F385760

General Info

Members Datasets Scaffolds Average Seq Length
283 170 566 258

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0077578|Ga0466970_0077578_282_1064
Length 251
Sequence MMAMPDPSVLLLLALAALAAGFVDAVVGGGGLVQLPALLLGLPGIAPVHVLATNKLASVCGTSVASTTYYRRVRPDPRTFGPLMGCALVGHIPASAFQPLVLVVLVVVGTYVLLRPDLGAATSLRFAGHRHVLAAMGVGLVIGVYDGALGPGTGSFFVITLVGLLGYDFLEASAKARLANWATNVGALLLFVPSGAVLWRLGLVMGACNLLGGYLGARTAVSRGSRFVRVFFLLVVSAFVVRIGGGVLEVW

Samples

Sample ID Description Type Environment
1 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
89 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
90 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
91 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
92 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
93 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
100 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
101 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
108 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
135 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
136 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
149 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
152 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
153 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
158 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
159 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
160 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
161 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
163 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
164 2643221561 Nocardioides sp. Root151 Isolate Unclassified
165 2643221615 Nocardioides sp. Root224 Isolate Unclassified
166 2643221641 Nocardioides sp. Root122 Isolate Unclassified
167 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
168 2643221696 Nocardioides sp. Root140 Isolate Unclassified
169 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
170 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.53
Metatranscriptomes 0
Isolates 2.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.07
Nodule 0.35
Rhizoplane 7.07
Rhizosphere 76.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466970_0077578 3300044765 Bacteria 1791
2 rootL2_10035056 3300003322 Bacteria 1530
3 Ga0070683_100005530 3300005329 Bacteria 10559
4 Ga0070670_100105482 3300005331 Bacteria 2428
5 Ga0070682_100019877 3300005337 Bacteria 3945
6 Ga0070682_100241035 3300005337 Bacteria 1298
7 Ga0070661_100148411 3300005344 Bacteria 1771
8 Ga0070661_100640521 3300005344 Bacteria 862
9 Ga0070692_10246607 3300005345 Bacteria 1067
10 Ga0070668_100127081 3300005347 Bacteria 2043
11 Ga0070668_100288794 3300005347 Bacteria 1372
12 Ga0070675_100343704 3300005354 Bacteria 1322
13 Ga0070659_100030409 3300005366 Bacteria 4180
14 Ga0070659_100047702 3300005366 Bacteria 3362
15 Ga0070705_100043386 3300005440 Bacteria 2577
16 Ga0070663_100034124 3300005455 Bacteria 3521
