 |
| 103 | Ga0157369_10016819 | 3300013105 | Bacteria | 8220 |
| 104 | Ga0157369_10203135 | 3300013105 | Bacteria | 2079 |
| 105 | Ga0157374_10000762 | 3300013296 | Bacteria | 28119 |
| 106 | Ga0157378_10036853 | 3300013297 | Bacteria | 4329 |
| 107 | Ga0157372_10000010 | 3300013307 | Bacteria | 300658 |
| 108 | Ga0157372_10010571 | 3300013307 | Bacteria | 9817 |
| 109 | Ga0157372_10163913 | 3300013307 | Bacteria | 2570 |
| 110 | Ga0157375_10032036 | 3300013308 | Bacteria | 4981 |
| 111 | Ga0163163_10054101 | 3300014325 | Bacteria | 3965 |
| 112 | Ga0157380_10516334 | 3300014326 | Bacteria | 1164 |
| 113 | Ga0182008_10000996 | 3300014497 | Bacteria | 19695 |
| 114 | Ga0157379_10000401 | 3300014968 | Bacteria | 35047 |
| 115 | Ga0157376_10019424 | 3300014969 | Bacteria | 5238 |
| 116 | Ga0157376_10095494 | 3300014969 | Bacteria | 2585 |
| 117 | Ga0157376_10128255 | 3300014969 | Bacteria | 2259 |
| 118 | Ga0157376_10227521 | 3300014969 | Bacteria | 1731 |
| 119 | Ga0182006_1000006 | 3300015261 | Bacteria | 555811 |
| 120 | Ga0182007_10000187 | 3300015262 | Bacteria | 41581 |
| 121 | Ga0182005_1000001 | 3300015265 | Bacteria | 1014869 |
| 122 | Ga0163161_10000238 | 3300017792 | Bacteria | 50049 |
| 123 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 124 | Ga0209563_100086 | 3300025230 | Bacteria | 182199 |
| 125 | Ga0209258_100228 | 3300025242 | Bacteria | 105712 |
| 126 | Ga0209258_100872 | 3300025242 | Bacteria | 15897 |
| 127 | Ga0209646_1000067 | 3300025246 | Bacteria | 241595 |
| 128 | Ga0209026_1000033 | 3300025250 | Bacteria | 318512 |
| 129 | Ga0209677_100165 | 3300025253 | Bacteria | 57730 |
| 130 | Ga0209677_101647 | 3300025253 | Bacteria | 9396 |
| 131 | Ga0209148_1000204 | 3300025254 | Bacteria | 105778 |
| 132 | Ga0209759_1000024 | 3300025256 | Bacteria | 318512 |
| 133 | Ga0209050_1002010 | 3300025298 | Bacteria | 18995 |
| 134 | Ga0209257_1001540 | 3300025304 | Bacteria | 26823 |
| 135 | Ga0207697_10091595 | 3300025315 | Bacteria | 1288 |
| 136 | Ga0207642_10020690 | 3300025899 | Bacteria | 2575 |
| 137 | Ga0207688_10029736 | 3300025901 | Bacteria | 3009 |
| 138 | Ga0207645_10004674 | 3300025907 | Bacteria | 10081 |
| 139 | Ga0207645_10126192 | 3300025907 | Bacteria | 1663 |
| 140 | Ga0207654_10000120 | 3300025911 | Bacteria | 50396 |
| 141 | Ga0207654_10145246 | 3300025911 | Bacteria | 1517 |
| 142 | Ga0207707_10000631 | 3300025912 | Bacteria | 34920 |
| 143 | Ga0207695_10005325 | 3300025913 | Bacteria | 17124 |
| 144 | Ga0207695_10011891 | 3300025913 | Bacteria | 10490 |
| 145 | Ga0207671_10058914 | 3300025914 | Bacteria | 2847 |
| 146 | Ga0207660_10002006 | 3300025917 | Bacteria | 13540 |
| 147 | Ga0207652_10000699 | 3300025921 | Bacteria | 32535 |
| 148 | Ga0207650_10024703 | 3300025925 | Bacteria | 4274 |
| 149 | Ga0207650_10133006 | 3300025925 | Bacteria | 1948 |
| 150 | Ga0207650_10266918 | 3300025925 | Bacteria | 1390 |
| 151 | Ga0207659_10002358 | 3300025926 | Bacteria | 11254 |
| 152 | Ga0207687_10105974 | 3300025927 | Bacteria | 2077 |
| 153 | Ga0207644_10031388 | 3300025931 | Bacteria | 3701 |
| 154 | Ga0207686_10027531 | 3300025934 | Bacteria | 3330 |
| 155 | Ga0207670_10046982 | 3300025936 | Bacteria | 2871 |
| 156 | Ga0207691_10012693 | 3300025940 | Bacteria | 8069 |
| 157 | Ga0207711_10019520 | 3300025941 | Bacteria | 5642 |
| 158 | Ga0207689_10000171 | 3300025942 | Bacteria | 56716 |
| 159 | Ga0207661_10057787 | 3300025944 | Bacteria | 3121 |
| 160 | Ga0207679_10268174 | 3300025945 | Bacteria | 1459 |
| 161 | Ga0207667_10002644 | 3300025949 | Bacteria | 22147 |
| 162 | Ga0207667_10004632 | 3300025949 | Bacteria | 16870 |
| 163 | Ga0207667_10039993 | 3300025949 | Bacteria | 4993 |
| 164 | Ga0207667_10222418 | 3300025949 | Bacteria | 1934 |
| 165 | Ga0207651_10068489 | 3300025960 | Bacteria | 2502 |
| 166 | Ga0207651_10254676 | 3300025960 | Bacteria | 1438 |
| 167 | Ga0207640_10007530 | 3300025981 | Bacteria | 6013 |
| 168 | Ga0207658_10011591 | 3300025986 | Bacteria | 6001 |
| 169 | Ga0207677_10031083 | 3300026023 | Bacteria | 3417 |
