F385910

General Info

Members Datasets Scaffolds Average Seq Length
283 162 253 269

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2508501050|2508731090
Length 270
Sequence TSQGTALITGASSGIGAIYADRLARRGHDLILVARNQSRLEELAARLRDETGRSVEIVPADLNDDADLRRVETVLRTNTTISMLVNNAGIGGAAPLLASDVDAMDRMIRLNVLALTRLTYAAAPAFVARGGGTIVNIASIVAISSETLNGVYGGSKAFVLAFSQSLQHELAEKGVRVQAVLPGAIATEFWDVAGLPVSHLPAEIVMAAPDLVDAALAGLDQGETVTIPALEDKSEWDAYDAARRAMAGKLSRTEPATRYKAVSEEVRRAS

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
3 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
4 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
5 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
6 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
7 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
8 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
9 2773857925 Microvirga vignae BR3299 Isolate Unclassified
10 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
11 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
12 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
13 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
14 2831864461 Roseateles noduli HZ7 Isolate Nodule
15 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
16 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
17 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
18 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
19 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
20 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
21 2904564687 Burkholderia sp. 571 Isolate Unclassified
22 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
23 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
24 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
25 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
26 2928536128 Burkholderia sola 565 Isolate Unclassified
27 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
28 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
29 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
30 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
31 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
32 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
55 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
56 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
58 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
85 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
86 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
99 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
103 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
104 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
105 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
106 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
110 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
111 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
112 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
113 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
114 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
115 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
120 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
139 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
140 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
155 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
156 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
157 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
158 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
159 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
160 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
161 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
162 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.75
Metatranscriptomes 0
Isolates 10.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.65
Nodule 2.47
Rhizoplane 8.83
Rhizosphere 53.71
Stem 0
Stem Tuber 0
Unclassified 29.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10006002 3300003316 Bacteria 9944
2 rootH1_10079431 3300003316 Bacteria 3098
3 rootH1_10096359 3300003316 Bacteria 4858
4 rootH2_10018710 3300003320 Bacteria 5088
5 rootH2_10120172 3300003320 Bacteria 3388
6 rootH1_10104806 3300003323 Bacteria 6160
7 rootH1_10107674 3300003323 Bacteria 5403
8 JGI25160J50197_1000310 3300003354 Bacteria 34505
9 Ga0065165_1001003 3300005262 Bacteria 34543
10 Ga0070667_100000136 3300005367 Bacteria 93545
11 Ga0070709_10436628 3300005434 Bacteria 984
12 Ga0070663_100000204 3300005455 Bacteria 29549
13 Ga0070663_100247368 3300005455 Bacteria 1410
14 Ga0068853_100012399 3300005539 Bacteria 6935
15 Ga0068853_100074440 3300005539 Bacteria 2963
16 Ga0070665_100000810 3300005548 Bacteria 40895
17 Ga0070665_100115676 3300005548 Bacteria 2685
18 Ga0068857_100020602 3300005577 Bacteria 5803
19 Ga0068857_100146831 3300005577 Bacteria 2134
20 Ga0081540_1018973 3300005983 Bacteria 4199
21 Ga0081540_1072464 3300005983 Bacteria 1587
22 Ga0070716_100381941 3300006173 Bacteria 1007
23 Ga0105244_10000008 3300009036 Bacteria 302297
24 Ga0105244_10003552 3300009036 Bacteria 11074
25 Ga0105240_10000517 3300009093 Bacteria 71134
26 Ga0105240_10040925 3300009093 Bacteria 5921
27 Ga0105240_10054264 3300009093 Bacteria 5023
28 Ga0105240_10060371 3300009093 Bacteria 4727