17 Ga0070663_100115615 3300005455 Bacteria 2021
18 Ga0070678_100098442 3300005456 Bacteria 2261
19 Ga0070678_100158381 3300005456 Bacteria 1832
20 Ga0070678_100226860 3300005456 Bacteria 1555
21 Ga0070678_100398647 3300005456 Bacteria 1195
22 Ga0070685_10154065 3300005466 Bacteria 1459
23 Ga0070698_100034543 3300005471 Bacteria 5233
24 Ga0070684_100015715 3300005535 Bacteria 6174
25 Ga0068853_100400787 3300005539 Bacteria 1284
26 Ga0070696_100167676 3300005546 Bacteria 1621
27 Ga0070665_100104887 3300005548 Bacteria 2829
28 Ga0070664_100017541 3300005564 Bacteria 5879
29 Ga0070664_100027901 3300005564 Bacteria 4695
30 Ga0070664_100508413 3300005564 Bacteria 1111
31 Ga0068857_100010597 3300005577 Bacteria 8014
32 Ga0068856_100019566 3300005614 Bacteria 6573
33 Ga0070702_100002630 3300005615 Bacteria 7826
34 Ga0070702_100025226 3300005615 Bacteria 3183
35 Ga0068866_10039416 3300005718 Bacteria 2333
36 Ga0068861_100201224 3300005719 Bacteria 1672
37 Ga0068858_100144367 3300005842 Bacteria 2235
38 Ga0068862_100929952 3300005844 Bacteria 856
39 Ga0081539_10095692 3300005985 Bacteria 1525
40 Ga0075365_10016958 3300006038 Bacteria 4446
41 Ga0075365_10094247 3300006038 Bacteria 2043
42 Ga0075365_10102475 3300006038 Bacteria 1961
43 Ga0075365_10106106 3300006038 Bacteria 1927
44 Ga0075365_10166973 3300006038 Bacteria 1535
45 Ga0075368_10010873 3300006042 Bacteria 3299
46 Ga0075368_10153643 3300006042 Bacteria 962
47 Ga0075363_100016740 3300006048 Bacteria 3626
48 Ga0075363_100083060 3300006048 Bacteria 1755
49 Ga0075363_100143112 3300006048 Bacteria 1347
50 Ga0075364_10005097 3300006051 Bacteria 7616
51 Ga0075364_10033248 3300006051 Bacteria 3319
52 Ga0075364_10036087 3300006051 Bacteria 3196
53 Ga0075367_10062920 3300006178 Bacteria 2217
54 Ga0097621_100416441 3300006237 Bacteria 1205
55 Ga0075370_10075923 3300006353 Bacteria 1927
56 Ga0075370_10086287 3300006353 Bacteria 1808
57 Ga0075434_101034757 3300006871 Bacteria 835
58 Ga0068865_100011964 3300006881 Bacteria 5450
59 Ga0068865_100331270 3300006881 Bacteria 1228
60 Ga0068865_100690914 3300006881 Bacteria 871
61 Ga0111539_10265028 3300009094 Bacteria 2000
62 Ga0105245_10143258 3300009098 Bacteria 2253
63 Ga0105247_10279611 3300009101 Bacteria 1151
64 Ga0105243_10077616 3300009148 Bacteria 2702
65 Ga0105243_10089865 3300009148 Bacteria 2526
66 Ga0105242_10017827 3300009176 Bacteria 5540
67 Ga0105242_10233791 3300009176 Bacteria 1648
68 Ga0105248_10084475 3300009177 Bacteria 3571
69 Ga0105237_10078109 3300009545 Bacteria 3300
70 Ga0105238_10137621 3300009551 Bacteria 2420
71 Ga0105249_10022405 3300009553 Bacteria 5658
72 Ga0105249_10038267 3300009553 Bacteria 4352
73 Ga0105249_10110956 3300009553 Bacteria 2593
74 Ga0105249_10687293 3300009553 Bacteria 1083
75 Ga0105239_10006702 3300010375 Bacteria 13304
76 Ga0105239_10033867 3300010375 Bacteria 5607
77 Ga0105239_10061481 3300010375 Bacteria 4122
