F385813

General Info

Members Datasets Scaffolds Average Seq Length
283 177 566 228

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0208174|Ga0496104_0208174_423_1244
Length 257
Sequence VAAPRFSAGTLSFLRRLKRNNRREWFNAHRDEYEAHVRAPMIAVIERLAVDFRSFAPDVAASPKRSLYRIHRDIRFSEDKKPYKTHVAASFPSRELPKHEGAGLYFHVSPDEVWVGGGMYAPMAPQLHAVREHIAVNSRRLRSIVTAPGFKRAFGALEGERLQRVPRGFPKDHEAAEFLKYRQFLAGCEFPASFATSPRFYSSLLGIFRQIAPLVAFLNEPLLGKRSGGDNGSDQNHLRDDERRSDGGTPSRAGRGH

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
97 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
106 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
107 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
108 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
119 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
158 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
159 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
175 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
176 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
177 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.18
Nodule 0
Rhizoplane 2.47
Rhizosphere 94.35
Stem 0
Stem Tuber 0
Unclassified 14.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0208174 3300048907 Bacteria 1868
2 JGI24751J29686_10008124 3300002459 Bacteria 2145
3 JGI25405J52794_10000375 3300003911 Bacteria 6304
4 Ga0065704_10023121 3300005289 Bacteria 1423
5 Ga0065707_10154699 3300005295 Bacteria 1617
6 Ga0070670_100378357 3300005331 Bacteria 1247
7 Ga0070680_100496297 3300005336 Bacteria 1044
8 Ga0070675_100551677 3300005354 Unclassified 1042
9 Ga0070674_100099039 3300005356 Bacteria 2120
10 Ga0070674_100104526 3300005356 Bacteria 2069
11 Ga0070674_100132740 3300005356 Bacteria 1859
12 Ga0070673_100096422 3300005364 Bacteria 2427
13 Ga0070673_100112613 3300005364 Bacteria 2259
14 Ga0070688_100030902 3300005365 Bacteria 3218
15 Ga0070709_10008897 3300005434 Bacteria 5528
16 Ga0070714_100485094 3300005435 Unclassified 1177
17 Ga0070713_100004867 3300005436 Bacteria 9106
18 Ga0070694_100005951 3300005444 Bacteria 7395
19 Ga0070708_100129109 3300005445 Bacteria 2339
20 Ga0070708_100369956 3300005445 Bacteria 1351
21 Ga0070681_10027477 3300005458 Bacteria 5720
22 Ga0070706_100081599 3300005467 Bacteria 2994
23 Ga0070706_100157817 3300005467 Bacteria 2118
24 Ga0070706_100208733 3300005467 Bacteria 1824
25 Ga0070707_100036450 3300005468 Unclassified 4693
26 Ga0070707_100328088 3300005468 Bacteria 1487
27 Ga0070707_100511269 3300005468 Unclassified 1163
28 Ga0070707_100647812 3300005468 Unclassified 1019
29 Ga0070698_100835524 3300005471 Bacteria 866
30 Ga0070698_100969852 3300005471 Unclassified 797
31 Ga0070699_100029773 3300005518 Bacteria 4709
32 Ga0070699_100155750 3300005518 Bacteria 2022
33 Ga0070679_100038112 3300005530 Bacteria 4778
34 Ga0070679_100154167 3300005530 Bacteria 2273
35 Ga0070672_100071524 3300005543 Bacteria 2760
36 Ga0070695_100000305 3300005545 Bacteria 24850