29 Ga0105240_10149454 3300009093 Bacteria 2784
30 Ga0105240_10152307 3300009093 Bacteria 2753
31 Ga0105240_10177375 3300009093 Bacteria 2518
32 Ga0105240_10662943 3300009093 Bacteria 1142
33 Ga0105248_10001300 3300009177 Bacteria 27811
34 Ga0105237_10004233 3300009545 Bacteria 16711
35 Ga0105237_10030190 3300009545 Bacteria 5508
36 Ga0105237_10166318 3300009545 Bacteria 2204
37 Ga0105237_10169084 3300009545 Bacteria 2186
38 Ga0105238_10310131 3300009551 Bacteria 1563
39 Ga0105249_10000195 3300009553 Bacteria 69709
40 Ga0105249_10110098 3300009553 Bacteria 2602
41 Ga0157369_10018455 3300013105 Bacteria 7821
42 Ga0157369_10021247 3300013105 Bacteria 7259
43 Ga0157369_10340060 3300013105 Bacteria 1559
44 Ga0163162_10015341 3300013306 Bacteria 7485
45 Ga0163162_10059056 3300013306 Bacteria 3866
46 Ga0157375_10000142 3300013308 Bacteria 71529
47 Ga0157375_10031819 3300013308 Bacteria 4996
48 Ga0157379_10001853 3300014968 Bacteria 17493
49 Ga0157376_10140074 3300014969 Bacteria 2169
50 Ga0182006_1038172 3300015261 Bacteria 1900
51 Ga0182007_10008970 3300015262 Bacteria 4072
52 Ga0213872_10003488 3300021361 Bacteria 8718
53 Ga0209148_1000752 3300025254 Bacteria 24847
54 Ga0209759_1015527 3300025256 Bacteria 1962
55 Ga0209455_1000335 3300025272 Bacteria 45110
56 Ga0209673_1026639 3300025273 Bacteria 1894
57 Ga0209130_1003941 3300025284 Bacteria 5944
58 Ga0209564_1005020 3300025295 Bacteria 7760
59 Ga0207426_1000783 3300025302 Bacteria 34768
60 Ga0207655_1000083 3300025728 Bacteria 213295
61 Ga0207655_1003856 3300025728 Bacteria 10920
62 Ga0207699_10038693 3300025906 Bacteria 2736
63 Ga0207695_10000116 3300025913 Bacteria 239510
64 Ga0207695_10062009 3300025913 Bacteria 3862
65 Ga0207695_10118144 3300025913 Bacteria 2623
66 Ga0207695_10207617 3300025913 Bacteria 1871
67 Ga0207695_10244188 3300025913 Bacteria 1696
68 Ga0207695_10263076 3300025913 Bacteria 1622
69 Ga0207671_10001825 3300025914 Bacteria 23756
70 Ga0207671_10058564 3300025914 Bacteria 2856
71 Ga0207694_10105816 3300025924 Bacteria 2234
72 Ga0207700_10010707 3300025928 Bacteria 5806
73 Ga0207700_10333867 3300025928 Bacteria 1316
74 Ga0207664_10329917 3300025929 Bacteria 1347
75 Ga0207711_10000945 3300025941 Bacteria 27919
76 Ga0207712_10000277 3300025961 Bacteria 48990
77 Ga0207712_10300431 3300025961 Bacteria 1317
78 Ga0207640_10243654 3300025981 Bacteria 1391
79 Ga0207658_10000663 3300025986 Bacteria 30044
80 Ga0207639_10030896 3300026041 Bacteria 3932
81 Ga0207639_10340186 3300026041 Bacteria 1337
82 Ga0207678_10000160 3300026067 Bacteria 55960
83 Ga0207678_10284918 3300026067 Bacteria 1418
84 Ga0207648_10447948 3300026089 Bacteria 1175
85 Ga0207674_10035563 3300026116 Bacteria 5198
86 Ga0207674_10038235 3300026116 Bacteria 4985
87 Ga0268266_10000002 3300028379 Bacteria 3059047
88 Ga0268266_10156897 3300028379 Bacteria 2056
89 Ga0307513_10031514 3300031456 Bacteria 6002
90 Ga0307412_10000588 3300031911 Bacteria 21547
91 Ga0307412_10215857 3300031911 Bacteria 1467
92 Ga0307510_10003822 3300033180 Bacteria 17640
93 Ga0436365_0422986 3300039437 Bacteria 3932
94 Ga0436361_0087708 3300039447 Bacteria 4128
95 Ga0436361_0126160 3300039447 Bacteria 1576
96 Ga0436361_0269444 3300039447 Bacteria 1220
97 Ga0436361_0541628 3300039447 Bacteria 8662
98 Ga0436361_0550990 3300039447 Bacteria 7064
99 Ga0436361_0718795 3300039447 Bacteria 3626
100 Ga0436361_0874413 3300039447 Bacteria 1063
101 Ga0451833_1468087 3300041491 Bacteria 1874
102 Ga0439431_0032406 3300041997 Bacteria 1303
103 Ga0439462_0031302 3300042015 Bacteria 1408
104 Ga0466961_0001005 3300044693 Bacteria 17409
105 Ga0495617_000019 3300046452 Bacteria 247938
106 Ga0495592_0063528 3300046454 Bacteria 2708
107 Ga0495603_0161772 3300046455 Bacteria 1298
108 Ga0495590_0077206 3300046457 Bacteria 1172
109 Ga0495629_0016733 3300046459 Bacteria 5262
110 Ga0495653_0006747 3300046463 Bacteria 9426
111 Ga0495650_0006062 3300046471 Bacteria 7635
112 Ga0495650_0055319 3300046471 Bacteria 1615
113 Ga0495580_0391729 3300046472 Bacteria 937
114 Ga0495605_0004502 3300046474 Bacteria 8163
115 Ga0495606_0000317 3300046507 Bacteria 83201
116 Ga0495606_0014414 3300046507 Bacteria 6171
117 Ga0495616_0009525 3300046513 Bacteria 5673
118 Ga0495620_0002182 3300046515 Bacteria 11381
119 Ga0495628_0015643 3300046516 Bacteria 6334
120 Ga0495630_0021901 3300046517 Bacteria 4720
121 Ga0495643_0000160 3300046522 Bacteria 107502
122 Ga0495648_0065749 3300046524 Bacteria 2130
123 Ga0495665_0003587 3300046531 Bacteria 8424
124 Ga0495665_0029216 3300046531 Bacteria 2954
125 Ga0495586_0100724 3300046535 Bacteria 1603
126 Ga0495597_0002332 3300046542 Bacteria 12297
127 Ga0495645_0258782 3300046543 Bacteria 1153
128 Ga0495625_0067612 3300046660 Bacteria 2514
129 Ga0495625_0135922 3300046660 Bacteria 1662
130 Ga0495623_0002327 3300046679 Bacteria 12674
131 Ga0495646_0087072 3300046680 Bacteria 1810
132 Ga0495646_0161116 3300046680 Bacteria 1242
133 Ga0495624_0013422 3300046690 Bacteria 5587
134 Ga0495624_0171163 3300046690 Bacteria 1325
135 Ga0495649_0007871 3300046694 Bacteria 6448
136 Ga0495589_0019882 3300046794 Bacteria 3436
137 Ga0495660_0168749 3300046810 Bacteria 1067
138 Ga0495581_0175255 3300047315 Bacteria 1254
139 Ga0495604_0154740 3300047317 Bacteria 1625
140 Ga0495674_0008680 3300047319 Bacteria 9664
141 Ga0495674_0281782 3300047319 Bacteria 1361
