F385741

General Info

Members Datasets Scaffolds Average Seq Length
283 175 283 129

Family's Representative Sequence

Representative Sequence 3300042993|Ga0439440_0102269|Ga0439440_0102269_246_719
Length 157
Sequence MCSQAASGAPRTHGSDVADHGEVLDRIRELCLALPEASERLSHGHPTFFVRGKRSFAMVLNDHHGDGRFALWAAAEDGVQQMLVEADPERFFRPPYVGHRGWLGLRLDRELHWDELAGILEDAYVEVAPPKLVEEARSSVSRLGRAAARPRPERRRA

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
93 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
94 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
111 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
112 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
113 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
114 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
115 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
116 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
125 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
172 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 16.96
Rhizosphere 82.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10018484 3300003373 Bacteria 1811
2 Ga0070683_101732591 3300005329 Bacteria 601
3 Ga0070683_101971598 3300005329 Bacteria 561
4 Ga0068869_100408528 3300005334 Unclassified 1118
5 Ga0070682_100242239 3300005337 Bacteria 1295
6 Ga0068868_100616758 3300005338 Bacteria 963
7 Ga0070660_100401786 3300005339 Bacteria 1133
8 Ga0070668_100405661 3300005347 Unclassified 1164
9 Ga0070675_100240988 3300005354 Bacteria 1580
10 Ga0070671_100503233 3300005355 Bacteria 1042
11 Ga0070671_101181411 3300005355 Bacteria 673
12 Ga0070703_10030073 3300005406 Unclassified 1634
13 Ga0070709_11133290 3300005434 Bacteria 627
14 Ga0070711_100062941 3300005439 Bacteria 2588
15 Ga0070705_100121284 3300005440 Bacteria 1689
16 Ga0070700_101731002 3300005441 Bacteria 537
17 Ga0070694_101011834 3300005444 Unclassified 690
18 Ga0070662_100208247 3300005457 Unclassified 1555
19 Ga0068867_102008449 3300005459 Bacteria 547
20 Ga0070707_100001545 3300005468 Bacteria 22379
21 Ga0070698_100169724 3300005471 Bacteria 2123
22 Ga0070699_100007390 3300005518 Bacteria 9566
23 Ga0070699_100102204 3300005518 Unclassified 2513
24 Ga0070699_100528330 3300005518 Bacteria 1073
25 Ga0070679_100135293 3300005530 Bacteria 2446
26 Ga0070684_101885629 3300005535 Bacteria 564
27 Ga0070697_100389075 3300005536 Unclassified 1209
28 Ga0070697_100668267 3300005536 Bacteria 915
29 Ga0070697_100806777 3300005536 Bacteria 831
30 Ga0070695_100424789 3300005545 Bacteria 1013
31 Ga0070696_101512114 3300005546 Bacteria 575
32 Ga0070704_100480951 3300005549 Bacteria 1074
33 Ga0068855_100297257 3300005563 Bacteria 1789
34 Ga0068855_101374997 3300005563 Bacteria 728
35 Ga0068854_100311289 3300005578 Bacteria 1277
36 Ga0068856_100044185 3300005614 Bacteria 4383
37 Ga0068856_100073012 3300005614 Bacteria 3397
38 Ga0068856_100363779 3300005614 Bacteria 1465
39 Ga0068852_100060850 3300005616 Bacteria 3279
40 Ga0068866_10924108 3300005718 Bacteria 615
41 Ga0068861_101039802 3300005719 Bacteria 784
42 Ga0068861_101128714 3300005719 Bacteria 755
43 Ga0068862_100827490 3300005844 Bacteria 906
44 Ga0081538_10003340 3300005981 Bacteria 15197
45 Ga0081538_10086982 3300005981 Unclassified 1634
46 Ga0081539_10004826 3300005985 Bacteria 14460
47 Ga0070716_100016338 3300006173 Bacteria 3827
48 Ga0070712_100092387 3300006175 Bacteria 2219
49 Ga0070712_101870799 3300006175 Bacteria 526
50 Ga0075428_100189782 3300006844 Bacteria 2223
51 Ga0075430_100360392 3300006846 Bacteria 1201
52 Ga0075434_100976981 3300006871 Bacteria 861
53 Ga0075434_101986380 3300006871 Bacteria 587
54 Ga0075429_100097700 3300006880 Bacteria 2562
55 Ga0105250_10185692 3300009092 Bacteria 873
56 Ga0105240_10009411 3300009093 Bacteria 13835
57 Ga0111539_10423244 3300009094 Unclassified 1551
58 Ga0111539_11309406 3300009094 Bacteria 841
59 Ga0105245_10097708 3300009098 Bacteria 2712
60 Ga0105245_10358978 3300009098 Unclassified 1446
61 Ga0105245_10598510 3300009098 Bacteria 1129
62 Ga0105245_12810837 3300009098 Bacteria 539
63 Ga0114129_10123289 3300009147 Bacteria 3564
64 Ga0114129_11928292 3300009147 Bacteria 716