78 Ga0105246_10008957 3300011119 Bacteria 6161
79 Ga0105246_10041171 3300011119 Bacteria 3121
80 Ga0105246_10718483 3300011119 Bacteria 877
81 Ga0157371_10050662 3300013102 Bacteria 2951
82 Ga0157369_10723118 3300013105 Bacteria 1025
83 Ga0157378_10017738 3300013297 Bacteria 6249
84 Ga0157372_10001978 3300013307 Bacteria 22270
85 Ga0157375_10077966 3300013308 Bacteria 3345
86 Ga0157375_10146145 3300013308 Bacteria 2495
87 Ga0157375_10192288 3300013308 Bacteria 2196
88 Ga0157375_10217523 3300013308 Bacteria 2068
89 Ga0157375_10278412 3300013308 Bacteria 1836
90 Ga0157375_10609304 3300013308 Bacteria 1251
91 Ga0163163_10042642 3300014325 Bacteria 4445
92 Ga0163163_10161588 3300014325 Bacteria 2285
93 Ga0157379_10071807 3300014968 Bacteria 3096
94 Ga0163161_10006768 3300017792 Bacteria 7918
95 Ga0163161_10020140 3300017792 Bacteria 4678
96 Ga0207671_10082510 3300025914 Bacteria 2412
97 Ga0207662_10058287 3300025918 Bacteria 2311
98 Ga0207662_10531620 3300025918 Bacteria 813
99 Ga0207649_10448325 3300025920 Bacteria 973
100 Ga0207694_10200442 3300025924 Bacteria 1624
101 Ga0207659_10351175 3300025926 Bacteria 1224
102 Ga0207687_10079160 3300025927 Bacteria 2369
103 Ga0207690_10042199 3300025932 Bacteria 2994
104 Ga0207690_10132728 3300025932 Bacteria 1825
105 Ga0207706_10175258 3300025933 Bacteria 1884
106 Ga0207686_10028502 3300025934 Bacteria 3283
107 Ga0207686_10048428 3300025934 Bacteria 2633
108 Ga0207709_10115326 3300025935 Bacteria 1804
109 Ga0207704_10076011 3300025938 Bacteria 2150
110 Ga0207704_10486035 3300025938 Bacteria 992
111 Ga0207711_10444458 3300025941 Bacteria 1207
112 Ga0207711_10523434 3300025941 Bacteria 1106
113 Ga0207661_10073738 3300025944 Bacteria 2796
114 Ga0207679_10079400 3300025945 Bacteria 2502
115 Ga0207679_10082496 3300025945 Bacteria 2461
116 Ga0207679_10172334 3300025945 Bacteria 1783
117 Ga0207712_10079091 3300025961 Bacteria 2388
118 Ga0207639_10703638 3300026041 Bacteria 937
119 Ga0207678_10138868 3300026067 Bacteria 2074
120 Ga0207708_10119887 3300026075 Bacteria 2049
121 Ga0207641_10417742 3300026088 Bacteria 1291
122 Ga0207674_10005576 3300026116 Bacteria 14923
123 Ga0207675_100257201 3300026118 Bacteria 1691
124 Ga0207675_100660584 3300026118 Bacteria 1052
125 Ga0207683_10045451 3300026121 Bacteria 3840
126 Ga0207683_10129075 3300026121 Bacteria 2273
127 Ga0207683_10204444 3300026121 Bacteria 1796
128 Ga0207683_10245742 3300026121 Bacteria 1632
129 Ga0307407_10026700 3300031903 Bacteria 3062
130 Ga0307412_10071683 3300031911 Bacteria 2366
131 Ga0307412_10406494 3300031911 Bacteria 1110
132 Ga0307409_100306943 3300031995 Bacteria 1479
133 Ga0307416_100435422 3300032002 Bacteria 1360
134 Ga0307416_100676688 3300032002 Bacteria 1119
135 Ga0307416_100915833 3300032002 Bacteria 977
136 Ga0307411_10225948 3300032005 Bacteria 1456
137 Ga0395900_0199894 3300037418 Bacteria 2023
138 Ga0395900_0481153 3300037418 Bacteria 1194