| 170 | Ga0207703_10000464 | 3300026035 | Bacteria | 42704 |
| 171 | Ga0207639_10030552 | 3300026041 | Bacteria | 3951 |
| 172 | Ga0207639_10159207 | 3300026041 | Bacteria | 1901 |
| 173 | Ga0207702_10000145 | 3300026078 | Bacteria | 83991 |
| 174 | Ga0207702_10027373 | 3300026078 | Unclassified | 4734 |
| 175 | Ga0207702_10092490 | 3300026078 | Bacteria | 2650 |
| 176 | Ga0207641_10017859 | 3300026088 | Bacteria | 5811 |
| 177 | Ga0207648_10023108 | 3300026089 | Bacteria | 5577 |
| 178 | Ga0207676_10002704 | 3300026095 | Bacteria | 12617 |
| 179 | Ga0207674_10026370 | 3300026116 | Bacteria | 6174 |
| 180 | Ga0207675_100070141 | 3300026118 | Bacteria | 3276 |
| 181 | Ga0207675_100083510 | 3300026118 | Bacteria | 2996 |
| 182 | Ga0207698_10025547 | 3300026142 | Bacteria | 4163 |
| 183 | Ga0207428_10072811 | 3300027907 | Bacteria | 2696 |
| 184 | Ga0268265_10002333 | 3300028380 | Bacteria | 14411 |
| 185 | Ga0268264_10002323 | 3300028381 | Bacteria | 16821 |
| 186 | Ga0307405_10002861 | 3300031731 | Bacteria | 7760 |
| 187 | Ga0307414_10044600 | 3300032004 | Bacteria | 3030 |
| 188 | Ga0373934_0095271 | 3300035086 | Bacteria | 1202 |
| 189 | Ga0373936_0014170 | 3300035113 | Bacteria | 3046 |
| 190 | Ga0373954_0000398 | 3300035118 | Bacteria | 16290 |
| 191 | Ga0373954_0135660 | 3300035118 | Bacteria | 1199 |
| 192 | Ga0373956_0144029 | 3300035119 | Bacteria | 1120 |
| 193 | Ga0373924_0010709 | 3300035410 | Bacteria | 3392 |
| 194 | Ga0373935_0029319 | 3300035692 | Bacteria | 3405 |
| 195 | Ga0373933_0014565 | 3300035724 | Bacteria | 4375 |
| 196 | Ga0373947_0107259 | 3300035725 | Bacteria | 1761 |
| 197 | Ga0373937_0009756 | 3300036401 | Bacteria | 8370 |
| 198 | Ga0395899_0000405 | 3300037312 | Bacteria | 50426 |
| 199 | Ga0395899_0202375 | 3300037312 | Bacteria | 1384 |
| 200 | Ga0395900_0034860 | 3300037418 | Bacteria | 5185 |
| 201 | Ga0395898_0006091 | 3300037466 | Bacteria | 12942 |
| 202 | Ga0395905_0076931 | 3300037471 | Bacteria | 3127 |
| 203 | Ga0395901_0002606 | 3300038443 | Bacteria | 18256 |
| 204 | Ga0451853_0873336 | 3300041512 | Bacteria | 1122 |
| 205 | Ga0451577_0002857 | 3300042876 | Bacteria | 19857 |
| 206 | Ga0466966_0013271 | 3300044684 | Bacteria | 5455 |
| 207 | Ga0453684_0002387 | 3300044712 | Bacteria | 45815 |
| 208 | Ga0453684_0004185 | 3300044712 | Bacteria | 31074 |
| 209 | Ga0453684_0132327 | 3300044712 | Bacteria | 2991 |
| 210 | Ga0453684_0154273 | 3300044712 | Bacteria | 2725 |
| 211 | Ga0466960_0062215 | 3300044901 | Bacteria | 1834 |
| 212 | Ga0466959_0015601 | 3300045049 | Bacteria | 5539 |
| 213 | Ga0451576_0441217 | 3300045051 | Bacteria | 1366 |
| 214 | Ga0451576_0635715 | 3300045051 | Bacteria | 1121 |
| 215 | Ga0466958_0011920 | 3300045836 | Bacteria | 4910 |
| 216 | Ga0495629_0098103 | 3300046459 | Bacteria | 2044 |
| 217 | Ga0495638_0000030 | 3300046460 | Bacteria | 318183 |
| 218 | Ga0495653_0228046 | 3300046463 | Bacteria | 1248 |
| 219 | Ga0495580_0019317 | 3300046472 | Bacteria | 5063 |
| 220 | Ga0495580_0112523 | 3300046472 | Bacteria | 1890 |
| 221 | Ga0495582_0072297 | 3300046473 | Bacteria | 1908 |
| 222 | Ga0495662_0117795 | 3300046476 | Bacteria | 1303 |
| 223 | Ga0495662_0142679 | 3300046476 | Bacteria | 1179 |
| 224 | Ga0495664_0203919 | 3300046477 | Bacteria | 1198 |
| 225 | Ga0495583_0000073 | 3300046506 | Bacteria | 178177 |
| 226 | Ga0495630_0000096 | 3300046517 | Bacteria | 68453 |
| 227 | Ga0495666_0048029 | 3300046526 | Bacteria | 2056 |
| 228 | Ga0495652_0009830 | 3300046529 | Bacteria | 8671 |
| 229 | Ga0495665_0037006 | 3300046531 | Unclassified | 2605 |
| 230 | Ga0495586_0000043 | 3300046535 | Bacteria | 74540 |
| 231 | Ga0495587_0001319 | 3300046536 | Bacteria | 16480 |
| 232 | Ga0495609_0045897 | 3300046538 | Bacteria | 1957 |
| 233 | Ga0495633_0000684 | 3300046558 | Bacteria | 31187 |
| 234 | Ga0495667_0207453 | 3300046559 | Bacteria | 1253 |
| 235 | Ga0495634_0010635 | 3300046642 | Bacteria | 6736 |
| 236 | Ga0495635_0101380 | 3300046663 | Bacteria | 1967 |
| 237 | Ga0495658_0036455 | 3300046683 | Bacteria | 2713 |