142 Ga0495680_0014348 3300047322 Bacteria 6867
143 Ga0495675_0184242 3300047444 Bacteria 1277
144 Ga0495673_0000003 3300047469 Bacteria 1491337
145 Ga0495686_0000072 3300047472 Bacteria 216371
146 Ga0495686_0000395 3300047472 Bacteria 69176
147 Ga0495686_0016340 3300047472 Bacteria 5033
148 Ga0495686_0024341 3300047472 Bacteria 3980
149 Ga0495686_0034787 3300047472 Bacteria 3242
150 Ga0495686_0049394 3300047472 Bacteria 2647
151 Ga0495593_0008876 3300047673 Bacteria 5832
152 Ga0495593_0047112 3300047673 Bacteria 2294
153 Ga0495602_0003267 3300048088 Bacteria 16748
154 Ga0495626_0116983 3300048091 Bacteria 1150
155 Ga0496100_0000253 3300048903 Bacteria 27469
156 Ga0496100_0142824 3300048903 Bacteria 1699
157 Ga0496100_0160040 3300048903 Bacteria 1613
158 Ga0496101_0000415 3300048904 Bacteria 27487
159 Ga0496101_0137116 3300048904 Bacteria 1863
160 Ga0496102_0000134 3300048905 Bacteria 101631
161 Ga0496102_0000174 3300048905 Bacteria 87691
162 Ga0496103_0000069 3300048906 Bacteria 121542
163 Ga0496103_0000376 3300048906 Bacteria 40044
164 Ga0496104_0119151 3300048907 Bacteria 2534
165 Ga0496104_0435195 3300048907 Bacteria 1223
166 Ga0496105_0005913 3300048908 Bacteria 9334
167 Ga0496105_0251838 3300048908 Bacteria 1430
168 Ga0496106_0192424 3300048909 Bacteria 1622
169 Ga0496106_0418394 3300048909 Bacteria 1077
170 Ga0496107_0073446 3300048910 Bacteria 2488
171 Ga0496107_0130951 3300048910 Bacteria 1852
172 Ga0496110_0039340 3300048913 Bacteria 4117
173 Ga0496110_0177795 3300048913 Bacteria 1932
174 Ga0496110_0392509 3300048913 Bacteria 1265
175 Ga0496112_0238873 3300048915 Bacteria 1770
176 Ga0496113_0001659 3300048916 Bacteria 12576
177 Ga0496114_0081442 3300048917 Bacteria 2734
178 Ga0496115_0000009 3300048918 Bacteria 234372
179 Ga0496115_0065394 3300048918 Bacteria 2937
180 Ga0496116_0010575 3300048919 Bacteria 7718
181 Ga0496116_0045242 3300048919 Bacteria 2982
182 Ga0496116_0168317 3300048919 Bacteria 1191
183 Ga0496117_0000185 3300048920 Bacteria 127413
184 Ga0496117_0002073 3300048920 Bacteria 26513
185 Ga0496117_0023190 3300048920 Bacteria 4955
186 Ga0496117_0105090 3300048920 Bacteria 1776
187 Ga0496117_0169139 3300048920 Bacteria 1271
188 Ga0496118_0000077 3300048921 Bacteria 192298
189 Ga0496118_0001420 3300048921 Bacteria 36121
190 Ga0496118_0012898 3300048921 Bacteria 7962
191 Ga0496118_0055350 3300048921 Bacteria 2995
192 Ga0496118_0094184 3300048921 Bacteria 2049
193 Ga0496118_0119027 3300048921 Bacteria 1728
194 Ga0496119_0013405 3300048922 Bacteria 6535
195 Ga0496119_0077009 3300048922 Bacteria 1933
196 Ga0496119_0079035 3300048922 Bacteria 1901
197 Ga0496120_0000560 3300048923 Bacteria 56630
198 Ga0496120_0056141 3300048923 Bacteria 2224
199 Ga0496120_0082816 3300048923 Bacteria 1733
200 Ga0496121_0000197 3300048924 Bacteria 135555
201 Ga0496121_0000326 3300048924 Bacteria 99968
202 Ga0496121_0000432 3300048924 Bacteria 82444
203 Ga0496121_0000458 3300048924 Bacteria 80207
204 Ga0496121_0002462 3300048924 Bacteria 28269
205 Ga0496121_0002578 3300048924 Bacteria 27416
206 Ga0496121_0004486 3300048924 Bacteria 18723
207 Ga0496121_0015852 3300048924 Bacteria 7835
208 Ga0496121_0035502 3300048924 Bacteria 4468
209 Ga0496121_0046406 3300048924 Bacteria 3719
210 Ga0496121_0065061 3300048924 Bacteria 2969
211 Ga0496121_0183455 3300048924 Bacteria 1508
212 Ga0496121_0203511 3300048924 Bacteria 1409
213 Ga0496121_0264220 3300048924 Bacteria 1186
214 Ga0496121_0279337 3300048924 Bacteria 1143
215 Ga0496122_0012311 3300048925 Bacteria 8538
216 Ga0496122_0096657 3300048925 Bacteria 1991
217 Ga0496123_0002212 3300048926 Bacteria 24710
218 Ga0496123_0090220 3300048926 Bacteria 1823
219 Ga0496123_0153064 3300048926 Bacteria 1241
220 Ga0496124_0000050 3300048927 Bacteria 258041
221 Ga0496124_0000293 3300048927 Bacteria 93590
222 Ga0496124_0000674 3300048927 Bacteria 56134
223 Ga0496124_0008028 3300048927 Bacteria 11101
224 Ga0496125_0020717 3300048928 Bacteria 6164
225 Ga0496126_0000113 3300048929 Bacteria 192212
226 Ga0496126_0000216 3300048929 Bacteria 126985
227 Ga0496126_0005441 3300048929 Bacteria 14521
228 Ga0496126_0009532 3300048929 Bacteria 10299
229 Ga0496126_0013387 3300048929 Bacteria 8348
230 Ga0496126_0014113 3300048929 Bacteria 8089
231 Ga0496126_0016477 3300048929 Bacteria 7387
232 Ga0496126_0017385 3300048929 Bacteria 7166
233 Ga0496126_0032039 3300048929 Bacteria 4958
234 Ga0496126_0044735 3300048929 Bacteria 4075
235 Ga0496126_0076719 3300048929 Bacteria 2964
236 Ga0496126_0085083 3300048929 Bacteria 2788
237 Ga0496126_0088760 3300048929 Bacteria 2723
238 Ga0496126_0123185 3300048929 Bacteria 2246
239 Ga0496126_0253901 3300048929 Bacteria 1464
240 Ga0495682_0017926 3300049460 Bacteria 2666
241 Ga0501032_0118113 3300049569 Bacteria 1754
242 Ga0501046_0000010 3300049580 Bacteria 331082
243 Ga0501046_0002863 3300049580 Bacteria 16015
244 Ga0501073_0154631 3300049589 Bacteria 1590
245 Ga0501044_0246739 3300049823 Bacteria 1728
246 Ga0500643_002076 3300053087 Bacteria 10663
247 Ga0500566_0000074 3300053094 Bacteria 48359
248 Ga0500572_000970 3300053111 Bacteria 8692
249 Ga0500597_000320 3300053120 Bacteria 9910
250 Ga0500614_001115 3300053123 Bacteria 6622
251 Ga0500618_005683 3300053125 Bacteria 3762
252 Ga0500603_000030 3300053150 Bacteria 34154
253 Ga0500639_000047 3300053163 Bacteria 57835