37 Ga0070695_100212749 3300005545 Unclassified 1389
38 Ga0070696_100420746 3300005546 Unclassified 1049
39 Ga0070665_100008232 3300005548 Bacteria 10553
40 Ga0070704_100028374 3300005549 Bacteria 3723
41 Ga0068854_100038355 3300005578 Bacteria 3369
42 Ga0068854_100400105 3300005578 Bacteria 1136
43 Ga0068859_100009564 3300005617 Bacteria 9787
44 Ga0068859_100077422 3300005617 Bacteria 3366
45 Ga0068864_100006801 3300005618 Bacteria 9366
46 Ga0068866_10093602 3300005718 Bacteria 1642
47 Ga0068861_100046075 3300005719 Bacteria 3287
48 Ga0068861_100753369 3300005719 Unclassified 910
49 Ga0068858_100042399 3300005842 Bacteria 4219
50 Ga0068858_100170546 3300005842 Bacteria 2052
51 Ga0068860_100083347 3300005843 Bacteria 3041
52 Ga0068860_100103391 3300005843 Bacteria 2719
53 Ga0068862_100015017 3300005844 Bacteria 6431
54 Ga0081455_10004206 3300005937 Bacteria 16221
55 Ga0081455_10090364 3300005937 Bacteria 2483
56 Ga0081538_10010476 3300005981 Bacteria 7603
57 Ga0081540_1024234 3300005983 Bacteria 3526
58 Ga0075368_10051307 3300006042 Unclassified 1640
59 Ga0075364_10028706 3300006051 Bacteria 3562
60 Ga0070715_10063922 3300006163 Bacteria 1624
61 Ga0070716_100053527 3300006173 Unclassified 2302
62 Ga0070716_100329257 3300006173 Bacteria 1073
63 Ga0075427_10005210 3300006194 Bacteria 1848
64 Ga0075366_10029595 3300006195 Bacteria 3218
65 Ga0097621_100000864 3300006237 Bacteria 21281
66 Ga0097621_100006144 3300006237 Bacteria 8508
67 Ga0097621_100077217 3300006237 Bacteria 2764
68 Ga0097621_100078494 3300006237 Bacteria 2743
69 Ga0068871_100000670 3300006358 Bacteria 23450
70 Ga0068871_100007764 3300006358 Bacteria 7681
71 Ga0068871_100013070 3300006358 Bacteria 6155
72 Ga0075428_100016722 3300006844 Bacteria 8099
73 Ga0075428_100331436 3300006844 Bacteria 1635
74 Ga0075428_100343107 3300006844 Bacteria 1603
75 Ga0075431_100198977 3300006847 Bacteria 2050
76 Ga0075431_100423749 3300006847 Bacteria 1330
77 Ga0075433_10027499 3300006852 Bacteria 4825
78 Ga0075434_100005277 3300006871 Bacteria 11748
79 Ga0075434_100035541 3300006871 Bacteria 4926
80 Ga0075434_100121566 3300006871 Bacteria 2627
81 Ga0075434_100292810 3300006871 Bacteria 1648
82 Ga0075434_100461015 3300006871 Bacteria 1292
83 Ga0075429_100000904 3300006880 Bacteria 23465
84 Ga0075429_100048549 3300006880 Bacteria 3691
85 Ga0075436_100126691 3300006914 Bacteria 1789
86 Ga0075436_100616996 3300006914 Bacteria 800
87 Ga0097620_100009564 3300006931 Bacteria 9787
88 Ga0097620_100077420 3300006931 Bacteria 3366
89 Ga0075435_100014114 3300007076 Bacteria 5961
90 Ga0075435_100033566 3300007076 Bacteria 4059
91 Ga0075435_100071406 3300007076 Unclassified 2835
92 Ga0075435_100080577 3300007076 Bacteria 2673
93 Ga0075435_100163354 3300007076 Bacteria 1877
94 Ga0111539_10000197 3300009094 Bacteria 70992
95 Ga0111539_10087306 3300009094 Bacteria 3664
96 Ga0111539_10087639 3300009094 Bacteria 3657
97 Ga0111539_10148344 3300009094 Bacteria 2746