| 238 | Ga0495658_0189648 | 3300046683 | Bacteria | 1277 |
| 239 | Ga0495613_0084392 | 3300046689 | Unclassified | 2306 |
| 240 | Ga0495624_0052749 | 3300046690 | Unclassified | 2569 |
| 241 | Ga0495649_0001355 | 3300046694 | Bacteria | 18642 |
| 242 | Ga0495674_0007245 | 3300047319 | Bacteria | 10616 |
| 243 | Ga0495676_0059670 | 3300047321 | Bacteria | 2994 |
| 244 | Ga0495675_0108499 | 3300047444 | Bacteria | 1734 |
| 245 | Ga0495684_0032481 | 3300047471 | Unclassified | 4008 |
| 246 | Ga0496101_0017090 | 3300048904 | Bacteria | 4914 |
| 247 | Ga0496103_0114288 | 3300048906 | Bacteria | 1716 |
| 248 | Ga0496108_0101763 | 3300048911 | Bacteria | 2451 |
| 249 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 250 | Ga0496118_0000002 | 3300048921 | Bacteria | 1690764 |
| 251 | Ga0496121_0002029 | 3300048924 | Bacteria | 32075 |
| 252 | Ga0496121_0015072 | 3300048924 | Bacteria | 8134 |
| 253 | Ga0496121_0226372 | 3300048924 | Bacteria | 1313 |
| 254 | Ga0496122_0002570 | 3300048925 | Bacteria | 25500 |
| 255 | Ga0495682_0015082 | 3300049460 | Bacteria | 2929 |
| 256 | Ga0501315_001237 | 3300049531 | Bacteria | 2123 |
| 257 | Ga0501033_0042482 | 3300049570 | Bacteria | 3389 |
| 258 | Ga0501037_0060659 | 3300049573 | Bacteria | 2759 |
| 259 | Ga0501046_0000334 | 3300049580 | Bacteria | 47461 |
| 260 | Ga0501046_0105772 | 3300049580 | Bacteria | 2155 |
| 261 | Ga0501047_0021105 | 3300049581 | Bacteria | 6253 |
| 262 | Ga0501073_0055041 | 3300049589 | Bacteria | 2784 |
| 263 | Ga0501080_0113370 | 3300049742 | Bacteria | 2513 |
| 264 | Ga0501080_0194858 | 3300049742 | Bacteria | 1861 |
| 265 | Ga0501241_002146 | 3300049758 | Bacteria | 3851 |
| 266 | Ga0501035_0016955 | 3300049822 | Bacteria | 6714 |
| 267 | Ga0501044_0001498 | 3300049823 | Bacteria | 27366 |
| 268 | Ga0501044_0074208 | 3300049823 | Bacteria | 3457 |
| 269 | nmdc:mga08y16_39652_c1 | 3300050511 | Bacteria | 4941 |
| 270 | nmdc:mga0rr50_358375_c1 | 3300050513 | Bacteria | 1227 |
| 271 | Ga0495619_0037903 | 3300053085 | Unclassified | 3144 |
| 272 | Ga0500618_002376 | 3300053125 | Bacteria | 7180 |
| 273 | Ga0501084_0033198 | 3300054114 | Bacteria | 4317 |
| 274 | Ga0501082_0170468 | 3300060353 | Bacteria | 1892 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035119 | Ga0373956_0144029 | Ga0373956_0144029_194_1075 | 288 |
| 2 | 3300046559 | Ga0495667_0207453 | Ga0495667_0207453_34_915 | 288 |
| 3 | 3300035725 | Ga0373947_0107259 | Ga0373947_0107259_807_1748 | 296 |
| 4 | 3300048904 | Ga0496101_0017090 | Ga0496101_0017090_3951_4871 | 296 |
| 5 | 3300037471 | Ga0395905_0076931 | Ga0395905_0076931_1923_2924 | 304 |
| 6 | iso_pu_bacteria | 2739367866 | 2740032199 | 315 |
| 7 | iso_pu_bacteria | 2910245624 | 2910250878 | 315 |
| 8 | 3300037418 | Ga0395900_0034860 | Ga0395900_0034860_185_1183 | 317 |
| 9 | 3300014497 | Ga0182008_10000996 | Ga0182008_1000099614 | 318 |
| 10 | 3300017792 | Ga0163161_10000238 | Ga0163161_1000023841 | 318 |
| 11 | 3300035118 | Ga0373954_0135660 | Ga0373954_0135660_136_1158 | 318 |
| 12 | 3300046463 | Ga0495653_0228046 | Ga0495653_0228046_202_1224 | 318 |
| 13 | 3300046683 | Ga0495658_0189648 | Ga0495658_0189648_212_1234 | 318 |
| 14 | 3300049758 | Ga0501241_002146 | Ga0501241_002146_676_1662 | 318 |
| 15 | 3300014969 | Ga0157376_10019424 | Ga0157376_100194244 | 319 |
| 16 | 3300025298 | Ga0209050_1002010 | Ga0209050_10020104 | 319 |
| 17 | 3300025304 | Ga0209257_1001540 | Ga0209257_10015407 | 319 |
| 18 | 3300053125 | Ga0500618_002376 | Ga0500618_002376_5111_6118 | 319 |
| 19 | 3300003322 | rootL2_10035342 | rootL2_1003534215 | 320 |
| 20 | 3300005614 | Ga0068856_100046411 | Ga0068856_1000464113 | 320 |
| 21 | 3300013100 | Ga0157373_10001045 | Ga0157373_1000104518 | 320 |
| 22 | 3300026078 | Ga0207702_10027373 | Ga0207702_100273732 | 320 |
| 23 | 3300046538 | Ga0495609_0045897 | Ga0495609_0045897_604_1593 | 320 |
| 24 | 3300013307 | Ga0157372_10010571 | Ga0157372_100105713 | 323 |
| 25 | 3300005355 | Ga0070671_100066202 | Ga0070671_1000662024 | 325 |
| 26 | 3300005546 | Ga0070696_100191158 | Ga0070696_1001911582 | 325 |