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005983 Ga0081540_1072464 Ga0081540_10724642 241
2 3300013308 Ga0157375_10031819 Ga0157375_100318195 250
3 3300046522 Ga0495643_0000160 Ga0495643_0000160_98275_99054 256
4 3300046542 Ga0495597_0002332 Ga0495597_0002332_8364_9143 256
5 3300046810 Ga0495660_0168749 Ga0495660_0168749_91_870 256
6 iso_pu_bacteria 2831864461 2831865577 257
7 3300048922 Ga0496119_0079035 Ga0496119_0079035_74_853 259
8 iso_pu_bacteria 2808606384 2808973856 259
9 iso_pu_bacteria 2808606390 2809008702 259
10 iso_pu_bacteria 2808606391 2809015792 259
11 iso_pu_bacteria 3005710791 3005716365 260
12 iso_pu_bacteria 2513237082 2513558166 261
13 iso_pu_bacteria 2513237161 2514014818 261
14 iso_pu_bacteria 2562617112 2563056864 261
15 iso_pu_bacteria 2711768613 2713481119 261
16 iso_pu_bacteria 2818991466 2819713627 261
17 iso_pu_bacteria 2844315083 2844320810 261
18 iso_pu_bacteria 2863421361 2863423771 261
19 iso_pu_bacteria 2879099564 2879101595 261
20 iso_pu_bacteria 2879163058 2879164105 261
21 iso_pu_bacteria 2904564687 2904568339 261
22 iso_pu_bacteria 2904571731 2904575382 261
23 iso_pu_bacteria 2906602504 2906605965 261
24 iso_pu_bacteria 2921643360 2921651448 261
25 iso_pu_bacteria 2928526807 2928530067 261
26 iso_pu_bacteria 2928536128 2928536206 261
27 iso_pu_bacteria 2928968154 2928969743 261
28 iso_pu_bacteria 8018845410 8018853685 261
29 3300026067 Ga0207678_10284918 Ga0207678_102849182 262
30 3300046474 Ga0495605_0004502 Ga0495605_0004502_6134_6928 262
31 3300046507 Ga0495606_0014414 Ga0495606_0014414_3859_4653 262
32 3300047472 Ga0495686_0049394 Ga0495686_0049394_683_1477 262
33 iso_pu_bacteria 2508501050 2508731090 262
34 iso_pu_bacteria 2513237165 2514043358 262
35 iso_pu_bacteria 2585428057 2587730125 262
36 iso_pu_bacteria 2773857925 2774874493 262
37 iso_pu_bacteria 2902405164 2902409320 262
38 3300042015 Ga0439462_0031302 Ga0439462_0031302_590_1396 263
39 3300048924 Ga0496121_0000197 Ga0496121_0000197_23065_23871 263
40 3300009036 Ga0105244_10003552 Ga0105244_100035526 264
41 3300013306 Ga0163162_10059056 Ga0163162_100590561 264
42 3300013308 Ga0157375_10000142 Ga0157375_1000014228 264
43 3300025273 Ga0209673_1026639 Ga0209673_10266393 264
44 3300025728 Ga0207655_1003856 Ga0207655_10038564 264
45 3300026089 Ga0207648_10447948 Ga0207648_104479481 264
46 3300031911 Ga0307412_10215857 Ga0307412_102158572 264
47 3300033180 Ga0307510_10003822 Ga0307510_100038229 264
48 3300041491 Ga0451833_1468087 Ga0451833_1468087_442_1248 264
49 3300044693 Ga0466961_0001005 Ga0466961_0001005_12383_13180 264
50 3300046471 Ga0495650_0006062 Ga0495650_0006062_2247_3041 264
51 3300046471 Ga0495650_0055319 Ga0495650_0055319_619_1431 264
52 3300047472 Ga0495686_0034787 Ga0495686_0034787_1658_2455 264
53 3300048913 Ga0496110_0177795 Ga0496110_0177795_79_891 264
54 3300048924 Ga0496121_0000197 Ga0496121_0000197_91573_92373 264
55 3300048924 Ga0496121_0015852 Ga0496121_0015852_4937_5731 264
56 3300048924 Ga0496121_0046406 Ga0496121_0046406_2456_3250 264
57 3300048924 Ga0496121_0264220 Ga0496121_0264220_210_1004 264
58 3300048924 Ga0496121_0279337 Ga0496121_0279337_140_934 264
59 3300048929 Ga0496126_0032039 Ga0496126_0032039_2089_2967 264
60 3300049589 Ga0501073_0154631 Ga0501073_0154631_105_899 264
61 iso_pu_bacteria 2718218334 2721027429 264
62 iso_pu_bacteria 2884338543 2884340561 264
63 3300003316 rootH1_10079431 rootH1_100794313 265
64 3300003316 rootH1_10096359 rootH1_100963596 265
65 3300003320 rootH2_10018710 rootH2_100187104 265
66 3300003320 rootH2_10120172 rootH2_101201724 265
67 3300003323 rootH1_10104806 rootH1_101048067 265
68 3300003323 rootH1_10107674 rootH1_101076747 265
69 3300003354 JGI25160J50197_1000310 JGI25160J50197_100031021 265
70 3300005262 Ga0065165_1001003 Ga0065165_100100321 265
71 3300005367 Ga0070667_100000136 Ga0070667_10000013656 265
72 3300005434 Ga0070709_10436628 Ga0070709_104366281 265
73 3300005455 Ga0070663_100000204 Ga0070663_10000020425 265
74 3300005455 Ga0070663_100247368 Ga0070663_1002473681 265
75 3300005539 Ga0068853_100012399 Ga0068853_1000123998 265
76 3300005548 Ga0070665_100000810 Ga0070665_1000008106 265
77 3300005548 Ga0070665_100115676 Ga0070665_1001156764 265
78 3300005577 Ga0068857_100020602 Ga0068857_1000206023 265