98 Ga0111539_11038893 3300009094 Unclassified 952
99 Ga0105245_10063046 3300009098 Bacteria 3346
100 Ga0105245_10173831 3300009098 Bacteria 2053
101 Ga0105245_10458028 3300009098 Bacteria 1285
102 Ga0114129_10008132 3300009147 Bacteria 14952
103 Ga0114129_10033576 3300009147 Bacteria 7251
104 Ga0114129_10105919 3300009147 Bacteria 3885
105 Ga0114129_10296853 3300009147 Bacteria 2155
106 Ga0105243_10259143 3300009148 Bacteria 1556
107 Ga0105242_10067676 3300009176 Bacteria 2953
108 Ga0105242_10080278 3300009176 Bacteria 2726
109 Ga0105242_10354943 3300009176 Unclassified 1355
110 Ga0105242_10521060 3300009176 Bacteria 1134
111 Ga0105248_10036211 3300009177 Bacteria 5519
112 Ga0105248_10270473 3300009177 Bacteria 1914
113 Ga0105248_10385452 3300009177 Bacteria 1578
114 Ga0105249_10283725 3300009553 Bacteria 1655
115 Ga0105246_10428410 3300011119 Bacteria 1106
116 Ga0163162_10147589 3300013306 Bacteria 2468
117 Ga0157375_10068845 3300013308 Bacteria 3543
118 Ga0157375_10446784 3300013308 Bacteria 1458
119 Ga0157375_11212591 3300013308 Unclassified 885
120 Ga0163163_10341750 3300014325 Unclassified 1552
121 Ga0157380_11476610 3300014326 Bacteria 732
122 Ga0157377_10150932 3300014745 Bacteria 1436
123 Ga0157376_10096876 3300014969 Bacteria 2568
124 Ga0207642_10256136 3300025899 Unclassified 996
125 Ga0207699_10025803 3300025906 Bacteria 3231
126 Ga0207645_10313442 3300025907 Bacteria 1046
127 Ga0207684_10052577 3300025910 Unclassified 3457
128 Ga0207684_10099196 3300025910 Bacteria 2488
129 Ga0207707_10035537 3300025912 Bacteria 4357
130 Ga0207660_10181097 3300025917 Unclassified 1636
131 Ga0207662_10033031 3300025918 Bacteria 3014
132 Ga0207652_10174538 3300025921 Bacteria 1930
133 Ga0207646_10018485 3300025922 Bacteria 6498
134 Ga0207646_10269966 3300025922 Bacteria 1538
135 Ga0207646_10369379 3300025922 Bacteria 1296
136 Ga0207700_10096482 3300025928 Bacteria 2348
137 Ga0207670_10109109 3300025936 Bacteria 1991
138 Ga0207704_10018663 3300025938 Bacteria 3626
139 Ga0207665_10039224 3300025939 Bacteria 3157
140 Ga0207665_10272817 3300025939 Bacteria 1257
141 Ga0207691_10040980 3300025940 Bacteria 4278
142 Ga0207711_10031624 3300025941 Bacteria 4469
143 Ga0207711_10055584 3300025941 Bacteria 3398
144 Ga0207651_10039518 3300025960 Bacteria 3112
145 Ga0207640_10024322 3300025981 Bacteria 3653
146 Ga0207640_10073090 3300025981 Bacteria 2316
147 Ga0207677_10289182 3300026023 Bacteria 1349
148 Ga0207703_10027580 3300026035 Bacteria 4472
149 Ga0207703_10127560 3300026035 Bacteria 2193
150 Ga0207648_10075841 3300026089 Bacteria 2931
151 Ga0207676_10042284 3300026095 Bacteria 3504
152 Ga0207675_100205670 3300026118 Bacteria 1892
153 Ga0207683_10025105 3300026121 Bacteria 5138
154 Ga0207428_10011959 3300027907 Bacteria 7639
155 Ga0207428_10043228 3300027907 Bacteria 3640
156 Ga0207428_10130896 3300027907 Bacteria 1920
157 Ga0207428_10299533 3300027907 Bacteria 1190