| 27 | 3300005547 | Ga0070693_100028697 | Ga0070693_1000286973 | 325 |
| 28 | 3300006237 | Ga0097621_100014425 | Ga0097621_1000144252 | 325 |
| 29 | 3300007076 | Ga0075435_100371908 | Ga0075435_1003719081 | 325 |
| 30 | 3300014969 | Ga0157376_10095494 | Ga0157376_100954942 | 325 |
| 31 | 3300025931 | Ga0207644_10031388 | Ga0207644_100313884 | 325 |
| 32 | 3300025936 | Ga0207670_10046982 | Ga0207670_100469822 | 325 |
| 33 | 3300050513 | nmdc:mga0rr50_358375_c1 | nmdc:mga0rr50_358375_c1_74_1129 | 325 |
| 34 | 3300005328 | Ga0070676_10074808 | Ga0070676_100748082 | 326 |
| 35 | 3300005340 | Ga0070689_100003551 | Ga0070689_1000035512 | 326 |
| 36 | 3300005354 | Ga0070675_100026355 | Ga0070675_1000263551 | 326 |
| 37 | 3300005365 | Ga0070688_100021870 | Ga0070688_1000218703 | 326 |
| 38 | 3300005455 | Ga0070663_100023166 | Ga0070663_1000231664 | 326 |
| 39 | 3300005466 | Ga0070685_10014536 | Ga0070685_100145363 | 326 |
| 40 | 3300005543 | Ga0070672_100100156 | Ga0070672_1001001561 | 326 |
| 41 | 3300005616 | Ga0068852_100233934 | Ga0068852_1002339342 | 326 |
| 42 | 3300005840 | Ga0068870_10083948 | Ga0068870_100839482 | 326 |
| 43 | 3300025315 | Ga0207697_10091595 | Ga0207697_100915951 | 326 |
| 44 | 3300025901 | Ga0207688_10029736 | Ga0207688_100297362 | 326 |
| 45 | 3300025907 | Ga0207645_10126192 | Ga0207645_101261922 | 326 |
| 46 | 3300025925 | Ga0207650_10266918 | Ga0207650_102669182 | 326 |
| 47 | 3300025926 | Ga0207659_10002358 | Ga0207659_100023582 | 326 |
| 48 | 3300025940 | Ga0207691_10012693 | Ga0207691_100126932 | 326 |
| 49 | 3300025945 | Ga0207679_10268174 | Ga0207679_102681742 | 326 |
| 50 | 3300025960 | Ga0207651_10254676 | Ga0207651_102546762 | 326 |
| 51 | 3300041512 | Ga0451853_0873336 | Ga0451853_0873336_57_1091 | 326 |
| 52 | 3300003761 | Ga0055535_1004183 | Ga0055535_10041833 | 327 |
| 53 | 3300003762 | Ga0055542_1004832 | Ga0055542_10048321 | 327 |
| 54 | 3300005336 | Ga0070680_100003378 | Ga0070680_1000033788 | 327 |
| 55 | 3300005337 | Ga0070682_100000864 | Ga0070682_1000008643 | 327 |
| 56 | 3300005341 | Ga0070691_10012913 | Ga0070691_100129134 | 327 |
| 57 | 3300005458 | Ga0070681_10033739 | Ga0070681_100337394 | 327 |
| 58 | 3300005530 | Ga0070679_100001027 | Ga0070679_10000102719 | 327 |
| 59 | 3300005539 | Ga0068853_100006463 | Ga0068853_1000064635 | 327 |
| 60 | 3300005547 | Ga0070693_100065193 | Ga0070693_1000651932 | 327 |
| 61 | 3300005563 | Ga0068855_100011886 | Ga0068855_1000118866 | 327 |
| 62 | 3300009093 | Ga0105240_10006602 | Ga0105240_100066028 | 327 |
| 63 | 3300009174 | Ga0105241_10000280 | Ga0105241_100002807 | 327 |
| 64 | 3300013102 | Ga0157371_10022167 | Ga0157371_100221675 | 327 |
| 65 | 3300013104 | Ga0157370_10001574 | Ga0157370_100015747 | 327 |
| 66 | 3300013307 | Ga0157372_10163913 | Ga0157372_101639132 | 327 |
| 67 | 3300014969 | Ga0157376_10128255 | Ga0157376_101282553 | 327 |
| 68 | 3300025242 | Ga0209258_100228 | Ga0209258_10022847 | 327 |
| 69 | 3300025254 | Ga0209148_1000204 | Ga0209148_100020445 | 327 |
| 70 | 3300025911 | Ga0207654_10000120 | Ga0207654_1000012025 | 327 |
| 71 | 3300025912 | Ga0207707_10000631 | Ga0207707_100006318 | 327 |
| 72 | 3300025913 | Ga0207695_10011891 | Ga0207695_100118917 | 327 |
| 73 | 3300025917 | Ga0207660_10002006 | Ga0207660_100020069 | 327 |
| 74 | 3300025921 | Ga0207652_10000699 | Ga0207652_100006999 | 327 |
| 75 | 3300025949 | Ga0207667_10039993 | Ga0207667_100399934 | 327 |
| 76 | 3300026041 | Ga0207639_10030552 | Ga0207639_100305524 | 327 |
| 77 | 3300035086 | Ga0373934_0095271 | Ga0373934_0095271_11_1018 | 327 |
| 78 | 3300044712 | Ga0453684_0004185 | Ga0453684_0004185_8174_9178 | 327 |
| 79 | 3300046459 | Ga0495629_0098103 | Ga0495629_0098103_505_1512 | 327 |
| 80 | 3300046472 | Ga0495580_0019317 | Ga0495580_0019317_624_1631 | 327 |
| 81 | 3300046476 | Ga0495662_0117795 | Ga0495662_0117795_156_1163 | 327 |
| 82 | 3300046477 | Ga0495664_0203919 | Ga0495664_0203919_181_1188 | 327 |
| 83 | 3300046531 | Ga0495665_0037006 | Ga0495665_0037006_1446_2453 | 327 |