139 Ga0395898_0027346 3300037466 Bacteria 5728
140 Ga0395905_0124478 3300037471 Bacteria 2424
141 Ga0395901_0030928 3300038443 Bacteria 5518
142 Ga0395901_0097351 3300038443 Bacteria 3084
143 Ga0395901_0509161 3300038443 Bacteria 1225
144 Ga0439461_0008768 3300041410 Bacteria 1821
145 Ga0439465_0119253 3300041413 Bacteria 924
146 Ga0451795_0303526 3300041456 Bacteria 875
147 Ga0439431_0024722 3300041997 Bacteria 1463
148 Ga0439442_004442 3300042002 Bacteria 2786
149 Ga0450906_021888 3300042145 Bacteria 1141
150 Ga0466969_0044370 3300044656 Bacteria 2212
151 Ga0466965_0008590 3300044683 Bacteria 4726
152 Ga0466965_0053332 3300044683 Bacteria 2010
153 Ga0466966_0068308 3300044684 Bacteria 2231
154 Ga0466966_0090068 3300044684 Bacteria 1905
155 Ga0466966_0321971 3300044684 Bacteria 929
156 Ga0466961_0016163 3300044693 Bacteria 4791
157 Ga0466961_0040268 3300044693 Bacteria 2996
158 Ga0466961_0072826 3300044693 Bacteria 2179
159 Ga0466961_0084825 3300044693 Bacteria 2003
160 Ga0466961_0242222 3300044693 Bacteria 1108
161 Ga0466963_0042480 3300044694 Bacteria 2986
162 Ga0466963_0074109 3300044694 Bacteria 2295
163 Ga0466963_0106520 3300044694 Bacteria 1922
164 Ga0466964_0029749 3300044706 Bacteria 2158
165 Ga0466971_0017968 3300044719 Bacteria 3132
166 Ga0466971_0168354 3300044719 Bacteria 1027
167 Ga0466971_0194726 3300044719 Bacteria 956
168 Ga0466968_0039580 3300044735 Bacteria 1985
169 Ga0466970_0005256 3300044765 Bacteria 6410
170 Ga0466970_0010061 3300044765 Bacteria 4791
171 Ga0466970_0015566 3300044765 Bacteria 3916
172 Ga0466970_0085579 3300044765 Bacteria 1708
173 Ga0466970_0086765 3300044765 Bacteria 1696
174 Ga0466970_0128093 3300044765 Bacteria 1393
175 Ga0466957_0026499 3300044842 Bacteria 3439
176 Ga0466957_0075184 3300044842 Bacteria 2096
177 Ga0466960_0003550 3300044901 Bacteria 6007
178 Ga0466960_0018576 3300044901 Bacteria 3050
179 Ga0466960_0022410 3300044901 Bacteria 2824
180 Ga0466960_0195151 3300044901 Bacteria 1104
181 Ga0466958_0146755 3300045836 Bacteria 1487
182 Ga0466958_0224229 3300045836 Bacteria 1199
183 Ga0466967_0009682 3300045976 Bacteria 7170
184 Ga0466967_0130773 3300045976 Bacteria 2330
185 Ga0466967_0275853 3300045976 Bacteria 1612
186 Ga0495651_0182329 3300046462 Bacteria 1485
187 Ga0495596_0084798 3300046500 Bacteria 1230
188 Ga0495657_0039953 3300046675 Bacteria 3221
189 Ga0496100_0185774 3300048903 Bacteria 1506
190 Ga0496101_0166642 3300048904 Bacteria 1692
191 Ga0496102_0201078 3300048905 Bacteria 1878
192 Ga0496105_0030783 3300048908 Bacteria 4399
193 Ga0496105_0182828 3300048908 Bacteria 1716
194 Ga0496107_0248918 3300048910 Bacteria 1322
195 Ga0496108_0016404 3300048911 Bacteria 6041
196 Ga0496108_0488962 3300048911 Bacteria 1075
197 Ga0496109_0019495 3300048912 Bacteria 5985
198 Ga0496109_0647431 3300048912 Bacteria 994
199 Ga0496109_0859610 3300048912 Bacteria 845
200 Ga0496110_0074536 3300048913 Bacteria 3014
201 Ga0496110_0107510 3300048913 Bacteria 2504