79 3300005577 Ga0068857_100146831 Ga0068857_1001468312 265
80 3300005983 Ga0081540_1018973 Ga0081540_10189733 265
81 3300009036 Ga0105244_10000008 Ga0105244_10000008252 265
82 3300009093 Ga0105240_10000517 Ga0105240_1000051749 265
83 3300009093 Ga0105240_10054264 Ga0105240_100542645 265
84 3300009093 Ga0105240_10060371 Ga0105240_100603712 265
85 3300009093 Ga0105240_10149454 Ga0105240_101494542 265
86 3300009093 Ga0105240_10152307 Ga0105240_101523072 265
87 3300009093 Ga0105240_10662943 Ga0105240_106629431 265
88 3300009177 Ga0105248_10001300 Ga0105248_100013009 265
89 3300009545 Ga0105237_10004233 Ga0105237_1000423313 265
90 3300009545 Ga0105237_10030190 Ga0105237_100301903 265
91 3300009545 Ga0105237_10166318 Ga0105237_101663182 265
92 3300009553 Ga0105249_10000195 Ga0105249_1000019543 265
93 3300013105 Ga0157369_10021247 Ga0157369_100212476 265
94 3300013105 Ga0157369_10340060 Ga0157369_103400603 265
95 3300013306 Ga0163162_10015341 Ga0163162_100153413 265
96 3300014968 Ga0157379_10001853 Ga0157379_100018537 265
97 3300025254 Ga0209148_1000752 Ga0209148_100075221 265
98 3300025256 Ga0209759_1015527 Ga0209759_10155272 265
99 3300025272 Ga0209455_1000335 Ga0209455_100033512 265
100 3300025284 Ga0209130_1003941 Ga0209130_10039413 265
101 3300025295 Ga0209564_1005020 Ga0209564_10050204 265
102 3300025302 Ga0207426_1000783 Ga0207426_10007839 265
103 3300025728 Ga0207655_1000083 Ga0207655_100008337 265
104 3300025906 Ga0207699_10038693 Ga0207699_100386932 265
105 3300025913 Ga0207695_10000116 Ga0207695_1000011626 265
106 3300025913 Ga0207695_10062009 Ga0207695_100620095 265
107 3300025913 Ga0207695_10207617 Ga0207695_102076172 265
108 3300025913 Ga0207695_10244188 Ga0207695_102441882 265
109 3300025914 Ga0207671_10001825 Ga0207671_1000182514 265
110 3300025914 Ga0207671_10058564 Ga0207671_100585642 265
111 3300025928 Ga0207700_10010707 Ga0207700_100107075 265
112 3300025928 Ga0207700_10333867 Ga0207700_103338672 265
113 3300025929 Ga0207664_10329917 Ga0207664_103299171 265
114 3300025941 Ga0207711_10000945 Ga0207711_100009458 265
115 3300025961 Ga0207712_10000277 Ga0207712_1000027742 265
116 3300025981 Ga0207640_10243654 Ga0207640_102436542 265
117 3300025986 Ga0207658_10000663 Ga0207658_1000066328 265
118 3300026041 Ga0207639_10030896 Ga0207639_100308962 265
119 3300026067 Ga0207678_10000160 Ga0207678_1000016025 265
120 3300026116 Ga0207674_10035563 Ga0207674_100355635 265
121 3300026116 Ga0207674_10038235 Ga0207674_100382355 265
122 3300028379 Ga0268266_10000002 Ga0268266_100000021735 265
123 3300028379 Ga0268266_10156897 Ga0268266_101568972 265
124 3300031456 Ga0307513_10031514 Ga0307513_100315144 265
125 3300031911 Ga0307412_10000588 Ga0307412_1000058821 265
126 3300039437 Ga0436365_0422986 Ga0436365_0422986_2775_3590 265
127 3300039447 Ga0436361_0087708 Ga0436361_0087708_808_1605 265
128 3300039447 Ga0436361_0874413 Ga0436361_0874413_16_825 265
129 3300046454 Ga0495592_0063528 Ga0495592_0063528_1806_2615 265
130 3300046455 Ga0495603_0161772 Ga0495603_0161772_253_1062 265
131 3300046457 Ga0495590_0077206 Ga0495590_0077206_122_931 265
132 3300046459 Ga0495629_0016733 Ga0495629_0016733_2927_3727 265
133 3300046463 Ga0495653_0006747 Ga0495653_0006747_8041_8841 265
134 3300046472 Ga0495580_0391729 Ga0495580_0391729_64_873 265
135 3300046513 Ga0495616_0009525 Ga0495616_0009525_172_981 265
136 3300046516 Ga0495628_0015643 Ga0495628_0015643_3940_4740 265
137 3300046517 Ga0495630_0021901 Ga0495630_0021901_296_1096 265
138 3300046524 Ga0495648_0065749 Ga0495648_0065749_449_1258 265
139 3300046531 Ga0495665_0003587 Ga0495665_0003587_5458_6258 265
140 3300046531 Ga0495665_0029216 Ga0495665_0029216_617_1426 265
141 3300046535 Ga0495586_0100724 Ga0495586_0100724_690_1490 265
142 3300046543 Ga0495645_0258782 Ga0495645_0258782_137_946 265
143 3300046679 Ga0495623_0002327 Ga0495623_0002327_10033_10833 265
144 3300046680 Ga0495646_0087072 Ga0495646_0087072_37_837 265
145 3300046680 Ga0495646_0161116 Ga0495646_0161116_311_1120 265
146 3300046690 Ga0495624_0013422 Ga0495624_0013422_664_1464 265
147 3300046690 Ga0495624_0171163 Ga0495624_0171163_287_1096 265
148 3300046694 Ga0495649_0007871 Ga0495649_0007871_25_834 265
149 3300046794 Ga0495589_0019882 Ga0495589_0019882_1192_2001 265
150 3300047315 Ga0495581_0175255 Ga0495581_0175255_411_1211 265