| 84 | 3300046663 | Ga0495635_0101380 | Ga0495635_0101380_178_1185 | 327 |
| 85 | 3300046683 | Ga0495658_0036455 | Ga0495658_0036455_884_1891 | 327 |
| 86 | 3300046689 | Ga0495613_0084392 | Ga0495613_0084392_937_1944 | 327 |
| 87 | 3300046690 | Ga0495624_0052749 | Ga0495624_0052749_213_1220 | 327 |
| 88 | 3300047471 | Ga0495684_0032481 | Ga0495684_0032481_151_1158 | 327 |
| 89 | 3300049589 | Ga0501073_0055041 | Ga0501073_0055041_580_1602 | 327 |
| 90 | 3300049742 | Ga0501080_0194858 | Ga0501080_0194858_705_1727 | 327 |
| 91 | 3300049823 | Ga0501044_0074208 | Ga0501044_0074208_1610_2632 | 327 |
| 92 | 3300053085 | Ga0495619_0037903 | Ga0495619_0037903_170_1177 | 327 |
| 93 | 3300054114 | Ga0501084_0033198 | Ga0501084_0033198_3227_4249 | 327 |
| 94 | 3300060353 | Ga0501082_0170468 | Ga0501082_0170468_696_1718 | 327 |
| 95 | 3300045051 | Ga0451576_0441217 | Ga0451576_0441217_26_1147 | 329 |
| 96 | 3300013102 | Ga0157371_10001240 | Ga0157371_100012402 | 330 |
| 97 | 3300013104 | Ga0157370_10030656 | Ga0157370_100306562 | 330 |
| 98 | 3300013105 | Ga0157369_10003013 | Ga0157369_1000301314 | 330 |
| 99 | 3300013307 | Ga0157372_10000010 | Ga0157372_10000010146 | 330 |
| 100 | 3300037312 | Ga0395899_0000405 | Ga0395899_0000405_21220_22257 | 330 |
| 101 | 3300044684 | Ga0466966_0013271 | Ga0466966_0013271_53_1090 | 330 |
| 102 | 3300045049 | Ga0466959_0015601 | Ga0466959_0015601_3385_4422 | 330 |
| 103 | 3300045836 | Ga0466958_0011920 | Ga0466958_0011920_1522_2559 | 330 |
| 104 | iso_pu_bacteria | 2896429255 | 2896430138 | 330 |
| 105 | 3300049580 | Ga0501046_0105772 | Ga0501046_0105772_211_1335 | 332 |
| 106 | iso_pu_bacteria | 3007866637 | 3007870309 | 332 |
| 107 | 3300005844 | Ga0068862_100317451 | Ga0068862_1003174512 | 333 |
| 108 | 3300026142 | Ga0207698_10025547 | Ga0207698_100255473 | 333 |
| 109 | 3300007265 | Ga0099794_10000172 | Ga0099794_100001727 | 334 |
| 110 | 3300005549 | Ga0070704_100012830 | Ga0070704_1000128303 | 335 |
| 111 | 3300013105 | Ga0157369_10203135 | Ga0157369_102031352 | 335 |
| 112 | 3300025925 | Ga0207650_10133006 | Ga0207650_101330062 | 335 |
| 113 | 3300046529 | Ga0495652_0009830 | Ga0495652_0009830_6793_7812 | 335 |
| 114 | 3300005563 | Ga0068855_100002037 | Ga0068855_1000020373 | 336 |
| 115 | 3300005614 | Ga0068856_100046997 | Ga0068856_1000469973 | 336 |
| 116 | 3300014326 | Ga0157380_10516334 | Ga0157380_105163341 | 336 |
| 117 | 3300025949 | Ga0207667_10002644 | Ga0207667_100026443 | 336 |
| 118 | 3300026078 | Ga0207702_10092490 | Ga0207702_100924903 | 336 |
| 119 | 3300031731 | Ga0307405_10002861 | Ga0307405_100028615 | 336 |
| 120 | 3300032004 | Ga0307414_10044600 | Ga0307414_100446003 | 336 |
| 121 | 3300046536 | Ga0495587_0001319 | Ga0495587_0001319_9393_10439 | 336 |
| 122 | 3300005458 | Ga0070681_10102566 | Ga0070681_101025662 | 337 |
| 123 | 3300005535 | Ga0070684_100166534 | Ga0070684_1001665342 | 337 |
| 124 | 3300005563 | Ga0068855_100003021 | Ga0068855_1000030219 | 337 |
| 125 | 3300005563 | Ga0068855_100061967 | Ga0068855_1000619673 | 337 |
| 126 | 3300006237 | Ga0097621_100071301 | Ga0097621_1000713014 | 337 |
| 127 | 3300009094 | Ga0111539_10006025 | Ga0111539_100060253 | 337 |
| 128 | 3300009098 | Ga0105245_10142173 | Ga0105245_101421732 | 337 |
| 129 | 3300009176 | Ga0105242_10181018 | Ga0105242_101810182 | 337 |
| 130 | 3300009177 | Ga0105248_10053492 | Ga0105248_100534922 | 337 |
| 131 | 3300009551 | Ga0105238_10172469 | Ga0105238_101724692 | 337 |
| 132 | 3300014969 | Ga0157376_10227521 | Ga0157376_102275211 | 337 |
| 133 | 3300025927 | Ga0207687_10105974 | Ga0207687_101059741 | 337 |
| 134 | 3300026118 | Ga0207675_100070141 | Ga0207675_1000701413 | 337 |
| 135 | 3300027907 | Ga0207428_10072811 | Ga0207428_100728112 | 337 |
| 136 | 3300035118 | Ga0373954_0000398 | Ga0373954_0000398_9808_10866 | 337 |
| 137 | 3300035410 | Ga0373924_0010709 | Ga0373924_0010709_1602_2660 | 337 |
| 138 | 3300035724 | Ga0373933_0014565 | Ga0373933_0014565_707_1765 | 337 |
| 139 | 3300036401 | Ga0373937_0009756 | Ga0373937_0009756_2123_3181 | 337 |