158 Ga0268265_10004933 3300028380 Bacteria 9178
159 Ga0268265_10164810 3300028380 Unclassified 1888
160 Ga0268264_10092026 3300028381 Bacteria 2617
161 Ga0268264_10115163 3300028381 Bacteria 2361
162 Ga0265318_10064781 3300028577 Unclassified 1359
163 Ga0265336_10013330 3300028666 Bacteria 2743
164 Ga0265332_10078628 3300031238 Archaea 1400
165 Ga0307408_100309086 3300031548 Unclassified 1327
166 Ga0307408_100473619 3300031548 Archaea 1091
167 Ga0307408_100509912 3300031548 Bacteria 1054
168 Ga0307405_10093544 3300031731 Bacteria 1997
169 Ga0307406_10343618 3300031901 Bacteria 1163
170 Ga0307412_10199014 3300031911 Bacteria 1520
171 Ga0307416_100056631 3300032002 Bacteria 3165
172 Ga0307416_100087227 3300032002 Bacteria 2663
173 Ga0307411_10044423 3300032005 Bacteria 2850
174 Ga0307411_10056597 3300032005 Bacteria 2586
175 Ga0307415_100116288 3300032126 Bacteria 1995
176 Ga0373944_0067720 3300035089 Bacteria 1157
177 Ga0373932_0091097 3300035112 Bacteria 978
178 Ga0373945_0062393 3300035116 Bacteria 1393
179 Ga0373953_0192911 3300035117 Unclassified 880
180 Ga0373956_0088948 3300035119 Unclassified 1423
181 Ga0373943_0081434 3300035170 Bacteria 1660
182 Ga0373943_0226924 3300035170 Unclassified 1042
183 Ga0373946_0070067 3300035171 Bacteria 1512
184 Ga0373955_0024916 3300035172 Bacteria 3065
185 Ga0373955_0105138 3300035172 Bacteria 1626
186 Ga0373924_0005442 3300035410 Bacteria 4511
187 Ga0373931_0166237 3300035691 Unclassified 1296
188 Ga0373933_0152861 3300035724 Bacteria 1462
189 Ga0373937_0096506 3300036401 Bacteria 2742
190 Ga0373937_0189972 3300036401 Bacteria 1930
191 Ga0373937_0678822 3300036401 Unclassified 976
192 Ga0373925_0002531 3300037068 Bacteria 14558
193 Ga0373925_0296103 3300037068 Unclassified 1306
194 Ga0373925_0356990 3300037068 Unclassified 1187
195 Ga0373925_0847838 3300037068 Unclassified 753
196 Ga0439464_0003636 3300042439 Bacteria 3909
197 Ga0453683_0152457 3300044673 Bacteria 1461
198 Ga0453683_0301126 3300044673 Unclassified 1026
199 Ga0451576_0156394 3300045051 Bacteria 2378
200 Ga0495592_0119660 3300046454 Bacteria 1854
201 Ga0495638_0012833 3300046460 Bacteria 5725
202 Ga0495580_0032554 3300046472 Bacteria 3762
203 Ga0495582_0138397 3300046473 Bacteria 1379
204 Ga0495639_0029967 3300046475 Bacteria 2417
205 Ga0495608_0014302 3300046511 Bacteria 5506
206 Ga0495618_0160678 3300046514 Bacteria 1432
207 Ga0495628_0047676 3300046516 Bacteria 3398
208 Ga0495628_0058656 3300046516 Bacteria 3023
209 Ga0495628_0357355 3300046516 Unclassified 1073
210 Ga0495630_0006758 3300046517 Bacteria 8172
211 Ga0495652_0072564 3300046529 Bacteria 2869
212 Ga0495665_0102180 3300046531 Bacteria 1504
213 Ga0495586_0103457 3300046535 Bacteria 1582
214 Ga0495586_0368591 3300046535 Unclassified 825
215 Ga0495587_0040954 3300046536 Bacteria 2765
216 Ga0495645_0038031 3300046543 Bacteria 3509
217 Ga0495667_0034724 3300046559 Bacteria 3371
218 Ga0495667_0175368 3300046559 Bacteria 1377