151 3300047317 Ga0495604_0154740 Ga0495604_0154740_183_983 265
152 3300047319 Ga0495674_0008680 Ga0495674_0008680_3258_4067 265
153 3300047319 Ga0495674_0281782 Ga0495674_0281782_40_840 265
154 3300047322 Ga0495680_0014348 Ga0495680_0014348_4284_5084 265
155 3300047444 Ga0495675_0184242 Ga0495675_0184242_331_1131 265
156 3300047472 Ga0495686_0000072 Ga0495686_0000072_84134_84931 265
157 3300047472 Ga0495686_0016340 Ga0495686_0016340_3928_4740 265
158 3300047673 Ga0495593_0008876 Ga0495593_0008876_4786_5586 265
159 3300047673 Ga0495593_0047112 Ga0495593_0047112_1337_2146 265
160 3300048088 Ga0495602_0003267 Ga0495602_0003267_4623_5423 265
161 3300048091 Ga0495626_0116983 Ga0495626_0116983_11_820 265
162 3300048903 Ga0496100_0000253 Ga0496100_0000253_4929_5738 265
163 3300048903 Ga0496100_0142824 Ga0496100_0142824_726_1535 265
164 3300048903 Ga0496100_0160040 Ga0496100_0160040_449_1258 265
165 3300048904 Ga0496101_0000415 Ga0496101_0000415_21750_22559 265
166 3300048905 Ga0496102_0000134 Ga0496102_0000134_27499_28308 265
167 3300048905 Ga0496102_0000174 Ga0496102_0000174_36796_37596 265
168 3300048906 Ga0496103_0000069 Ga0496103_0000069_12785_13585 265
169 3300048906 Ga0496103_0000376 Ga0496103_0000376_25049_25858 265
170 3300048907 Ga0496104_0119151 Ga0496104_0119151_152_952 265
171 3300048907 Ga0496104_0435195 Ga0496104_0435195_102_911 265
172 3300048908 Ga0496105_0005913 Ga0496105_0005913_2506_3306 265
173 3300048908 Ga0496105_0251838 Ga0496105_0251838_363_1172 265
174 3300048909 Ga0496106_0192424 Ga0496106_0192424_617_1426 265
175 3300048909 Ga0496106_0418394 Ga0496106_0418394_133_942 265
176 3300048910 Ga0496107_0073446 Ga0496107_0073446_201_1010 265
177 3300048910 Ga0496107_0130951 Ga0496107_0130951_476_1276 265
178 3300048913 Ga0496110_0039340 Ga0496110_0039340_755_1555 265
179 3300048913 Ga0496110_0392509 Ga0496110_0392509_426_1235 265
180 3300048915 Ga0496112_0238873 Ga0496112_0238873_325_1134 265
181 3300048916 Ga0496113_0001659 Ga0496113_0001659_10208_11017 265
182 3300048917 Ga0496114_0081442 Ga0496114_0081442_721_1521 265
183 3300048918 Ga0496115_0000009 Ga0496115_0000009_125758_126558 265
184 3300048918 Ga0496115_0065394 Ga0496115_0065394_400_1197 265
185 3300048919 Ga0496116_0010575 Ga0496116_0010575_2118_2918 265
186 3300048919 Ga0496116_0168317 Ga0496116_0168317_174_983 265
187 3300048920 Ga0496117_0000185 Ga0496117_0000185_107959_108759 265
188 3300048920 Ga0496117_0002073 Ga0496117_0002073_1179_1988 265
189 3300048920 Ga0496117_0023190 Ga0496117_0023190_2617_3417 265
190 3300048920 Ga0496117_0105090 Ga0496117_0105090_350_1147 265
191 3300048921 Ga0496118_0000077 Ga0496118_0000077_83401_84201 265
192 3300048921 Ga0496118_0001420 Ga0496118_0001420_18981_19790 265
193 3300048921 Ga0496118_0012898 Ga0496118_0012898_2598_3398 265
194 3300048921 Ga0496118_0055350 Ga0496118_0055350_1463_2260 265
195 3300048921 Ga0496118_0094184 Ga0496118_0094184_765_1574 265
196 3300048921 Ga0496118_0119027 Ga0496118_0119027_587_1399 265
197 3300048922 Ga0496119_0013405 Ga0496119_0013405_870_1679 265
198 3300048922 Ga0496119_0077009 Ga0496119_0077009_1055_1855 265
199 3300048923 Ga0496120_0000560 Ga0496120_0000560_45964_46773 265
200 3300048923 Ga0496120_0056141 Ga0496120_0056141_401_1198 265
201 3300048923 Ga0496120_0082816 Ga0496120_0082816_225_1025 265
202 3300048924 Ga0496121_0000432 Ga0496121_0000432_67577_68377 265
203 3300048924 Ga0496121_0002462 Ga0496121_0002462_21624_22433 265
204 3300048924 Ga0496121_0002578 Ga0496121_0002578_19519_20316 265
205 3300048924 Ga0496121_0004486 Ga0496121_0004486_12346_13155 265
206 3300048924 Ga0496121_0035502 Ga0496121_0035502_1174_1974 265
207 3300048924 Ga0496121_0183455 Ga0496121_0183455_456_1265 265
208 3300048924 Ga0496121_0203511 Ga0496121_0203511_438_1250 265
209 3300048925 Ga0496122_0012311 Ga0496122_0012311_1656_2468 265
210 3300048925 Ga0496122_0096657 Ga0496122_0096657_1147_1947 265
211 3300048926 Ga0496123_0002212 Ga0496123_0002212_1258_2070 265
212 3300048926 Ga0496123_0090220 Ga0496123_0090220_759_1562 265
213 3300048926 Ga0496123_0153064 Ga0496123_0153064_360_1169 265
214 3300048927 Ga0496124_0000050 Ga0496124_0000050_149192_149992 265
215 3300048927 Ga0496124_0008028 Ga0496124_0008028_2670_3473 265
216 3300048929 Ga0496126_0000113 Ga0496126_0000113_83443_84243 265