| 140 | 3300042876 | Ga0451577_0002857 | Ga0451577_0002857_14362_15390 | 337 |
| 141 | 3300044712 | Ga0453684_0002387 | Ga0453684_0002387_18215_19243 | 337 |
| 142 | 3300046473 | Ga0495582_0072297 | Ga0495582_0072297_510_1538 | 337 |
| 143 | 3300046476 | Ga0495662_0142679 | Ga0495662_0142679_110_1138 | 337 |
| 144 | 3300046517 | Ga0495630_0000096 | Ga0495630_0000096_48998_50026 | 337 |
| 145 | 3300046526 | Ga0495666_0048029 | Ga0495666_0048029_474_1502 | 337 |
| 146 | 3300046535 | Ga0495586_0000043 | Ga0495586_0000043_52073_53101 | 337 |
| 147 | 3300046642 | Ga0495634_0010635 | Ga0495634_0010635_5268_6296 | 337 |
| 148 | 3300046694 | Ga0495649_0001355 | Ga0495649_0001355_3434_4459 | 337 |
| 149 | 3300047319 | Ga0495674_0007245 | Ga0495674_0007245_3103_4131 | 337 |
| 150 | 3300047321 | Ga0495676_0059670 | Ga0495676_0059670_1710_2738 | 337 |
| 151 | 3300047444 | Ga0495675_0108499 | Ga0495675_0108499_372_1430 | 337 |
| 152 | 3300049531 | Ga0501315_001237 | Ga0501315_001237_161_1246 | 337 |
| 153 | 3300049580 | Ga0501046_0000334 | Ga0501046_0000334_23185_24213 | 337 |
| 154 | 3300049742 | Ga0501080_0113370 | Ga0501080_0113370_34_1119 | 337 |
| 155 | 3300050511 | nmdc:mga08y16_39652_c1 | nmdc:mga08y16_39652_c1_690_1727 | 337 |
| 156 | 3300009098 | Ga0105245_10617278 | Ga0105245_106172781 | 338 |
| 157 | iso_pu_bacteria | 2600255292 | 2601668622 | 338 |
| 158 | iso_pu_bacteria | 2857547612 | 2857550853 | 338 |
| 159 | iso_pu_bacteria | 2932410948 | 2932414175 | 338 |
| 160 | iso_pu_bacteria | 2932416698 | 2932416784 | 338 |
| 161 | 3300003323 | rootH1_10035563 | rootH1_100355632 | 339 |
| 162 | 3300003752 | Ga0055539_1000638 | Ga0055539_10006386 | 339 |
| 163 | 3300003756 | Ga0055533_1000061 | Ga0055533_100006155 | 339 |
| 164 | 3300003759 | Ga0055525_1001073 | Ga0055525_10010732 | 339 |
| 165 | 3300025226 | Ga0209674_100003 | Ga0209674_100003109 | 339 |
| 166 | 3300025230 | Ga0209563_100086 | Ga0209563_10008656 | 339 |
| 167 | 3300025253 | Ga0209677_100165 | Ga0209677_1001656 | 339 |
| 168 | iso_pu_bacteria | 2885080285 | 2885082987 | 339 |
| 169 | 3300044901 | Ga0466960_0062215 | Ga0466960_0062215_168_1232 | 340 |
| 170 | 3300003322 | rootL2_10081603 | rootL2_100816032 | 341 |
| 171 | 3300003322 | rootL2_10081604 | rootL2_100816043 | 341 |
| 172 | 3300003323 | rootH1_10324902 | rootH1_103249022 | 341 |
| 173 | 3300005445 | Ga0070708_100227277 | Ga0070708_1002272771 | 341 |
| 174 | 3300015261 | Ga0182006_1000006 | Ga0182006_1000006264 | 341 |
| 175 | 3300015262 | Ga0182007_10000187 | Ga0182007_1000018731 | 341 |
| 176 | 3300015265 | Ga0182005_1000001 | Ga0182005_1000001513 | 341 |
| 177 | 3300046460 | Ga0495638_0000030 | Ga0495638_0000030_263746_264819 | 341 |
| 178 | 3300048920 | Ga0496117_0000001 | Ga0496117_0000001_408668_409861 | 341 |
| 179 | 3300048921 | Ga0496118_0000002 | Ga0496118_0000002_408668_409861 | 341 |
| 180 | 3300048924 | Ga0496121_0002029 | Ga0496121_0002029_319_1512 | 341 |
| 181 | 3300048924 | Ga0496121_0015072 | Ga0496121_0015072_5413_6666 | 341 |
| 182 | 3300048924 | Ga0496121_0226372 | Ga0496121_0226372_158_1246 | 341 |
| 183 | 3300048925 | Ga0496122_0002570 | Ga0496122_0002570_23828_24997 | 341 |
| 184 | 3300049570 | Ga0501033_0042482 | Ga0501033_0042482_292_1380 | 341 |
| 185 | 3300049573 | Ga0501037_0060659 | Ga0501037_0060659_1118_2206 | 341 |
| 186 | 3300049581 | Ga0501047_0021105 | Ga0501047_0021105_922_2010 | 341 |
| 187 | 3300049822 | Ga0501035_0016955 | Ga0501035_0016955_698_1786 | 341 |
| 188 | 3300049823 | Ga0501044_0001498 | Ga0501044_0001498_10858_11946 | 341 |
| 189 | 3300005539 | Ga0068853_100463672 | Ga0068853_1004636721 | 342 |
| 190 | 3300005563 | Ga0068855_100208351 | Ga0068855_1002083512 | 342 |
| 191 | 3300025949 | Ga0207667_10004632 | Ga0207667_100046328 | 342 |
| 192 | 3300002705 | JGI25156J39149_1000378 | JGI25156J39149_100037811 | 343 |
| 193 | 3300002738 | JGI25154J39366_1000408 | JGI25154J39366_100040811 | 343 |
| 194 | 3300002741 | JGI25157J39369_1000419 | JGI25157J39369_100041913 | 343 |
| 195 | 3300005328 | Ga0070676_10009913 | Ga0070676_100099135 | 343 |