65 Ga0105243_12147024 3300009148 Bacteria 595
66 Ga0105241_12133659 3300009174 Unclassified 554
67 Ga0105242_10456933 3300009176 Unclassified 1205
68 Ga0105242_12382241 3300009176 Bacteria 577
69 Ga0105248_11860205 3300009177 Bacteria 683
70 Ga0105249_10051114 3300009553 Bacteria 3769
71 Ga0105239_10123939 3300010375 Bacteria 2871
72 Ga0105239_10290326 3300010375 Bacteria 1842
73 Ga0105239_10605046 3300010375 Bacteria 1250
74 Ga0105239_11523009 3300010375 Unclassified 773
75 Ga0157370_10012219 3300013104 Bacteria 8922
76 Ga0157369_10016287 3300013105 Bacteria 8368
77 Ga0157369_10028592 3300013105 Bacteria 6169
78 Ga0157374_10400432 3300013296 Bacteria 1369
79 Ga0157378_10129815 3300013297 Bacteria 2332
80 Ga0163162_10377267 3300013306 Bacteria 1551
81 Ga0157372_10750799 3300013307 Bacteria 1134
82 Ga0157372_11081163 3300013307 Bacteria 928
83 Ga0157372_11449818 3300013307 Bacteria 791
84 Ga0157380_12395495 3300014326 Bacteria 593
85 Ga0182008_10142329 3300014497 Bacteria 1200
86 Ga0157376_12641897 3300014969 Bacteria 542
87 Ga0206353_11869344 3300020082 Bacteria 1077
88 Ga0207642_10211976 3300025899 Bacteria 1077
89 Ga0207688_10550590 3300025901 Bacteria 725
90 Ga0207699_10015052 3300025906 Bacteria 4009
91 Ga0207699_10070881 3300025906 Bacteria 2129
92 Ga0207699_10266422 3300025906 Bacteria 1186
93 Ga0207705_10552183 3300025909 Bacteria 895
94 Ga0207684_10262011 3300025910 Bacteria 1492
95 Ga0207684_10340008 3300025910 Bacteria 1292
96 Ga0207684_11663489 3300025910 Bacteria 515
97 Ga0207707_10685175 3300025912 Bacteria 862
98 Ga0207695_10064421 3300025913 Bacteria 3774
99 Ga0207693_10032228 3300025915 Bacteria 4137
100 Ga0207693_10049473 3300025915 Bacteria 3301
101 Ga0207652_10596154 3300025921 Bacteria 991
102 Ga0207646_10003800 3300025922 Bacteria 16799
103 Ga0207646_10433063 3300025922 Bacteria 1187
104 Ga0207659_10129930 3300025926 Bacteria 1943
105 Ga0207687_10580410 3300025927 Bacteria 943
106 Ga0207687_11535657 3300025927 Bacteria 572
107 Ga0207700_10000001 3300025928 Bacteria 1122509
108 Ga0207690_10602243 3300025932 Bacteria 897
109 Ga0207706_10257691 3300025933 Unclassified 1523
110 Ga0207686_10115638 3300025934 Unclassified 1817
111 Ga0207709_10371458 3300025935 Bacteria 1085
112 Ga0207709_10777015 3300025935 Bacteria 772
113 Ga0207665_10805921 3300025939 Bacteria 742
114 Ga0207661_11303777 3300025944 Bacteria 667
115 Ga0207667_10066297 3300025949 Bacteria 3764
116 Ga0207667_10401016 3300025949 Bacteria 1396
117 Ga0207712_10079237 3300025961 Bacteria 2386
118 Ga0207712_10105697 3300025961 Bacteria 2101
119 Ga0207640_10116195 3300025981 Bacteria 1907
120 Ga0207677_10110742 3300026023 Bacteria 2044
121 Ga0207677_10547431 3300026023 Bacteria 1008
122 Ga0207708_11200589 3300026075 Bacteria 663
123 Ga0207702_10246462 3300026078 Bacteria 1676
124 Ga0207702_10349662 3300026078 Bacteria 1414
125 Ga0207648_10704214 3300026089 Bacteria 936
126 Ga0207675_100071207 3300026118 Bacteria 3250
127 Ga0207698_10171874 3300026142 Bacteria 1909
128 Ga0207698_10578659 3300026142 Bacteria 1104
129 Ga0268265_11366404 3300028380 Bacteria 710
130 Ga0265319_1000580 3300028563 Bacteria 24559
131 Ga0265318_10004863 3300028577 Bacteria 6414
132 Ga0265322_10007892 3300028654 Bacteria 3101
133 Ga0265338_10017691 3300028800 Bacteria 7664
134 Ga0265332_10080931 3300031238 Bacteria 1378
135 Ga0265328_10147233 3300031239 Bacteria 885
136 Ga0265320_10002170 3300031240 Bacteria 13780
137 Ga0265325_10186358 3300031241 Bacteria 964
138 Ga0265340_10013224 3300031247 Bacteria 4343
139 Ga0265339_10049829 3300031249 Bacteria 2292
140 Ga0265331_10032085 3300031250 Bacteria 2605
141 Ga0265342_10429263 3300031712 Bacteria 680
142 Ga0373946_0631353 3300035171 Bacteria 557
143 Ga0395899_0017158 3300037312 Bacteria 5517
144 Ga0395899_0262595 3300037312 Unclassified 1180
145 Ga0395900_0003314 3300037418 Bacteria 17416
146 Ga0395900_0608823 3300037418 Bacteria 1032
147 Ga0395898_0001512 3300037466 Bacteria 32062
148 Ga0395898_0013643 3300037466 Bacteria 8360
149 Ga0395898_0267786 3300037466 Bacteria 1629
150 Ga0395905_0002367 3300037471 Bacteria 21005
151 Ga0395905_0059458 3300037471 Bacteria 3572
152 Ga0395905_0155707 3300037471 Bacteria 2149