219 Ga0495634_0096494 3300046642 Bacteria 1914
220 Ga0495599_0384657 3300046678 Unclassified 837
221 Ga0495647_0028059 3300046681 Archaea 2074
222 Ga0495658_0025182 3300046683 Bacteria 3178
223 Ga0495669_0027916 3300046684 Bacteria 2469
224 Ga0495669_0045466 3300046684 Unclassified 1958
225 Ga0495613_0000509 3300046689 Bacteria 32621
226 Ga0495600_0014874 3300046809 Bacteria 4910
227 Ga0495581_0282483 3300047315 Unclassified 970
228 Ga0495604_0008674 3300047317 Bacteria 8033
229 Ga0495604_0294281 3300047317 Bacteria 1092
230 Ga0495674_0161824 3300047319 Bacteria 1872
231 Ga0495672_0028806 3300047320 Bacteria 3507
232 Ga0495680_0078341 3300047322 Bacteria 2501
233 Ga0495675_0132864 3300047444 Bacteria 1546
234 Ga0495684_0000235 3300047471 Bacteria 43518
235 Ga0495602_0182184 3300048088 Bacteria 1619
236 Ga0496100_0028965 3300048903 Bacteria 3420
237 Ga0496102_0509400 3300048905 Bacteria 1126
238 Ga0496104_0189261 3300048907 Bacteria 1969
239 Ga0496106_0080530 3300048909 Bacteria 2501
240 Ga0496107_0033712 3300048910 Bacteria 3665
241 Ga0496114_0003611 3300048917 Bacteria 11889
242 Ga0501075_0268726 3300049591 Bacteria 1300
243 Ga0501208_005666 3300049655 Bacteria 1549
244 Ga0501233_039142 3300049668 Unclassified 1107
245 Ga0501225_0095318 3300049705 Unclassified 865
246 Ga0501045_0429149 3300049824 Bacteria 983
247 nmdc:mga00v17_26279_c1 3300050491 Bacteria 3391
248 nmdc:mga04h51_50740_c1 3300050495 Unclassified 1391
249 nmdc:mga05p37_102771_c1 3300050507 Bacteria 3519
250 nmdc:mga05p37_113726_c1 3300050507 Bacteria 3328
251 nmdc:mga05p37_128951_c1 3300050507 Bacteria 3105
252 nmdc:mga05p37_27958_c1 3300050507 Bacteria 6870
253 nmdc:mga05p37_52383_c1 3300050507 Bacteria 5019
254 nmdc:mga05p37_77301_c1 3300050507 Bacteria 4098
255 nmdc:mga09592_195480_c1 3300050508 Bacteria 1751
256 nmdc:mga09592_57778_c1 3300050508 Bacteria 3280
257 nmdc:mga0qj67_101531_c1 3300050509 Bacteria 2319
258 nmdc:mga0qj67_161206_c1 3300050509 Bacteria 1821
259 nmdc:mga06r32_15965_c1 3300050510 Bacteria 6832
260 nmdc:mga06r32_221247_c1 3300050510 Bacteria 1881
261 nmdc:mga06r32_2469_c1 3300050510 Bacteria 16548
262 nmdc:mga06r32_331359_c1 3300050510 Bacteria 1507
263 nmdc:mga08y16_146130_c1 3300050511 Bacteria 2458
264 nmdc:mga08y16_14964_c1 3300050511 Bacteria 8159
265 nmdc:mga08y16_626180_c1 3300050511 Bacteria 1082
266 nmdc:mga08y16_7156_c1 3300050511 Bacteria 11711
267 nmdc:mga0n895_110011_c1 3300050512 Bacteria 2771
268 nmdc:mga0n895_445661_c1 3300050512 Unclassified 1307
269 nmdc:mga0rr50_44123_c1 3300050513 Bacteria 3268
270 nmdc:mga0rr50_70329_c1 3300050513 Bacteria 2667
271 nmdc:mga0a205_30940_c1 3300050515 Bacteria 5127
272 nmdc:mga0a205_364260_c1 3300050515 Bacteria 1312
273 nmdc:mga0a205_611296_c1 3300050515 Unclassified 943
274 Ga0495601_0008752 3300053077 Bacteria 5972
275 Ga0495601_0013513 3300053077 Bacteria 4911
276 Ga0495601_0072612 3300053077 Bacteria 2198
277 Ga0495595_0158708 3300053084 Bacteria 1115