202 Ga0496110_0313397 3300048913 Bacteria 1429
203 Ga0496111_0077406 3300048914 Bacteria 2425
204 Ga0496111_0103753 3300048914 Bacteria 2091
205 Ga0496114_0032018 3300048917 Bacteria 4326
206 Ga0496114_0056858 3300048917 Bacteria 3265
207 Ga0496115_0042986 3300048918 Bacteria 3602
208 Ga0496124_0380761 3300048927 Bacteria 987
209 Ga0501031_0017126 3300049568 Bacteria 4708
210 Ga0501031_0022651 3300049568 Bacteria 4094
211 Ga0501031_0317799 3300049568 Bacteria 1009
212 Ga0501033_0079158 3300049570 Bacteria 2412
213 Ga0501033_0259536 3300049570 Bacteria 1230
214 Ga0501034_0133787 3300049571 Bacteria 2462
215 Ga0501036_0025787 3300049572 Bacteria 4961
216 Ga0501036_0087572 3300049572 Bacteria 2632
217 Ga0501036_0249327 3300049572 Bacteria 1488
218 Ga0501037_0027093 3300049573 Bacteria 4234
219 Ga0501038_0006904 3300049574 Bacteria 10487
220 Ga0501039_0228325 3300049575 Bacteria 1463
221 Ga0501040_0254375 3300049576 Bacteria 1253
222 Ga0501042_0024820 3300049578 Bacteria 4208
223 Ga0501042_0061566 3300049578 Bacteria 2682
224 Ga0501042_0350107 3300049578 Bacteria 1068
225 Ga0501043_0188975 3300049579 Bacteria 1602
226 Ga0501043_0385231 3300049579 Bacteria 1061
227 Ga0501046_0197830 3300049580 Bacteria 1496
228 Ga0501047_0082927 3300049581 Bacteria 3081
229 Ga0501048_0062605 3300049582 Bacteria 2633
230 Ga0501048_0092715 3300049582 Bacteria 2130
231 Ga0501067_0159297 3300049583 Bacteria 1257
232 Ga0501068_0067718 3300049584 Bacteria 2176
233 Ga0501069_0107600 3300049585 Bacteria 1586
234 Ga0501070_0159891 3300049586 Bacteria 1857
235 Ga0501070_0166360 3300049586 Bacteria 1817
236 Ga0501070_0188779 3300049586 Bacteria 1694
237 Ga0501070_0299358 3300049586 Bacteria 1310
238 Ga0501071_0093632 3300049587 Bacteria 2209
239 Ga0501071_0166585 3300049587 Bacteria 1649
240 Ga0501074_0071167 3300049590 Bacteria 2500
241 Ga0501075_0187903 3300049591 Bacteria 1576
242 Ga0501076_0176264 3300049592 Bacteria 1742
243 Ga0501079_0367415 3300049741 Bacteria 1128
244 Ga0501079_0372750 3300049741 Bacteria 1119
245 Ga0501080_0307613 3300049742 Bacteria 1437
246 Ga0501081_0084870 3300049743 Bacteria 2222
247 Ga0501035_0038082 3300049822 Bacteria 4354
248 Ga0501044_0060720 3300049823 Bacteria 3869
249 Ga0501044_0602852 3300049823 Bacteria 991
250 Ga0501045_0028006 3300049824 Bacteria 4064
251 nmdc:mga03683_169182_c1 3300050489 Bacteria 992
252 nmdc:mga03n38_96126_c1 3300050490 Bacteria 1420
253 nmdc:mga00v17_109766_c1 3300050491 Bacteria 1749
254 nmdc:mga00v17_11412_c1 3300050491 Bacteria 4883
255 nmdc:mga00v17_64690_c1 3300050491 Bacteria 2254
256 nmdc:mga00v17_80683_c1 3300050491 Bacteria 2030
257 nmdc:mga0yw44_103023_c1 3300050492 Bacteria 1820
258 nmdc:mga0yw44_123095_c1 3300050492 Bacteria 1672
259 nmdc:mga0yw44_158280_c1 3300050492 Bacteria 1482
260 nmdc:mga0yw44_265814_c1 3300050492 Bacteria 1144
261 nmdc:mga0yw44_309822_c1 3300050492 Bacteria 1059
262 nmdc:mga0yw44_36181_c1 3300050492 Bacteria 2908