153 Ga0395905_0759402 3300037471 Bacteria 872
154 Ga0395905_0898124 3300037471 Bacteria 789
155 Ga0395901_0002733 3300038443 Bacteria 17798
156 Ga0395901_0003788 3300038443 Bacteria 15226
157 Ga0395901_0074182 3300038443 Bacteria 3549
158 Ga0395901_0125263 3300038443 Bacteria 2700
159 Ga0395901_0159188 3300038443 Bacteria 2371
160 Ga0395901_0411056 3300038443 Bacteria 1389
161 Ga0395901_0611313 3300038443 Bacteria 1098
162 Ga0439436_0068066 3300041404 Bacteria 993
163 Ga0439439_0024699 3300041406 Bacteria 1509
164 Ga0439433_0001312 3300041999 Bacteria 5110
165 Ga0439442_008673 3300042002 Bacteria 2053
166 Ga0439462_0006019 3300042015 Bacteria 3002
167 Ga0439446_0000446 3300042156 Bacteria 8143
168 Ga0439440_0102269 3300042993 Unclassified 781
169 Ga0466967_1144606 3300045976 Bacteria 775
170 Ga0495630_0061079 3300046517 Bacteria 2830
171 Ga0495640_0243943 3300046533 Unclassified 1127
172 Ga0495645_0726221 3300046543 Bacteria 601
173 Ga0495635_0127279 3300046663 Bacteria 1737
174 Ga0495635_0870665 3300046663 Bacteria 578
175 Ga0495657_0666160 3300046675 Bacteria 599
176 Ga0495613_0919572 3300046689 Bacteria 565
177 Ga0495670_0421779 3300046691 Bacteria 722
178 Ga0495649_0587965 3300046694 Bacteria 550
179 Ga0495674_0050628 3300047319 Bacteria 3665
180 Ga0495680_0444145 3300047322 Bacteria 889
181 Ga0495684_0910608 3300047471 Bacteria 566
182 Ga0495602_0256222 3300048088 Bacteria 1301
183 Ga0496100_0015387 3300048903 Bacteria 4467
184 Ga0496100_0520918 3300048903 Bacteria 918
185 Ga0496100_0842068 3300048903 Bacteria 719
186 Ga0496101_0006361 3300048904 Bacteria 7603
187 Ga0496101_1563480 3300048904 Bacteria 513
188 Ga0496102_0012480 3300048905 Bacteria 7355
189 Ga0496102_0027563 3300048905 Bacteria 5073
190 Ga0496102_0098720 3300048905 Bacteria 2710
191 Ga0496102_0242331 3300048905 Bacteria 1700
192 Ga0496102_0296622 3300048905 Bacteria 1524
193 Ga0496103_0739738 3300048906 Bacteria 622
194 Ga0496104_0003357 3300048907 Bacteria 13829
195 Ga0496104_0078462 3300048907 Bacteria 3147
196 Ga0496105_0014719 3300048908 Bacteria 6228
197 Ga0496105_0142689 3300048908 Bacteria 1971
198 Ga0496105_0857281 3300048908 Bacteria 687
199 Ga0496106_0004029 3300048909 Bacteria 10982
200 Ga0496106_0010301 3300048909 Bacteria 6912
201 Ga0496106_0078261 3300048909 Bacteria 2537
202 Ga0496106_0174434 3300048909 Bacteria 1705
203 Ga0496107_0000820 3300048910 Bacteria 18076
204 Ga0496107_0294678 3300048910 Bacteria 1207
205 Ga0496107_0414943 3300048910 Bacteria 1001
206 Ga0496108_0004537 3300048911 Bacteria 11182
207 Ga0496108_0683742 3300048911 Bacteria 890
208 Ga0496108_1500274 3300048911 Bacteria 561
209 Ga0496109_0002702 3300048912 Bacteria 14874
210 Ga0496109_0179793 3300048912 Bacteria 1986
211 Ga0496109_0244170 3300048912 Bacteria 1690
212 Ga0496110_0005789 3300048913 Bacteria 9716
213 Ga0496110_0007971 3300048913 Bacteria 8485
214 Ga0496110_0327135 3300048913 Bacteria 1396
215 Ga0496111_0004616 3300048914 Bacteria 8717
216 Ga0496111_0076580 3300048914 Bacteria 2438
217 Ga0496111_0124141 3300048914 Bacteria 1908
218 Ga0496111_0316576 3300048914 Bacteria 1156
219 Ga0496112_0045614 3300048915 Bacteria 4297
220 Ga0496112_0067916 3300048915 Bacteria 3520
221 Ga0496112_0785735 3300048915 Bacteria 877
222 Ga0496113_0017764 3300048916 Bacteria 4945
223 Ga0496113_0106903 3300048916 Bacteria 2174
224 Ga0496113_0183346 3300048916 Bacteria 1660
225 Ga0496114_0022156 3300048917 Bacteria 5175
226 Ga0496114_0036931 3300048917 Bacteria 4039
227 Ga0496114_0298270 3300048917 Bacteria 1423
228 Ga0496114_0462203 3300048917 Bacteria 1123
229 Ga0496115_0444173 3300048918 Bacteria 1048
230 Ga0496115_0967317 3300048918 Bacteria 653
231 Ga0501033_0009092 3300049570 Bacteria 7665
232 Ga0501037_0192664 3300049573 Bacteria 1443
233 Ga0501038_0082343 3300049574 Bacteria 2710
234 Ga0501038_0551245 3300049574 Bacteria 877
235 Ga0501039_0272761 3300049575 Bacteria 1330
236 Ga0501040_0039241 3300049576 Bacteria 3220
237 Ga0501040_0055269 3300049576 Bacteria 2722
238 Ga0501041_0121699 3300049577 Bacteria 1622
239 Ga0501041_0153670 3300049577 Bacteria 1437
240 Ga0501041_0182807 3300049577 Bacteria 1312