278 Ga0495619_0005546 3300053085 Bacteria 8005
279 Ga0495619_0032321 3300053085 Bacteria 3395
280 Ga0500555_000168 3300053103 Bacteria 30002
281 Ga0500568_0001636 3300053139 Bacteria 14129
282 Ga0500616_0000879 3300053153 Bacteria 33124
283 Ga0500645_000084 3300053730 Bacteria 76230
284 Ga0496104_0208174
285 JGI24751J29686_10008124
286 JGI25405J52794_10000375
287 Ga0065704_10023121
288 Ga0065707_10154699
289 Ga0070670_100378357
290 Ga0070680_100496297
291 Ga0070675_100551677
292 Ga0070674_100099039
293 Ga0070674_100104526
294 Ga0070674_100132740
295 Ga0070673_100096422
296 Ga0070673_100112613
297 Ga0070688_100030902
298 Ga0070709_10008897
299 Ga0070714_100485094
300 Ga0070713_100004867
301 Ga0070694_100005951
302 Ga0070708_100129109
303 Ga0070708_100369956
304 Ga0070681_10027477
305 Ga0070706_100081599
306 Ga0070706_100157817
307 Ga0070706_100208733
308 Ga0070707_100036450
309 Ga0070707_100328088
310 Ga0070707_100511269
311 Ga0070707_100647812
312 Ga0070698_100835524
313 Ga0070698_100969852
314 Ga0070699_100029773
315 Ga0070699_100155750
316 Ga0070679_100038112
317 Ga0070679_100154167
318 Ga0070672_100071524
319 Ga0070695_100000305
320 Ga0070695_100212749
321 Ga0070696_100420746
322 Ga0070665_100008232
323 Ga0070704_100028374
324 Ga0068854_100038355
325 Ga0068854_100400105
326 Ga0068859_100009564
327 Ga0068859_100077422
328 Ga0068864_100006801
329 Ga0068866_10093602
330 Ga0068861_100046075
331 Ga0068861_100753369
332 Ga0068858_100042399
333 Ga0068858_100170546
334 Ga0068860_100083347
335 Ga0068860_100103391
336 Ga0068862_100015017
337 Ga0081455_10004206
338 Ga0081455_10090364
339 Ga0081538_10010476
340 Ga0081540_1024234
341 Ga0075368_10051307
342 Ga0075364_10028706
343 Ga0070715_10063922
344 Ga0070716_100053527
345 Ga0070716_100329257
346 Ga0075427_10005210
347 Ga0075366_10029595
348 Ga0097621_100000864
349 Ga0097621_100006144
350 Ga0097621_100077217
351 Ga0097621_100078494
352 Ga0068871_100000670
353 Ga0068871_100007764
354 Ga0068871_100013070
355 Ga0075428_100016722
356 Ga0075428_100331436
357 Ga0075428_100343107
358 Ga0075431_100198977
359 Ga0075431_100423749
360 Ga0075433_10027499
361 Ga0075434_100005277
362 Ga0075434_100035541
363 Ga0075434_100121566
364 Ga0075434_100292810
365 Ga0075434_100461015
366 Ga0075429_100000904
367 Ga0075429_100048549
368 Ga0075436_100126691
369 Ga0075436_100616996
370 Ga0097620_100009564
371 Ga0097620_100077420
372 Ga0075435_100014114
373 Ga0075435_100033566
374 Ga0075435_100071406
375 Ga0075435_100080577
376 Ga0075435_100163354
377 Ga0111539_10000197
378 Ga0111539_10087306
379 Ga0111539_10087639
380 Ga0111539_10148344
381 Ga0111539_11038893
382 Ga0105245_10063046
383 Ga0105245_10173831
384 Ga0105245_10458028
385 Ga0114129_10008132
386 Ga0114129_10033576
387 Ga0114129_10105919
388 Ga0114129_10296853
389 Ga0105243_10259143
390 Ga0105242_10067676
391 Ga0105242_10080278
392 Ga0105242_10354943
393 Ga0105242_10521060
394 Ga0105248_10036211
395 Ga0105248_10270473