217 3300048929 Ga0496126_0000216 Ga0496126_0000216_121588_122388 265
218 3300048929 Ga0496126_0009532 Ga0496126_0009532_8844_9641 265
219 3300048929 Ga0496126_0014113 Ga0496126_0014113_3062_3859 265
220 3300048929 Ga0496126_0017385 Ga0496126_0017385_4163_4960 265
221 3300048929 Ga0496126_0044735 Ga0496126_0044735_1239_2051 265
222 3300048929 Ga0496126_0085083 Ga0496126_0085083_1592_2389 265
223 3300048929 Ga0496126_0123185 Ga0496126_0123185_226_1035 265
224 3300049460 Ga0495682_0017926 Ga0495682_0017926_1796_2605 265
225 3300049580 Ga0501046_0000010 Ga0501046_0000010_42162_42974 265
226 3300053087 Ga0500643_002076 Ga0500643_002076_1948_2760 265
227 3300053094 Ga0500566_0000074 Ga0500566_0000074_31709_32506 265
228 3300053111 Ga0500572_000970 Ga0500572_000970_1539_2336 265
229 3300053120 Ga0500597_000320 Ga0500597_000320_1064_1876 265
230 3300053123 Ga0500614_001115 Ga0500614_001115_709_1506 265
231 3300053150 Ga0500603_000030 Ga0500603_000030_16080_16877 265
232 3300053163 Ga0500639_000047 Ga0500639_000047_34059_34856 265
233 3300003316 rootH1_10006002 rootH1_100060026 266
234 3300005539 Ga0068853_100074440 Ga0068853_1000744404 266
235 3300006173 Ga0070716_100381941 Ga0070716_1003819411 266
236 3300009093 Ga0105240_10040925 Ga0105240_100409256 266
237 3300009093 Ga0105240_10177375 Ga0105240_101773753 266
238 3300009545 Ga0105237_10169084 Ga0105237_101690843 266
239 3300009551 Ga0105238_10310131 Ga0105238_103101312 266
240 3300009553 Ga0105249_10110098 Ga0105249_101100984 266
241 3300013105 Ga0157369_10018455 Ga0157369_100184554 266
242 3300014969 Ga0157376_10140074 Ga0157376_101400742 266
243 3300015261 Ga0182006_1038172 Ga0182006_10381722 266
244 3300015262 Ga0182007_10008970 Ga0182007_100089702 266
245 3300021361 Ga0213872_10003488 Ga0213872_100034888 266
246 3300025913 Ga0207695_10118144 Ga0207695_101181443 266
247 3300025913 Ga0207695_10263076 Ga0207695_102630762 266
248 3300025924 Ga0207694_10105816 Ga0207694_101058162 266
249 3300025961 Ga0207712_10300431 Ga0207712_103004312 266
250 3300026041 Ga0207639_10340186 Ga0207639_103401862 266
251 3300039447 Ga0436361_0126160 Ga0436361_0126160_381_1184 266
252 3300039447 Ga0436361_0269444 Ga0436361_0269444_80_880 266
253 3300039447 Ga0436361_0541628 Ga0436361_0541628_6993_7796 266
254 3300039447 Ga0436361_0550990 Ga0436361_0550990_2151_3026 266
255 3300039447 Ga0436361_0718795 Ga0436361_0718795_1241_2044 266
256 3300041997 Ga0439431_0032406 Ga0439431_0032406_286_1194 266
257 3300046452 Ga0495617_000019 Ga0495617_000019_10825_11643 266
258 3300046507 Ga0495606_0000317 Ga0495606_0000317_62132_63004 266
259 3300046515 Ga0495620_0002182 Ga0495620_0002182_2233_3051 266
260 3300046660 Ga0495625_0067612 Ga0495625_0067612_212_1030 266
261 3300046660 Ga0495625_0135922 Ga0495625_0135922_284_1102 266
262 3300047469 Ga0495673_0000003 Ga0495673_0000003_1403467_1404282 266
263 3300047472 Ga0495686_0000395 Ga0495686_0000395_20637_21476 266
264 3300047472 Ga0495686_0024341 Ga0495686_0024341_428_1246 266
265 3300048904 Ga0496101_0137116 Ga0496101_0137116_348_1163 266
266 3300048919 Ga0496116_0045242 Ga0496116_0045242_1979_2794 266
267 3300048920 Ga0496117_0169139 Ga0496117_0169139_363_1178 266
268 3300048924 Ga0496121_0000326 Ga0496121_0000326_44165_45136 266
269 3300048924 Ga0496121_0000458 Ga0496121_0000458_55872_56690 266
270 3300048924 Ga0496121_0065061 Ga0496121_0065061_2100_2918 266
271 3300048927 Ga0496124_0000293 Ga0496124_0000293_39015_39851 266
272 3300048927 Ga0496124_0000674 Ga0496124_0000674_50919_51755 266
273 3300048928 Ga0496125_0020717 Ga0496125_0020717_2807_3607 266
274 3300048929 Ga0496126_0005441 Ga0496126_0005441_10416_11231 266
275 3300048929 Ga0496126_0013387 Ga0496126_0013387_5715_6545 266
276 3300048929 Ga0496126_0016477 Ga0496126_0016477_56_1027 266
277 3300048929 Ga0496126_0076719 Ga0496126_0076719_1960_2778 266
278 3300048929 Ga0496126_0088760 Ga0496126_0088760_368_1183 266
279 3300048929 Ga0496126_0253901 Ga0496126_0253901_362_1171 266
280 3300049569 Ga0501032_0118113 Ga0501032_0118113_709_1572 266
281 3300049580 Ga0501046_0002863 Ga0501046_0002863_12317_13180 266
282 3300049823 Ga0501044_0246739 Ga0501044_0246739_252_1115 266
283 3300053125 Ga0500618_005683 Ga0500618_005683_282_1097 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