263 nmdc:mga0yw44_90107_c1 3300050492 Bacteria 1937
264 nmdc:mga04h51_30822_c1 3300050495 Bacteria 1690
265 nmdc:mga04h51_50326_c1 3300050495 Bacteria 1395
266 nmdc:mga07m45_147999_c1 3300050496 Bacteria 1361
267 nmdc:mga08y16_588830_c1 3300050511 Bacteria 1122
268 nmdc:mga0n895_964387_c1 3300050512 Bacteria 835
269 Ga0495619_0191792 3300053085 Bacteria 1414
270 Ga0500644_0000054 3300053088 Bacteria 69110
271 Ga0500554_056793 3300053102 Bacteria 1246
272 Ga0500556_0000337 3300053104 Bacteria 34999
273 Ga0500593_001785 3300053117 Bacteria 7738
274 Ga0500573_0090545 3300053140 Bacteria 1728
275 Ga0501082_0433557 3300060353 Bacteria 1148
276 Ga0466962_0053924 3300061719 Bacteria 1921
277 2643827796 2643221561 Bacteria 4984412
278 2644091280 2643221615 Bacteria 5487866
279 2644230950 2643221641 Bacteria 4490190
280 2644321083 2643221657 Bacteria 5490246
281 2644532436 2643221696 Bacteria 5431823
282 2855389449 2855386786 Bacteria 4752232
283 8054610151 8054609563 Bacteria 5170090
284 Ga0466970_0077578
285 rootL2_10035056
286 Ga0070683_100005530
287 Ga0070670_100105482
288 Ga0070682_100019877
289 Ga0070682_100241035
290 Ga0070661_100148411
291 Ga0070661_100640521
292 Ga0070692_10246607
293 Ga0070668_100127081
294 Ga0070668_100288794
295 Ga0070675_100343704
296 Ga0070659_100030409
297 Ga0070659_100047702
298 Ga0070705_100043386
299 Ga0070663_100034124
300 Ga0070663_100115615
301 Ga0070678_100098442
302 Ga0070678_100158381
303 Ga0070678_100226860
304 Ga0070678_100398647
305 Ga0070685_10154065
306 Ga0070698_100034543
307 Ga0070684_100015715
308 Ga0068853_100400787
309 Ga0070696_100167676
310 Ga0070665_100104887
311 Ga0070664_100017541
312 Ga0070664_100027901
313 Ga0070664_100508413
314 Ga0068857_100010597
315 Ga0068856_100019566
316 Ga0070702_100002630
317 Ga0070702_100025226
318 Ga0068866_10039416
319 Ga0068861_100201224
320 Ga0068858_100144367
321 Ga0068862_100929952
322 Ga0081539_10095692
323 Ga0075365_10016958
324 Ga0075365_10094247
325 Ga0075365_10102475
326 Ga0075365_10106106
327 Ga0075365_10166973
328 Ga0075368_10010873
329 Ga0075368_10153643
330 Ga0075363_100016740
331 Ga0075363_100083060
332 Ga0075363_100143112
333 Ga0075364_10005097
334 Ga0075364_10033248
335 Ga0075364_10036087
336 Ga0075367_10062920
337 Ga0097621_100416441
338 Ga0075370_10075923
339 Ga0075370_10086287
340 Ga0075434_101034757
341 Ga0068865_100011964
342 Ga0068865_100331270
343 Ga0068865_100690914
344 Ga0111539_10265028
345 Ga0105245_10143258
346 Ga0105247_10279611
347 Ga0105243_10077616
348 Ga0105243_10089865
349 Ga0105242_10017827
350 Ga0105242_10233791
351 Ga0105248_10084475
352 Ga0105237_10078109
353 Ga0105238_10137621
354 Ga0105249_10022405
355 Ga0105249_10038267
356 Ga0105249_10110956
357 Ga0105249_10687293
358 Ga0105239_10006702
359 Ga0105239_10033867
360 Ga0105239_10061481
361 Ga0105246_10008957
362 Ga0105246_10041171
363 Ga0105246_10718483
364 Ga0157371_10050662
365 Ga0157369_10723118
366 Ga0157378_10017738
367 Ga0157372_10001978
368 Ga0157375_10077966
369 Ga0157375_10146145
370 Ga0157375_10192288
371 Ga0157375_10217523
372 Ga0157375_10278412
373 Ga0157375_10609304
374 Ga0163163_10042642
375 Ga0163163_10161588
376 Ga0157379_10071807
377 Ga0163161_10006768
378 Ga0163161_10020140
379 Ga0207671_10082510
380 Ga0207662_10058287
381 Ga0207662_10531620
382 Ga0207649_10448325
383 Ga0207694_10200442
384 Ga0207659_10351175
385 Ga0207687_10079160
386 Ga0207690_10042199
387 Ga0207690_10132728
388 Ga0207706_10175258
389 Ga0207686_10028502
390 Ga0207686_10048428
391 Ga0207709_10115326
392 Ga0207704_10076011
393 Ga0207704_10486035
394 Ga0207711_10444458
395 Ga0207711_10523434
396 Ga0207661_10073738
397 Ga0207679_10079400
398 Ga0207679_10082496
399 Ga0207679_10172334
400 Ga0207712_10079091
401 Ga0207639_10703638
402 Ga0207678_10138868
403 Ga0207708_10119887
404 Ga0207641_10417742
405 Ga0207674_10005576
406 Ga0207675_100257201
407 Ga0207675_100660584
408 Ga0207683_10045451
409 Ga0207683_10129075
410 Ga0207683_10204444
411 Ga0207683_10245742
412 Ga0307407_10026700
413 Ga0307412_10071683
414 Ga0307412_10406494
415 Ga0307409_100306943
416 Ga0307416_100435422
417 Ga0307416_100676688
418 Ga0307416_100915833
419 Ga0307411_10225948
420 Ga0395900_0199894
421 Ga0395900_0481153
422 Ga0395898_0027346
423 Ga0395905_0124478
424 Ga0395901_0030928
425 Ga0395901_0097351
426 Ga0395901_0509161
427 Ga0439461_0008768
428 Ga0439465_0119253
429 Ga0451795_0303526
430 Ga0439431_0024722
431 Ga0439442_004442
432 Ga0450906_021888
433 Ga0466969_0044370
434 Ga0466965_0008590
435 Ga0466965_0053332
436 Ga0466966_0068308
437 Ga0466966_0090068
438 Ga0466966_0321971
439 Ga0466961_0016163
440 Ga0466961_0040268
441 Ga0466961_0072826
442 Ga0466961_0084825
443 Ga0466961_0242222
444 Ga0466963_0042480
445 Ga0466963_0074109
446 Ga0466963_0106520
447 Ga0466964_0029749
448 Ga0466971_0017968
449 Ga0466971_0168354
450 Ga0466971_0194726
451 Ga0466968_0039580
452 Ga0466970_0005256
453 Ga0466970_0010061
454 Ga0466970_0015566
455 Ga0466970_0085579
456 Ga0466970_0086765
457 Ga0466970_0128093
458 Ga0466957_0026499
459 Ga0466957_0075184
460 Ga0466960_0003550
461 Ga0466960_0018576
462 Ga0466960_0022410
463 Ga0466960_0195151
464 Ga0466958_0146755
465 Ga0466958_0224229
466 Ga0466967_0009682
467 Ga0466967_0130773
468 Ga0466967_0275853
469 Ga0495651_0182329
470 Ga0495596_0084798
471 Ga0495657_0039953
472 Ga0496100_0185774
473 Ga0496101_0166642
474 Ga0496102_0201078
475 Ga0496105_0030783
476 Ga0496105_0182828
477 Ga0496107_0248918
478 Ga0496108_0016404
479 Ga0496108_0488962
480 Ga0496109_0019495
481 Ga0496109_0647431
482 Ga0496109_0859610
483 Ga0496110_0074536
484 Ga0496110_0107510
485 Ga0496110_0313397
486 Ga0496111_0077406
487 Ga0496111_0103753
488 Ga0496114_0032018
489 Ga0496114_0056858
490 Ga0496115_0042986
491 Ga0496124_0380761
492 Ga0501031_0017126
493 Ga0501031_0022651
494 Ga0501031_0317799
495 Ga0501033_0079158
496 Ga0501033_0259536
497 Ga0501034_0133787
498 Ga0501036_0025787
499 Ga0501036_0087572
500 Ga0501036_0249327
501 Ga0501037_0027093
502 Ga0501038_0006904
503 Ga0501039_0228325
504 Ga0501040_0254375
505 Ga0501042_0024820
506 Ga0501042_0061566
507 Ga0501042_0350107
508 Ga0501043_0188975
509 Ga0501043_0385231
510 Ga0501046_0197830
511 Ga0501047_0082927
512 Ga0501048_0062605
513 Ga0501048_0092715
514 Ga0501067_0159297
515 Ga0501068_0067718
516 Ga0501069_0107600
517 Ga0501070_0159891
518 Ga0501070_0166360
519 Ga0501070_0188779
520 Ga0501070_0299358
521 Ga0501071_0093632
522 Ga0501071_0166585
523 Ga0501074_0071167
524 Ga0501075_0187903
525 Ga0501076_0176264
526 Ga0501079_0367415
527 Ga0501079_0372750
528 Ga0501080_0307613
529 Ga0501081_0084870
530 Ga0501035_0038082
531 Ga0501044_0060720
532 Ga0501044_0602852
533 Ga0501045_0028006
534 nmdc:mga03683_169182_c1
535 nmdc:mga03n38_96126_c1
536 nmdc:mga00v17_109766_c1
537 nmdc:mga00v17_11412_c1
538 nmdc:mga00v17_64690_c1
539 nmdc:mga00v17_80683_c1
540 nmdc:mga0yw44_103023_c1
541 nmdc:mga0yw44_123095_c1
542 nmdc:mga0yw44_158280_c1
543 nmdc:mga0yw44_265814_c1
544 nmdc:mga0yw44_309822_c1
545 nmdc:mga0yw44_36181_c1
546 nmdc:mga0yw44_90107_c1
547 nmdc:mga04h51_30822_c1
548 nmdc:mga04h51_50326_c1
549 nmdc:mga07m45_147999_c1
550 nmdc:mga08y16_588830_c1
551 nmdc:mga0n895_964387_c1
552 Ga0495619_0191792
553 Ga0500644_0000054
554 Ga0500554_056793
555 Ga0500556_0000337
556 Ga0500593_001785
557 Ga0500573_0090545
558 Ga0501082_0433557
559 Ga0466962_0053924
560 2643827796
561 2644091280
562 2644230950
563 2644321083
564 2644532436
565 2855389449
566 8054610151

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

13

243

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.6313 6 247
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.6008 6 247
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5926 6 247
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5688 6 247
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.3875 11 255
ID Description Score Start End Superfamily
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5 76 249 1.20.1250.20
af_B7YZU1_345_528_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4798 6 255 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4722 76 249 1.20.1250.20
af_Q2G1I0_8_408_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4689 43 249 1.20.1250.20
af_B7YZU1_345_528_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4606 6 255 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2S6IVH8-F1-model_v4 Probable membrane transporter protein 0.9928 3 255 GO:0005886
AF-A0A1I1AUT5-F1-model_v4 Probable membrane transporter protein 0.9924 2 255 GO:0005886
AF-A0A2E8P895-F1-model_v4 Probable membrane transporter protein 0.9912 10 249 GO:0005886
AF-A0A6J7JFH6-F1-model_v4 Unannotated protein 0.9889 2 255 GO:0005886
AF-A0A6J7L941-F1-model_v4 Unannotated protein 0.9875 3 252 GO:0005886

Map