| 196 | 3300005329 | Ga0070683_100073963 | Ga0070683_1000739632 | 343 |
| 197 | 3300005331 | Ga0070670_100004651 | Ga0070670_1000046512 | 343 |
| 198 | 3300005334 | Ga0068869_100000828 | Ga0068869_1000008287 | 343 |
| 199 | 3300005334 | Ga0068869_100081419 | Ga0068869_1000814192 | 343 |
| 200 | 3300005338 | Ga0068868_100083097 | Ga0068868_1000830972 | 343 |
| 201 | 3300005340 | Ga0070689_100341036 | Ga0070689_1003410362 | 343 |
| 202 | 3300005347 | Ga0070668_100010068 | Ga0070668_1000100682 | 343 |
| 203 | 3300005347 | Ga0070668_100083468 | Ga0070668_1000834682 | 343 |
| 204 | 3300005364 | Ga0070673_100051942 | Ga0070673_1000519422 | 343 |
| 205 | 3300005367 | Ga0070667_100003401 | Ga0070667_1000034013 | 343 |
| 206 | 3300005440 | Ga0070705_100037992 | Ga0070705_1000379922 | 343 |
| 207 | 3300005459 | Ga0068867_100014689 | Ga0068867_1000146893 | 343 |
| 208 | 3300005467 | Ga0070706_100108416 | Ga0070706_1001084162 | 343 |
| 209 | 3300005545 | Ga0070695_100254714 | Ga0070695_1002547141 | 343 |
| 210 | 3300005577 | Ga0068857_100004157 | Ga0068857_1000041576 | 343 |
| 211 | 3300005577 | Ga0068857_100031896 | Ga0068857_1000318963 | 343 |
| 212 | 3300005578 | Ga0068854_100014084 | Ga0068854_1000140845 | 343 |
| 213 | 3300005578 | Ga0068854_100197565 | Ga0068854_1001975652 | 343 |
| 214 | 3300005614 | Ga0068856_100005784 | Ga0068856_1000057845 | 343 |
| 215 | 3300005617 | Ga0068859_100005800 | Ga0068859_1000058004 | 343 |
| 216 | 3300005618 | Ga0068864_100000695 | Ga0068864_10000069516 | 343 |
| 217 | 3300005718 | Ga0068866_10017704 | Ga0068866_100177042 | 343 |
| 218 | 3300005841 | Ga0068863_100005718 | Ga0068863_1000057183 | 343 |
| 219 | 3300005842 | Ga0068858_100001295 | Ga0068858_1000012956 | 343 |
| 220 | 3300005842 | Ga0068858_100338842 | Ga0068858_1003388421 | 343 |
| 221 | 3300005843 | Ga0068860_100002930 | Ga0068860_1000029307 | 343 |
| 222 | 3300005844 | Ga0068862_100001083 | Ga0068862_1000010838 | 343 |
| 223 | 3300006881 | Ga0068865_100089181 | Ga0068865_1000891812 | 343 |
| 224 | 3300006931 | Ga0097620_100005800 | Ga0097620_1000058004 | 343 |
| 225 | 3300009036 | Ga0105244_10041521 | Ga0105244_100415212 | 343 |
| 226 | 3300009093 | Ga0105240_10040184 | Ga0105240_100401843 | 343 |
| 227 | 3300009174 | Ga0105241_10048136 | Ga0105241_100481362 | 343 |
| 228 | 3300009176 | Ga0105242_10061607 | Ga0105242_100616072 | 343 |
| 229 | 3300009177 | Ga0105248_10021195 | Ga0105248_100211952 | 343 |
| 230 | 3300009545 | Ga0105237_10013770 | Ga0105237_100137703 | 343 |
| 231 | 3300010375 | Ga0105239_10039742 | Ga0105239_100397425 | 343 |
| 232 | 3300010375 | Ga0105239_10423910 | Ga0105239_104239102 | 343 |
| 233 | 3300011119 | Ga0105246_10015636 | Ga0105246_100156365 | 343 |
| 234 | 3300013105 | Ga0157369_10016819 | Ga0157369_100168192 | 343 |
| 235 | 3300013296 | Ga0157374_10000762 | Ga0157374_1000076216 | 343 |
| 236 | 3300013297 | Ga0157378_10036853 | Ga0157378_100368533 | 343 |
| 237 | 3300013308 | Ga0157375_10032036 | Ga0157375_100320363 | 343 |
| 238 | 3300014325 | Ga0163163_10054101 | Ga0163163_100541012 | 343 |
| 239 | 3300014968 | Ga0157379_10000401 | Ga0157379_100004018 | 343 |
| 240 | 3300025242 | Ga0209258_100872 | Ga0209258_1008725 | 343 |
| 241 | 3300025246 | Ga0209646_1000067 | Ga0209646_1000067216 | 343 |
| 242 | 3300025250 | Ga0209026_1000033 | Ga0209026_100003313 | 343 |
| 243 | 3300025253 | Ga0209677_101647 | Ga0209677_1016476 | 343 |
| 244 | 3300025256 | Ga0209759_1000024 | Ga0209759_100002413 | 343 |
| 245 | 3300025899 | Ga0207642_10020690 | Ga0207642_100206902 | 343 |
| 246 | 3300025907 | Ga0207645_10004674 | Ga0207645_100046742 | 343 |
| 247 | 3300025911 | Ga0207654_10145246 | Ga0207654_101452462 | 343 |
| 248 | 3300025913 | Ga0207695_10005325 | Ga0207695_100053252 | 343 |
| 249 | 3300025914 | Ga0207671_10058914 | Ga0207671_100589141 | 343 |
| 250 | 3300025925 | Ga0207650_10024703 | Ga0207650_100247032 | 343 |
| 251 | 3300025934 | Ga0207686_10027531 | Ga0207686_100275312 | 343 |
| 252 | 3300025941 | Ga0207711_10019520 | Ga0207711_100195203 | 343 |
| 253 | 3300025942 | Ga0207689_10000171 | Ga0207689_1000017129 | 343 |