4

194

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

10

209

0.93

PF08659

KR

KR domain

4

185

0.88

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

6

177

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zdz-assembly1.cif.gz_B tetragonal crystal structure of the bulky-bulky ketone specific alcohol dehydrogenase from comamonas testosteroni 0.9633 5 262
6zdz-assembly1.cif.gz_A tetragonal crystal structure of the bulky-bulky ketone specific alcohol dehydrogenase from comamonas testosteroni 0.9595 5 262
6ze0-assembly1.cif.gz_A orthorhombic crystal structure of the bulky-bulky ketone specific alcohol dehydrogenase from comamonas testosteroni 0.9592 5 262
6ze0-assembly1.cif.gz_B orthorhombic crystal structure of the bulky-bulky ketone specific alcohol dehydrogenase from comamonas testosteroni 0.9566 5 262
6zdz-assembly1.cif.gz_A tetragonal crystal structure of the bulky-bulky ketone specific alcohol dehydrogenase from comamonas testosteroni 0.9518 5 262
ID Description Score Start End Superfamily
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9679 8 58 3.40.50.720
4bmvE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9514 8 262 3.40.50.720
4bmvE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.937 8 262 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9278 94 188 3.40.50.720
af_I6Y9I3_9_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9161 9 233 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q4CV41-F1-model_v4 SDR family oxidoreductase 0.9458 8 262 GO:0016020
GO:0016491
AF-A0A1G5YGT2-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG (EC 1.1.1.298) (EC 1.1.1.381) (L-allo-threonine dehydrogenase) (Malonic semialdehyde reductase) 0.9386 1 262 GO:0016491
AF-A0A3M5ZT92-F1-model_v4 Oxidoreductase, short chain dehydrogenase/reductase family 0.9375 1 266 GO:0016491
AF-A0A5A9EPS6-F1-model_v4 Catalase (EC 1.11.1.6) 0.9362 5 262 GO:0004096
GO:0005737
GO:0020037
GO:0042542
GO:0042744
GO:0046872
AF-A0A2T9J0G4-F1-model_v4 SDR family oxidoreductase 0.9315 1 265 GO:0016491

Feature Viewer

pLDDT pTM Quality
87.47 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map