396 Ga0105248_10385452
397 Ga0105249_10283725
398 Ga0105246_10428410
399 Ga0163162_10147589
400 Ga0157375_10068845
401 Ga0157375_10446784
402 Ga0157375_11212591
403 Ga0163163_10341750
404 Ga0157380_11476610
405 Ga0157377_10150932
406 Ga0157376_10096876
407 Ga0207642_10256136
408 Ga0207699_10025803
409 Ga0207645_10313442
410 Ga0207684_10052577
411 Ga0207684_10099196
412 Ga0207707_10035537
413 Ga0207660_10181097
414 Ga0207662_10033031
415 Ga0207652_10174538
416 Ga0207646_10018485
417 Ga0207646_10269966
418 Ga0207646_10369379
419 Ga0207700_10096482
420 Ga0207670_10109109
421 Ga0207704_10018663
422 Ga0207665_10039224
423 Ga0207665_10272817
424 Ga0207691_10040980
425 Ga0207711_10031624
426 Ga0207711_10055584
427 Ga0207651_10039518
428 Ga0207640_10024322
429 Ga0207640_10073090
430 Ga0207677_10289182
431 Ga0207703_10027580
432 Ga0207703_10127560
433 Ga0207648_10075841
434 Ga0207676_10042284
435 Ga0207675_100205670
436 Ga0207683_10025105
437 Ga0207428_10011959
438 Ga0207428_10043228
439 Ga0207428_10130896
440 Ga0207428_10299533
441 Ga0268265_10004933
442 Ga0268265_10164810
443 Ga0268264_10092026
444 Ga0268264_10115163
445 Ga0265318_10064781
446 Ga0265336_10013330
447 Ga0265332_10078628
448 Ga0307408_100309086
449 Ga0307408_100473619
450 Ga0307408_100509912
451 Ga0307405_10093544
452 Ga0307406_10343618
453 Ga0307412_10199014
454 Ga0307416_100056631
455 Ga0307416_100087227
456 Ga0307411_10044423
457 Ga0307411_10056597
458 Ga0307415_100116288
459 Ga0373944_0067720
460 Ga0373932_0091097
461 Ga0373945_0062393
462 Ga0373953_0192911
463 Ga0373956_0088948
464 Ga0373943_0081434
465 Ga0373943_0226924
466 Ga0373946_0070067
467 Ga0373955_0024916
468 Ga0373955_0105138
469 Ga0373924_0005442
470 Ga0373931_0166237
471 Ga0373933_0152861
472 Ga0373937_0096506
473 Ga0373937_0189972
474 Ga0373937_0678822
475 Ga0373925_0002531
476 Ga0373925_0296103
477 Ga0373925_0356990
478 Ga0373925_0847838
479 Ga0439464_0003636
480 Ga0453683_0152457
481 Ga0453683_0301126
482 Ga0451576_0156394
483 Ga0495592_0119660
484 Ga0495638_0012833
485 Ga0495580_0032554
486 Ga0495582_0138397
487 Ga0495639_0029967
488 Ga0495608_0014302
489 Ga0495618_0160678
490 Ga0495628_0047676
491 Ga0495628_0058656
492 Ga0495628_0357355
493 Ga0495630_0006758
494 Ga0495652_0072564
495 Ga0495665_0102180
496 Ga0495586_0103457
497 Ga0495586_0368591
498 Ga0495587_0040954
499 Ga0495645_0038031
500 Ga0495667_0034724
501 Ga0495667_0175368
502 Ga0495634_0096494
503 Ga0495599_0384657
504 Ga0495647_0028059
505 Ga0495658_0025182
506 Ga0495669_0027916
507 Ga0495669_0045466
508 Ga0495613_0000509
509 Ga0495600_0014874
510 Ga0495581_0282483
511 Ga0495604_0008674
512 Ga0495604_0294281
513 Ga0495674_0161824
514 Ga0495672_0028806
515 Ga0495680_0078341
516 Ga0495675_0132864
517 Ga0495684_0000235
518 Ga0495602_0182184
519 Ga0496100_0028965
520 Ga0496102_0509400
521 Ga0496104_0189261
522 Ga0496106_0080530
523 Ga0496107_0033712
524 Ga0496114_0003611
525 Ga0501075_0268726
526 Ga0501208_005666
527 Ga0501233_039142
528 Ga0501225_0095318
529 Ga0501045_0429149
530 nmdc:mga00v17_26279_c1
531 nmdc:mga04h51_50740_c1
532 nmdc:mga05p37_102771_c1
533 nmdc:mga05p37_113726_c1
534 nmdc:mga05p37_128951_c1
535 nmdc:mga05p37_27958_c1
536 nmdc:mga05p37_52383_c1
537 nmdc:mga05p37_77301_c1
538 nmdc:mga09592_195480_c1
539 nmdc:mga09592_57778_c1
540 nmdc:mga0qj67_101531_c1
541 nmdc:mga0qj67_161206_c1
542 nmdc:mga06r32_15965_c1
543 nmdc:mga06r32_221247_c1
544 nmdc:mga06r32_2469_c1
545 nmdc:mga06r32_331359_c1
546 nmdc:mga08y16_146130_c1
547 nmdc:mga08y16_14964_c1
548 nmdc:mga08y16_626180_c1
549 nmdc:mga08y16_7156_c1
550 nmdc:mga0n895_110011_c1
551 nmdc:mga0n895_445661_c1
552 nmdc:mga0rr50_44123_c1
553 nmdc:mga0rr50_70329_c1
554 nmdc:mga0a205_30940_c1
555 nmdc:mga0a205_364260_c1
556 nmdc:mga0a205_611296_c1
557 Ga0495601_0008752
558 Ga0495601_0013513
559 Ga0495601_0072612
560 Ga0495595_0158708
561 Ga0495619_0005546
562 Ga0495619_0032321
563 Ga0500555_000168
564 Ga0500568_0001636
565 Ga0500616_0000879
566 Ga0500645_000084

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09365

DUF2461

Conserved hypothetical protein (DUF2461)

9

217

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a8e-assembly1.cif.gz_A three-dimensional structure of bacillus subtilis q45498 putative protein at resolution 2.5a. northeast structural genomics consortium target sr204. 0.6216 2 224
2a8e-assembly1.cif.gz_A three-dimensional structure of bacillus subtilis q45498 putative protein at resolution 2.5a. northeast structural genomics consortium target sr204. 0.6191 2 224
3mqz-assembly1.cif.gz_A crystal structure of conserved protein duf1054 from pink subaerial biofilm microbial leptospirillum sp. group ii uba. 0.5669 26 220
3mqz-assembly1.cif.gz_A crystal structure of conserved protein duf1054 from pink subaerial biofilm microbial leptospirillum sp. group ii uba. 0.5201 26 220
4akx-assembly1.cif.gz_A structure of the heterodimeric complex exou-spcu from the type iii secretion system (t3ss) of pseudomonas aeruginosa 0.5075 96 221
ID Description Score Start End Superfamily
2a8eA00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.6299 30 224 3.30.930.20
af_Q2G2G7_1_204_3.30.930.20 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.5968 1 216 3.30.930.20
af_Q2G2G7_1_204_3.30.930.20 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.5919 1 216 3.30.930.20
2a8eA00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.5774 30 224 3.30.930.20
3mqzA00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.5755 32 220 3.30.930.20
ID Description Score Start End GO Terms
AF-A0A2V8AY61-F1-model_v4 TIGR02453 family protein 0.9879 1 224
AF-A0A2V8KIA5-F1-model_v4 Uncharacterized protein 0.9855 118 223
AF-A0A7V8XZ77-F1-model_v4 DUF2461 domain-containing protein 0.9854 6 221
AF-A0A1Q7MZW3-F1-model_v4 TIGR02453 family protein 0.9848 5 223
AF-A0A2V8IXW5-F1-model_v4 DUF2461 domain-containing protein 0.9844 6 222

Map