| 254 | 3300025944 | Ga0207661_10057787 | Ga0207661_100577872 | 343 |
| 255 | 3300025949 | Ga0207667_10222418 | Ga0207667_102224182 | 343 |
| 256 | 3300025960 | Ga0207651_10068489 | Ga0207651_100684893 | 343 |
| 257 | 3300025981 | Ga0207640_10007530 | Ga0207640_100075305 | 343 |
| 258 | 3300025986 | Ga0207658_10011591 | Ga0207658_100115913 | 343 |
| 259 | 3300026023 | Ga0207677_10031083 | Ga0207677_100310832 | 343 |
| 260 | 3300026035 | Ga0207703_10000464 | Ga0207703_100004648 | 343 |
| 261 | 3300026041 | Ga0207639_10159207 | Ga0207639_101592072 | 343 |
| 262 | 3300026078 | Ga0207702_10000145 | Ga0207702_1000014551 | 343 |
| 263 | 3300026088 | Ga0207641_10017859 | Ga0207641_100178593 | 343 |
| 264 | 3300026089 | Ga0207648_10023108 | Ga0207648_100231083 | 343 |
| 265 | 3300026095 | Ga0207676_10002704 | Ga0207676_100027047 | 343 |
| 266 | 3300026116 | Ga0207674_10026370 | Ga0207674_100263704 | 343 |
| 267 | 3300026118 | Ga0207675_100083510 | Ga0207675_1000835102 | 343 |
| 268 | 3300028380 | Ga0268265_10002333 | Ga0268265_100023335 | 343 |
| 269 | 3300028381 | Ga0268264_10002323 | Ga0268264_100023236 | 343 |
| 270 | 3300035113 | Ga0373936_0014170 | Ga0373936_0014170_176_1288 | 343 |
| 271 | 3300035692 | Ga0373935_0029319 | Ga0373935_0029319_81_1193 | 343 |
| 272 | 3300037312 | Ga0395899_0202375 | Ga0395899_0202375_314_1345 | 343 |
| 273 | 3300037466 | Ga0395898_0006091 | Ga0395898_0006091_2376_3407 | 343 |
| 274 | 3300038443 | Ga0395901_0002606 | Ga0395901_0002606_14059_15090 | 343 |
| 275 | 3300044712 | Ga0453684_0132327 | Ga0453684_0132327_1266_2324 | 343 |
| 276 | 3300044712 | Ga0453684_0154273 | Ga0453684_0154273_67_1221 | 343 |
| 277 | 3300045051 | Ga0451576_0635715 | Ga0451576_0635715_40_1110 | 343 |
| 278 | 3300046472 | Ga0495580_0112523 | Ga0495580_0112523_112_1206 | 343 |
| 279 | 3300046506 | Ga0495583_0000073 | Ga0495583_0000073_105771_106826 | 343 |
| 280 | 3300046558 | Ga0495633_0000684 | Ga0495633_0000684_349_1620 | 343 |
| 281 | 3300048906 | Ga0496103_0114288 | Ga0496103_0114288_541_1638 | 343 |
| 282 | 3300048911 | Ga0496108_0101763 | Ga0496108_0101763_402_1499 | 343 |
| 283 | 3300049460 | Ga0495682_0015082 | Ga0495682_0015082_807_2078 | 343 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ru9-assembly1.cif.gz_A | specific recognition of n-acetylated substrates and domain flexibility in wbgu: a udp-galnac 4-epimerase | 0.9809 | 5 | 343 |
| 1sb8-assembly1.cif.gz_A | crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4-epimerase complexed with udp-n-acetylgalactosamine | 0.9808 | 10 | 343 |
| 3ruc-assembly1.cif.gz_A | specific recognition of n-acetylated substrates and domain flexibility in wbgu: a udp-galnac 4-epimerase | 0.9782 | 7 | 343 |
| 3ru9-assembly1.cif.gz_A | specific recognition of n-acetylated substrates and domain flexibility in wbgu: a udp-galnac 4-epimerase | 0.9607 | 5 | 343 |
| 3ruc-assembly1.cif.gz_A | specific recognition of n-acetylated substrates and domain flexibility in wbgu: a udp-galnac 4-epimerase | 0.9581 | 7 | 343 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ru7A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9738 | 7 | 269 | 3.40.50.720 |
| 6dntA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9549 | 20 | 270 | 3.40.50.720 |
| 3lu1B02 | Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 | 0.9468 | 199 | 343 | 3.90.25.10 |
| 6dntA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9457 | 20 | 270 | 3.40.50.720 |
| af_Q2G289_4_319_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9339 | 22 | 341 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A259D8D1-F1-model_v4 | LPS biosynthesis protein WbpP | 0.987 | 10 | 213 |
|
| AF-A0A3D2H7C2-F1-model_v4 | LPS biosynthesis protein WbpP | 0.9813 | 10 | 343 |
|
| AF-A0A842W9Y4-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.977 | 23 | 342 |
|
| AF-A0A7T9IE08-F1-model_v4 | deleted | 0.9767 | 23 | 343 |
|
| AF-A0A1F3T5J3-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9758 | 18 | 342 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar