F385734

General Info

Members Datasets Scaffolds Average Seq Length
283 191 566 173

Family's Representative Sequence

Representative Sequence 3300041460|Ga0451802_1833524|Ga0451802_1833524_13_609
Length 198
Sequence MEFITMAAPFLIESTKSTDQPLIEQLLDIAFGIDRRTKTSYRLREGSTPADGLSLVVRDVEVGVAGSISFWPLAIGKSGTPALLLGPLVVHPKRQNLGVGLTLMREGLARAKTRGHRLVILVGDAPYYARVGFQKLPEGQLLMPGPVDPQRFLYVELVPGALAVMHGLVLPPHRFADISAPFAVPHQAERQKQSAECQ

Samples

Sample ID Description Type Environment
1 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
87 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
88 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
93 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
101 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
102 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
107 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
110 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
117 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
163 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
164 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
165 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
173 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
176 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
177 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
178 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
179 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
180 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
184 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
185 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
186 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
187 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
188 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
189 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
190 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
191 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.82
Metatranscriptomes 0
Isolates 3.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.95
Nodule 2.12
Rhizoplane 13.43
Rhizosphere 69.26
Stem 0
Stem Tuber 0
Unclassified 8.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451802_1833524 3300041460 Unclassified 759
2 JGI25153J46596_10014486 3300003215 Bacteria 3275
3 Ga0055526_1032969 3300003771 Bacteria 1448
4 Ga0065712_10004749 3300005290 Bacteria 3953
5 Ga0070690_100195149 3300005330 Bacteria 1406
6 Ga0070690_100218562 3300005330 Bacteria 1334
7 Ga0070689_100276163 3300005340 Bacteria 1393
8 Ga0070689_100519718 3300005340 Bacteria 1022
9 Ga0070687_100066413 3300005343 Bacteria 1922
10 Ga0070661_100148560 3300005344 Bacteria 1771
11 Ga0070669_100123404 3300005353 Bacteria 1979
12 Ga0070671_100380667 3300005355 Bacteria 1206
13 Ga0070671_100562812 3300005355 Bacteria 984
14 Ga0070659_100543659 3300005366 Bacteria 994
15 Ga0070709_10756673 3300005434 Bacteria 760
16 Ga0070714_100078702 3300005435 Bacteria 2866
17 Ga0070713_100082707 3300005436 Bacteria 2742
18 Ga0070711_100021554 3300005439 Bacteria 4168
19 Ga0070711_100603879 3300005439 Bacteria 916
20 Ga0070711_100642317 3300005439 Unclassified 889
21 Ga0070662_100074075 3300005457 Bacteria 2518
22 Ga0070672_100150376 3300005543 Bacteria 1926
23 Ga0070686_100013357 3300005544 Bacteria 4699
24 Ga0070696_100305072 3300005546 Bacteria 1221
25 Ga0068857_100447823 3300005577 Bacteria 1207
26 Ga0068856_100865849 3300005614 Bacteria 923
27 Ga0068856_101056949 3300005614 Bacteria 830
28 Ga0070702_100262981 3300005615 Bacteria 1176
29 Ga0070702_100590469 3300005615 Bacteria 831
30 Ga0068863_100326048 3300005841 Bacteria 1492