241 Ga0501042_0127184 3300049578 Bacteria 1835
242 Ga0501042_0189672 3300049578 Bacteria 1483
243 Ga0501043_0459977 3300049579 Bacteria 955
244 Ga0501046_0105765 3300049580 Bacteria 2155
245 Ga0501046_0138495 3300049580 Bacteria 1843
246 Ga0501046_0326948 3300049580 Bacteria 1116
247 Ga0501048_0061507 3300049582 Bacteria 2659
248 Ga0501068_0007700 3300049584 Bacteria 5959
249 Ga0501069_0346940 3300049585 Bacteria 875
250 Ga0501071_0081349 3300049587 Bacteria 2370
251 Ga0501072_0373545 3300049588 Bacteria 1131
252 Ga0501072_0448732 3300049588 Bacteria 1021
253 Ga0501075_0297527 3300049591 Bacteria 1229
254 Ga0501076_0110897 3300049592 Bacteria 2217
255 Ga0501076_0789770 3300049592 Bacteria 783
256 Ga0501076_0981657 3300049592 Bacteria 696
257 Ga0501077_0188824 3300049593 Bacteria 1309
258 Ga0501077_0391323 3300049593 Bacteria 888
259 Ga0501079_0077761 3300049741 Bacteria 2566
260 Ga0501079_0100608 3300049741 Bacteria 2241
261 Ga0501079_0104519 3300049741 Bacteria 2197
262 Ga0501079_0249596 3300049741 Bacteria 1387
263 Ga0501079_0488563 3300049741 Bacteria 968
264 Ga0501080_1196293 3300049742 Bacteria 653
265 Ga0501080_1836526 3300049742 Bacteria 508
266 Ga0501081_0009723 3300049743 Bacteria 6270
267 Ga0501081_0117313 3300049743 Bacteria 1893
268 Ga0501045_0038299 3300049824 Bacteria 3487
269 nmdc:mga05p37_14008_c1 3300050507 Bacteria 4827
270 nmdc:mga09592_92638_c1 3300050508 Bacteria 2583
271 nmdc:mga06r32_1012529_c1 3300050510 Bacteria 783
272 nmdc:mga0n895_2007172_c1 3300050512 Bacteria 536
273 Ga0495595_0603654 3300053084 Bacteria 561
274 Ga0500568_0289819 3300053139 Bacteria 594
275 Ga0501084_0084765 3300054114 Bacteria 2660
276 Ga0501084_0777858 3300054114 Bacteria 806
277 Ga0501082_0046811 3300060353 Bacteria 3728
278 Ga0501082_0095704 3300060353 Bacteria 2566
279 Ga0501082_0193220 3300060353 Bacteria 1770
280 Ga0501082_0492696 3300060353 Bacteria 1071
281 Ga0530510_0026411 3300061734 Bacteria 4156
282 Ga0530510_0213104 3300061734 Bacteria 1435
283 Ga0530510_1177951 3300061734 Bacteria 587

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006173 Ga0070716_100016338 Ga0070716_1000163386 113
2 3300048088 Ga0495602_0256222 Ga0495602_0256222_789_1229 116
3 3300046543 Ga0495645_0726221 Ga0495645_0726221_79_462 120
4 3300049585 Ga0501069_0346940 Ga0501069_0346940_376_756 121
5 3300014969 Ga0157376_12641897 Ga0157376_126418971 122
6 3300037418 Ga0395900_0608823 Ga0395900_0608823_459_839 122
7 3300038443 Ga0395901_0611313 Ga0395901_0611313_291_671 122
8 3300005334 Ga0068869_100408528 Ga0068869_1004085282 123
9 3300005338 Ga0068868_100616758 Ga0068868_1006167581 123
10 3300005339 Ga0070660_100401786 Ga0070660_1004017862 123
11 3300005347 Ga0070668_100405661 Ga0070668_1004056612 123
12 3300005354 Ga0070675_100240988 Ga0070675_1002409882 123
13 3300005355 Ga0070671_101181411 Ga0070671_1011814111 123
14 3300005406 Ga0070703_10030073 Ga0070703_100300732 123
15 3300005434 Ga0070709_11133290 Ga0070709_111332901 123
16 3300005439 Ga0070711_100062941 Ga0070711_1000629411 123
17 3300005440 Ga0070705_100121284 Ga0070705_1001212842 123
18 3300005441 Ga0070700_101731002 Ga0070700_1017310021 123
19 3300005444 Ga0070694_101011834 Ga0070694_1010118342 123
20 3300005457 Ga0070662_100208247 Ga0070662_1002082473 123
21 3300005459 Ga0068867_102008449 Ga0068867_1020084491 123
22 3300005468 Ga0070707_100001545 Ga0070707_10000154515 123
23 3300005518 Ga0070699_100007390 Ga0070699_1000073903 123
24 3300005535 Ga0070684_101885629 Ga0070684_1018856291 123
25 3300005536 Ga0070697_100668267 Ga0070697_1006682672 123
26 3300005546 Ga0070696_101512114 Ga0070696_1015121141 123
27 3300005549 Ga0070704_100480951 Ga0070704_1004809512 123
28 3300005563 Ga0068855_100297257 Ga0068855_1002972572 123
29 3300005578 Ga0068854_100311289 Ga0068854_1003112892 123
30 3300005718 Ga0068866_10924108 Ga0068866_109241082 123
31 3300005719 Ga0068861_101039802 Ga0068861_1010398022 123
32 3300005719 Ga0068861_101128714 Ga0068861_1011287142 123
33 3300005844 Ga0068862_100827490 Ga0068862_1008274901 123
34 3300005985 Ga0081539_10004826 Ga0081539_1000482616 123
35 3300006175 Ga0070712_100092387 Ga0070712_1000923872 123
36 3300006175 Ga0070712_101870799 Ga0070712_1018707991 123
37 3300006871 Ga0075434_101986380 Ga0075434_1019863802 123
38 3300009092 Ga0105250_10185692 Ga0105250_101856922 123
39 3300009098 Ga0105245_10097708 Ga0105245_100977085 123
40 3300009098 Ga0105245_10358978 Ga0105245_103589781 123
41 3300009098 Ga0105245_10598510 Ga0105245_105985102 123
42 3300009176 Ga0105242_10456933 Ga0105242_104569332 123
43 3300009553 Ga0105249_10051114 Ga0105249_100511143 123
44 3300010375 Ga0105239_10123939 Ga0105239_101239392 123
45 3300010375 Ga0105239_10290326 Ga0105239_102903263 123
46 3300010375 Ga0105239_11523009 Ga0105239_115230092 123
47 3300013296 Ga0157374_10400432 Ga0157374_104004322 123
48 3300013297 Ga0157378_10129815 Ga0157378_101298152 123
49 3300013306 Ga0163162_10377267 Ga0163162_103772672 123
50 3300013307 Ga0157372_10750799 Ga0157372_107507991 123
51 3300013307 Ga0157372_11081163 Ga0157372_110811632 123
52 3300025899 Ga0207642_10211976 Ga0207642_102119761 123
53 3300025906 Ga0207699_10070881 Ga0207699_100708812 123
54 3300025910 Ga0207684_11663489 Ga0207684_116634891 123
55 3300025915 Ga0207693_10032228 Ga0207693_100322282 123
56 3300025915 Ga0207693_10049473 Ga0207693_100494733 123
57 3300025922 Ga0207646_10003800 Ga0207646_100038009 123
58 3300025926 Ga0207659_10129930 Ga0207659_101299303 123
59 3300025927 Ga0207687_10580410 Ga0207687_105804102 123
60 3300025932 Ga0207690_10602243 Ga0207690_106022432 123
61 3300025933 Ga0207706_10257691 Ga0207706_102576912 123
62 3300025934 Ga0207686_10115638 Ga0207686_101156383 123
63 3300025935 Ga0207709_10777015 Ga0207709_107770152 123
64 3300025949 Ga0207667_10401016 Ga0207667_104010162 123
65 3300025961 Ga0207712_10079237 Ga0207712_100792372 123
66 3300025961 Ga0207712_10105697 Ga0207712_101056975 123
67 3300025981 Ga0207640_10116195 Ga0207640_101161952 123
68 3300026023 Ga0207677_10110742 Ga0207677_101107422 123
69 3300026075 Ga0207708_11200589 Ga0207708_112005892 123
70 3300026089 Ga0207648_10704214 Ga0207648_107042142 123
71 3300026118 Ga0207675_100071207 Ga0207675_1000712073 123
72 3300028380 Ga0268265_11366404 Ga0268265_113664041 123
73 3300037312 Ga0395899_0262595 Ga0395899_0262595_179_562 123
74 3300037418 Ga0395900_0003314 Ga0395900_0003314_11044_11427 123
75 3300037466 Ga0395898_0001512 Ga0395898_0001512_20399_20782 123
76 3300037471 Ga0395905_0002367 Ga0395905_0002367_4878_5261 123
77 3300037471 Ga0395905_0059458 Ga0395905_0059458_259_639 123
78 3300038443 Ga0395901_0003788 Ga0395901_0003788_8726_9109 123
79 3300046517 Ga0495630_0061079 Ga0495630_0061079_2411_2800 123
80 3300047322 Ga0495680_0444145 Ga0495680_0444145_442_831 123
81 3300048903 Ga0496100_0842068 Ga0496100_0842068_109_489 123
82 3300048904 Ga0496101_1563480 Ga0496101_1563480_34_414 123
83 3300048905 Ga0496102_0098720 Ga0496102_0098720_575_955 123
84 3300048905 Ga0496102_0296622 Ga0496102_0296622_804_1184 123
85 3300048907 Ga0496104_0078462 Ga0496104_0078462_2700_3080 123
86 3300048909 Ga0496106_0078261 Ga0496106_0078261_1553_1933 123
87 3300048910 Ga0496107_0414943 Ga0496107_0414943_157_531 123
88 3300048911 Ga0496108_1500274 Ga0496108_1500274_154_534 123
89 3300048912 Ga0496109_0244170 Ga0496109_0244170_970_1350 123
90 3300048913 Ga0496110_0007971 Ga0496110_0007971_7721_8101 123
91 3300048914 Ga0496111_0076580 Ga0496111_0076580_12_392 123
92 3300048914 Ga0496111_0316576 Ga0496111_0316576_763_1143 123
93 3300048917 Ga0496114_0462203 Ga0496114_0462203_501_881 123
94 3300048918 Ga0496115_0967317 Ga0496115_0967317_241_621 123
95 3300049576 Ga0501040_0039241 Ga0501040_0039241_2810_3190 123
96 3300049577 Ga0501041_0153670 Ga0501041_0153670_571_951 123
97 3300049578 Ga0501042_0127184 Ga0501042_0127184_928_1308 123
98 3300049579 Ga0501043_0459977 Ga0501043_0459977_190_570 123
99 3300049580 Ga0501046_0138495 Ga0501046_0138495_1419_1799 123
100 3300049592 Ga0501076_0789770 Ga0501076_0789770_93_473 123
101 3300049593 Ga0501077_0391323 Ga0501077_0391323_265_645 123
102 3300049741 Ga0501079_0100608 Ga0501079_0100608_189_569 123
103 3300049743 Ga0501081_0117313 Ga0501081_0117313_1041_1421 123
104 3300050512 nmdc:mga0n895_2007172_c1 nmdc:mga0n895_2007172_c1_96_476 123
105 3300053139 Ga0500568_0289819 Ga0500568_0289819_109_498 123
106 3300054114 Ga0501084_0084765 Ga0501084_0084765_1165_1545 123
107 3300060353 Ga0501082_0193220 Ga0501082_0193220_716_1096 123
108 3300005329 Ga0070683_101971598 Ga0070683_1019715981 124
109 3300005471 Ga0070698_100169724 Ga0070698_1001697242 124
110 3300005518 Ga0070699_100102204 Ga0070699_1001022044 124
111 3300005518 Ga0070699_100528330 Ga0070699_1005283302 124
112 3300005981 Ga0081538_10086982 Ga0081538_100869823 124
113 3300006844 Ga0075428_100189782 Ga0075428_1001897822 124
114 3300009094 Ga0111539_11309406 Ga0111539_113094062 124
115 3300009147 Ga0114129_11928292 Ga0114129_119282922 124
116 3300009148 Ga0105243_12147024 Ga0105243_121470241 124
117 3300025910 Ga0207684_10262011 Ga0207684_102620112 124
118 3300025910 Ga0207684_10340008 Ga0207684_103400082 124
119 3300025922 Ga0207646_10433063 Ga0207646_104330632 124
120 3300028563 Ga0265319_1000580 Ga0265319_100058017 124
121 3300028577 Ga0265318_10004863 Ga0265318_100048633 124
122 3300028654 Ga0265322_10007892 Ga0265322_100078922 124
123 3300028800 Ga0265338_10017691 Ga0265338_100176912 124
124 3300031238 Ga0265332_10080931 Ga0265332_100809312 124
125 3300031239 Ga0265328_10147233 Ga0265328_101472332 124
126 3300031240 Ga0265320_10002170 Ga0265320_1000217012 124
127 3300031241 Ga0265325_10186358 Ga0265325_101863581 124
128 3300031247 Ga0265340_10013224 Ga0265340_100132243 124
129 3300031249 Ga0265339_10049829 Ga0265339_100498293 124
130 3300031250 Ga0265331_10032085 Ga0265331_100320853 124
131 3300031712 Ga0265342_10429263 Ga0265342_104292632 124
132 3300037466 Ga0395898_0013643 Ga0395898_0013643_6226_6612 124
133 3300037471 Ga0395905_0898124 Ga0395905_0898124_249_638 124
134 3300038443 Ga0395901_0002733 Ga0395901_0002733_9333_9719 124
135 3300038443 Ga0395901_0125263 Ga0395901_0125263_2087_2476 124
136 3300048915 Ga0496112_0067916 Ga0496112_0067916_683_1075 124
137 3300049573 Ga0501037_0192664 Ga0501037_0192664_466_846 124
138 3300049574 Ga0501038_0082343 Ga0501038_0082343_2079_2459 124
139 3300049575 Ga0501039_0272761 Ga0501039_0272761_481_861 124
140 3300049576 Ga0501040_0055269 Ga0501040_0055269_455_835 124
141 3300049577 Ga0501041_0121699 Ga0501041_0121699_523_903 124
142 3300049578 Ga0501042_0189672 Ga0501042_0189672_1077_1457 124
143 3300049580 Ga0501046_0326948 Ga0501046_0326948_467_847 124
144 3300049582 Ga0501048_0061507 Ga0501048_0061507_1500_1880 124
145 3300049587 Ga0501071_0081349 Ga0501071_0081349_537_917 124
146 3300049588 Ga0501072_0373545 Ga0501072_0373545_262_642 124
147 3300049591 Ga0501075_0297527 Ga0501075_0297527_437_817 124
148 3300049592 Ga0501076_0110897 Ga0501076_0110897_357_737 124
149 3300049741 Ga0501079_0104519 Ga0501079_0104519_867_1247 124
150 3300049742 Ga0501080_1196293 Ga0501080_1196293_238_618 124
151 3300049824 Ga0501045_0038299 Ga0501045_0038299_1432_1812 124
152 3300060353 Ga0501082_0046811 Ga0501082_0046811_1450_1830 124
153 3300061734 Ga0530510_0026411 Ga0530510_0026411_1489_1869 124
154 3300003373 JGI25407J50210_10018484 JGI25407J50210_100184843 125
155 3300005329 Ga0070683_101732591 Ga0070683_1017325911 125
156 3300005337 Ga0070682_100242239 Ga0070682_1002422392 125
157 3300005355 Ga0070671_100503233 Ga0070671_1005032332 125
158 3300005530 Ga0070679_100135293 Ga0070679_1001352932 125
159 3300005536 Ga0070697_100389075 Ga0070697_1003890751 125
160 3300005536 Ga0070697_100806777 Ga0070697_1008067772 125
161 3300005545 Ga0070695_100424789 Ga0070695_1004247892 125
162 3300005563 Ga0068855_101374997 Ga0068855_1013749972 125
163 3300005614 Ga0068856_100044185 Ga0068856_1000441854 125
164 3300005614 Ga0068856_100073012 Ga0068856_1000730123 125
165 3300005614 Ga0068856_100363779 Ga0068856_1003637792 125
166 3300005616 Ga0068852_100060850 Ga0068852_1000608503 125
167 3300005981 Ga0081538_10003340 Ga0081538_100033404 125
168 3300006846 Ga0075430_100360392 Ga0075430_1003603922 125
169 3300006871 Ga0075434_100976981 Ga0075434_1009769811 125
170 3300006880 Ga0075429_100097700 Ga0075429_1000977003 125
171 3300009093 Ga0105240_10009411 Ga0105240_1000941112 125
172 3300009094 Ga0111539_10423244 Ga0111539_104232442 125
173 3300009098 Ga0105245_12810837 Ga0105245_128108371 125
174 3300009147 Ga0114129_10123289 Ga0114129_101232894 125
175 3300009174 Ga0105241_12133659 Ga0105241_121336591 125
176 3300009176 Ga0105242_12382241 Ga0105242_123822412 125
177 3300009177 Ga0105248_11860205 Ga0105248_118602051 125
178 3300010375 Ga0105239_10605046 Ga0105239_106050462 125
179 3300013104 Ga0157370_10012219 Ga0157370_100122192 125
180 3300013105 Ga0157369_10016287 Ga0157369_100162877 125
181 3300013105 Ga0157369_10028592 Ga0157369_100285926 125
182 3300013307 Ga0157372_11449818 Ga0157372_114498182 125
183 3300014326 Ga0157380_12395495 Ga0157380_123954952 125
184 3300014497 Ga0182008_10142329 Ga0182008_101423292 125
185 3300020082 Ga0206353_11869344 Ga0206353_118693442 125
186 3300025901 Ga0207688_10550590 Ga0207688_105505901 125
187 3300025906 Ga0207699_10015052 Ga0207699_100150524 125
188 3300025906 Ga0207699_10266422 Ga0207699_102664222 125
189 3300025909 Ga0207705_10552183 Ga0207705_105521832 125
190 3300025912 Ga0207707_10685175 Ga0207707_106851753 125
191 3300025913 Ga0207695_10064421 Ga0207695_100644212 125
192 3300025921 Ga0207652_10596154 Ga0207652_105961542 125
193 3300025927 Ga0207687_11535657 Ga0207687_115356571 125
194 3300025928 Ga0207700_10000001 Ga0207700_10000001736 125
195 3300025935 Ga0207709_10371458 Ga0207709_103714582 125
196 3300025939 Ga0207665_10805921 Ga0207665_108059212 125
197 3300025944 Ga0207661_11303777 Ga0207661_113037772 125
198 3300025949 Ga0207667_10066297 Ga0207667_100662972 125
199 3300026023 Ga0207677_10547431 Ga0207677_105474311 125
200 3300026078 Ga0207702_10246462 Ga0207702_102464621 125
201 3300026078 Ga0207702_10349662 Ga0207702_103496622 125
202 3300026142 Ga0207698_10171874 Ga0207698_101718742 125
203 3300026142 Ga0207698_10578659 Ga0207698_105786592 125
204 3300035171 Ga0373946_0631353 Ga0373946_0631353_96_482 125
205 3300037312 Ga0395899_0017158 Ga0395899_0017158_450_842 125
206 3300037466 Ga0395898_0267786 Ga0395898_0267786_831_1250 125
207 3300037471 Ga0395905_0155707 Ga0395905_0155707_929_1321 125
208 3300037471 Ga0395905_0759402 Ga0395905_0759402_114_509 125
209 3300038443 Ga0395901_0074182 Ga0395901_0074182_2205_2597 125
210 3300038443 Ga0395901_0159188 Ga0395901_0159188_1211_1630 125
211 3300038443 Ga0395901_0411056 Ga0395901_0411056_351_746 125
212 3300041404 Ga0439436_0068066 Ga0439436_0068066_282_680 125
213 3300041406 Ga0439439_0024699 Ga0439439_0024699_219_614 125
214 3300041999 Ga0439433_0001312 Ga0439433_0001312_1051_1449 125
215 3300042002 Ga0439442_008673 Ga0439442_008673_1437_1835 125
216 3300042015 Ga0439462_0006019 Ga0439462_0006019_2478_2876 125
217 3300042156 Ga0439446_0000446 Ga0439446_0000446_976_1374 125
218 3300042993 Ga0439440_0102269 Ga0439440_0102269_246_719 125
219 3300045976 Ga0466967_1144606 Ga0466967_1144606_270_671 125
220 3300046533 Ga0495640_0243943 Ga0495640_0243943_402_806 125
221 3300046663 Ga0495635_0127279 Ga0495635_0127279_578_982 125
222 3300046663 Ga0495635_0870665 Ga0495635_0870665_13_411 125
223 3300046675 Ga0495657_0666160 Ga0495657_0666160_58_462 125
224 3300046689 Ga0495613_0919572 Ga0495613_0919572_35_439 125
225 3300046691 Ga0495670_0421779 Ga0495670_0421779_41_427 125
226 3300046694 Ga0495649_0587965 Ga0495649_0587965_77_463 125
227 3300047319 Ga0495674_0050628 Ga0495674_0050628_739_1143 125
228 3300047471 Ga0495684_0910608 Ga0495684_0910608_39_428 125
229 3300048903 Ga0496100_0015387 Ga0496100_0015387_3081_3461 125
230 3300048903 Ga0496100_0520918 Ga0496100_0520918_402_788 125
231 3300048904 Ga0496101_0006361 Ga0496101_0006361_7118_7498 125
232 3300048905 Ga0496102_0012480 Ga0496102_0012480_539_919 125
233 3300048905 Ga0496102_0027563 Ga0496102_0027563_2715_3101 125
234 3300048905 Ga0496102_0242331 Ga0496102_0242331_875_1270 125
235 3300048906 Ga0496103_0739738 Ga0496103_0739738_72_467 125
236 3300048907 Ga0496104_0003357 Ga0496104_0003357_2920_3306 125
237 3300048908 Ga0496105_0014719 Ga0496105_0014719_3282_3668 125
238 3300048908 Ga0496105_0142689 Ga0496105_0142689_251_637 125
239 3300048908 Ga0496105_0857281 Ga0496105_0857281_39_464 125
240 3300048909 Ga0496106_0004029 Ga0496106_0004029_4143_4538 125
241 3300048909 Ga0496106_0010301 Ga0496106_0010301_808_1188 125
242 3300048909 Ga0496106_0174434 Ga0496106_0174434_1202_1588 125
243 3300048910 Ga0496107_0000820 Ga0496107_0000820_4547_4942 125
244 3300048910 Ga0496107_0294678 Ga0496107_0294678_488_868 125
245 3300048911 Ga0496108_0004537 Ga0496108_0004537_6820_7206 125
246 3300048911 Ga0496108_0683742 Ga0496108_0683742_401_787 125
247 3300048912 Ga0496109_0002702 Ga0496109_0002702_7712_8098 125
248 3300048912 Ga0496109_0179793 Ga0496109_0179793_148_534 125
249 3300048913 Ga0496110_0005789 Ga0496110_0005789_4448_4834 125
250 3300048913 Ga0496110_0327135 Ga0496110_0327135_579_971 125
251 3300048914 Ga0496111_0004616 Ga0496111_0004616_5653_6039 125
252 3300048914 Ga0496111_0124141 Ga0496111_0124141_1026_1415 125
253 3300048915 Ga0496112_0045614 Ga0496112_0045614_2012_2398 125
254 3300048915 Ga0496112_0785735 Ga0496112_0785735_465_851 125
255 3300048916 Ga0496113_0017764 Ga0496113_0017764_3017_3403 125
256 3300048916 Ga0496113_0106903 Ga0496113_0106903_377_763 125
257 3300048916 Ga0496113_0183346 Ga0496113_0183346_1079_1504 125
258 3300048917 Ga0496114_0022156 Ga0496114_0022156_2496_2876 125
259 3300048917 Ga0496114_0036931 Ga0496114_0036931_2768_3172 125
260 3300048917 Ga0496114_0298270 Ga0496114_0298270_314_700 125
261 3300048918 Ga0496115_0444173 Ga0496115_0444173_467_862 125
262 3300049570 Ga0501033_0009092 Ga0501033_0009092_150_551 125
263 3300049574 Ga0501038_0551245 Ga0501038_0551245_423_815 125
264 3300049577 Ga0501041_0182807 Ga0501041_0182807_815_1216 125
265 3300049580 Ga0501046_0105765 Ga0501046_0105765_309_689 125
266 3300049584 Ga0501068_0007700 Ga0501068_0007700_5462_5863 125
267 3300049588 Ga0501072_0448732 Ga0501072_0448732_85_486 125
268 3300049592 Ga0501076_0981657 Ga0501076_0981657_79_459 125
269 3300049593 Ga0501077_0188824 Ga0501077_0188824_649_1029 125
270 3300049741 Ga0501079_0077761 Ga0501079_0077761_97_498 125
271 3300049741 Ga0501079_0249596 Ga0501079_0249596_853_1233 125
272 3300049741 Ga0501079_0488563 Ga0501079_0488563_144_533 125
273 3300049742 Ga0501080_1836526 Ga0501080_1836526_97_498 125
274 3300049743 Ga0501081_0009723 Ga0501081_0009723_5334_5735 125
275 3300050507 nmdc:mga05p37_14008_c1 nmdc:mga05p37_14008_c1_1171_1590 125
276 3300050508 nmdc:mga09592_92638_c1 nmdc:mga09592_92638_c1_1717_2136 125
277 3300050510 nmdc:mga06r32_1012529_c1 nmdc:mga06r32_1012529_c1_254_673 125
278 3300053084 Ga0495595_0603654 Ga0495595_0603654_77_481 125
279 3300054114 Ga0501084_0777858 Ga0501084_0777858_408_788 125
280 3300060353 Ga0501082_0095704 Ga0501082_0095704_2069_2470 125
281 3300060353 Ga0501082_0492696 Ga0501082_0492696_551_931 125
282 3300061734 Ga0530510_0213104 Ga0530510_0213104_152_532 125
283 3300061734 Ga0530510_1177951 Ga0530510_1177951_75_533 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04237

YjbR

YjbR

32

126

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.7524 7 122
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.7081 7 121
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.6981 7 122
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.6966 1 106
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.6889 7 121
ID Description Score Start End Superfamily
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.7946 8 117 3.30.70.1230
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7854 7 120 3.90.1150.30
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7719 2 120 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7615 7 120 3.90.1150.30
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7608 2 120 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A7W0ZG71-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9726 2 125 GO:0003677
AF-A0A7V9DJC9-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.972 3 124 GO:0003677
AF-A0A538BI20-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9716 2 121 GO:0003677
AF-A0A7V9CS18-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9714 11 124 GO:0003677
AF-A0A536A5X7-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9636 6 97 GO:0003677

Feature Viewer

pLDDT pTM Quality
90.12 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map