31 Ga0081455_10003587 3300005937 Bacteria 17806
32 Ga0075365_10086769 3300006038 Bacteria 2127
33 Ga0075365_10543799 3300006038 Bacteria 821
34 Ga0075368_10046078 3300006042 Bacteria 1724
35 Ga0075368_10159467 3300006042 Bacteria 944
36 Ga0075363_100075983 3300006048 Bacteria 1831
37 Ga0075364_10161525 3300006051 Bacteria 1512
38 Ga0075364_10198997 3300006051 Unclassified 1358
39 Ga0070715_10160755 3300006163 Bacteria 1110
40 Ga0070712_100004030 3300006175 Bacteria 9015
41 Ga0070712_100032613 3300006175 Bacteria 3518
42 Ga0070712_100070496 3300006175 Bacteria 2498
43 Ga0070712_100367598 3300006175 Bacteria 1181
44 Ga0075362_10100546 3300006177 Bacteria 1352
45 Ga0075367_10337439 3300006178 Bacteria 950
46 Ga0075367_10338170 3300006178 Bacteria 949
47 Ga0075367_10672215 3300006178 Bacteria 658
48 Ga0075366_10170683 3300006195 Bacteria 1319
49 Ga0075366_10307063 3300006195 Bacteria 971
50 Ga0068871_100304822 3300006358 Bacteria 1399
51 Ga0075430_100278992 3300006846 Bacteria 1383
52 Ga0075431_100149812 3300006847 Bacteria 2403
53 Ga0075431_100332195 3300006847 Bacteria 1531
54 Ga0075434_100154245 3300006871 Bacteria 2316
55 Ga0099794_10020742 3300007265 Bacteria 2977
56 Ga0099795_10003485 3300007788 Bacteria 3902
57 Ga0099795_10118991 3300007788 Bacteria 1054
58 Ga0105240_10609351 3300009093 Bacteria 1201
59 Ga0111539_10175002 3300009094 Bacteria 2507
60 Ga0111539_10960860 3300009094 Bacteria 993
61 Ga0105245_10133415 3300009098 Bacteria 2331
62 Ga0105247_10611161 3300009101 Bacteria 810
63 Ga0105242_10261892 3300009176 Bacteria 1562
64 Ga0105248_10328101 3300009177 Bacteria 1724
65 Ga0105237_10007210 3300009545 Bacteria 12204
66 Ga0105237_10103012 3300009545 Bacteria 2846
67 Ga0105238_10016103 3300009551 Bacteria 7563
68 Ga0105249_10587912 3300009553 Bacteria 1167
69 Ga0157378_11146288 3300013297 Bacteria 816
70 Ga0163162_10592381 3300013306 Bacteria 1235
71 Ga0157372_10210363 3300013307 Bacteria 2254
72 Ga0157380_10803445 3300014326 Bacteria 958
73 Ga0157380_11750692 3300014326 Bacteria 680
74 Ga0182008_10034761 3300014497 Bacteria 2526
75 Ga0157377_10210308 3300014745 Bacteria 1240
76 Ga0157379_10180288 3300014968 Bacteria 1908
77 Ga0157376_10729221 3300014969 Bacteria 998
78 Ga0163161_10115448 3300017792 Bacteria 2012
79 Ga0209758_1000125 3300025297 Bacteria 189869
80 Ga0207426_1105233 3300025302 Bacteria 721
81 Ga0207695_10385362 3300025913 Bacteria 1287
82 Ga0207671_10836431 3300025914 Bacteria 729
83 Ga0207693_10016658 3300025915 Bacteria 5872
84 Ga0207693_10037578 3300025915 Bacteria 3817
85 Ga0207693_10128155 3300025915 Bacteria 1995
86 Ga0207693_10187424 3300025915 Bacteria 1628
87 Ga0207663_10018787 3300025916 Bacteria 3882
88 Ga0207663_10189272 3300025916 Bacteria 1476
89 Ga0207663_10225081 3300025916 Bacteria 1367
90 Ga0207663_10914820 3300025916 Unclassified 702
91 Ga0207662_10009869 3300025918 Bacteria 5268
92 Ga0207681_10112747 3300025923 Bacteria 1981
93 Ga0207681_10266457 3300025923 Bacteria 1343
94 Ga0207650_10111552 3300025925 Bacteria 2118
95 Ga0207700_10160580 3300025928 Bacteria 1866
96 Ga0207664_10085912 3300025929 Bacteria 2569
97 Ga0207644_10081473 3300025931 Bacteria 2392
98 Ga0207706_10035559 3300025933 Bacteria 4427
99 Ga0207706_11284080 3300025933 Bacteria 605
100 Ga0207686_10341459 3300025934 Bacteria 1125
101 Ga0207670_10140393 3300025936 Bacteria 1781
102 Ga0207704_11200602 3300025938 Bacteria 647
103 Ga0207665_10407791 3300025939 Bacteria 1036
104 Ga0207668_10059666 3300025972 Bacteria 2674
105 Ga0207698_10916150 3300026142 Bacteria 884
106 Ga0209179_1033504 3300027512 Bacteria 1062
107 Ga0209588_1020542 3300027671 Bacteria 2068
108 Ga0265318_10167317 3300028577 Bacteria 806
109 Ga0265325_10003643 3300031241 Bacteria 9997
110 Ga0265325_10065248 3300031241 Bacteria 1839
111 Ga0265331_10092422 3300031250 Bacteria 1397
112 Ga0307408_100082700 3300031548 Bacteria 2404
113 Ga0265314_10014246 3300031711 Bacteria 6374
114 Ga0307516_10434797 3300031730 Bacteria 969
115 Ga0307409_101092149 3300031995 Bacteria 819
116 Ga0373926_0071602 3300035083 Unclassified 1274
117 Ga0373944_0003478 3300035089 Bacteria 4070
118 Ga0373923_0204481 3300035111 Unclassified 914
119 Ga0373936_0006836 3300035113 Bacteria 4294
120 Ga0373945_0007596 3300035116 Bacteria 3515
121 Ga0373945_0008951 3300035116 Bacteria 3272
122 Ga0373943_0000126 3300035170 Bacteria 28849
123 Ga0373943_0015975 3300035170 Bacteria 3417
124 Ga0373943_0227463 3300035170 Bacteria 1041
125 Ga0373946_0002773 3300035171 Bacteria 6198
126 Ga0373946_0458025 3300035171 Bacteria 650
127 Ga0373961_0024457 3300035241 Bacteria 1634
128 Ga0373935_0001507 3300035692 Bacteria 12936
129 Ga0373935_0006466 3300035692 Bacteria 6998
130 Ga0373935_0252827 3300035692 Bacteria 1234
131 Ga0373927_0001618 3300035695 Bacteria 16878
132 Ga0373927_0058382 3300035695 Bacteria 2495
133 Ga0373927_0344675 3300035695 Bacteria 982
134 Ga0373947_0000581 3300035725 Bacteria 21444
135 Ga0373947_0430318 3300035725 Unclassified 892
136 Ga0373937_0530255 3300036401 Bacteria 1119
137 Ga0373925_0004273 3300037068 Bacteria 10823
138 Ga0373925_0006642 3300037068 Bacteria 8493
139 Ga0373925_0254797 3300037068 Bacteria 1408
140 Ga0436365_1074512 3300039437 Bacteria 1840
141 Ga0436365_1198186 3300039437 Bacteria 912
142 Ga0436365_1822775 3300039437 Bacteria 2023
143 Ga0436365_1828085 3300039437 Unclassified 980
144 Ga0436365_1902034 3300039437 Bacteria 1266
145 Ga0451849_0809711 3300041505 Unclassified 721
146 Ga0439434_0122038 3300042435 Bacteria 850
147 Ga0439435_0160131 3300042436 Bacteria 726
148 Ga0495629_0027587 3300046459 Bacteria 4032
149 Ga0495629_0117040 3300046459 Bacteria 1857
150 Ga0495653_0012640 3300046463 Bacteria 6894
151 Ga0495580_0016079 3300046472 Bacteria 5623
152 Ga0495639_0067639 3300046475 Bacteria 1646
153 Ga0495662_0018625 3300046476 Bacteria 3361
154 Ga0495662_0040061 3300046476 Bacteria 2262
155 Ga0495664_0000146 3300046477 Bacteria 35506
156 Ga0495664_0165705 3300046477 Bacteria 1341
157 Ga0495584_0099273 3300046491 Bacteria 1471
158 Ga0495584_0210193 3300046491 Bacteria 989
159 Ga0495607_0152411 3300046501 Bacteria 1182
160 Ga0495608_0642618 3300046511 Bacteria 634
161 Ga0495618_0000473 3300046514 Bacteria 28654
162 Ga0495618_0070341 3300046514 Bacteria 2225
163 Ga0495630_0008856 3300046517 Bacteria 7228
164 Ga0495630_0031348 3300046517 Bacteria 3958
165 Ga0495666_0058634 3300046526 Bacteria 1841
166 Ga0495652_0591221 3300046529 Bacteria 758
167 Ga0495665_0085123 3300046531 Unclassified 1662
168 Ga0495640_0002833 3300046533 Bacteria 13941
169 Ga0495640_0121128 3300046533 Bacteria 1701
170 Ga0495586_0039223 3300046535 Bacteria 2546
171 Ga0495645_0002522 3300046543 Bacteria 12428
172 Ga0495667_0228627 3300046559 Unclassified 1186
173 Ga0495656_0025200 3300046615 Bacteria 2356
174 Ga0495656_0145138 3300046615 Bacteria 1141
175 Ga0495634_0003112 3300046642 Bacteria 13487
176 Ga0495634_0010907 3300046642 Bacteria 6633
177 Ga0495635_0003908 3300046663 Bacteria 10356
178 Ga0495659_0143431 3300046664 Bacteria 955
179 Ga0495646_0102747 3300046680 Unclassified 1637
180 Ga0495658_0370883 3300046683 Bacteria 911
181 Ga0495613_0079028 3300046689 Bacteria 2392
182 Ga0495613_0241695 3300046689 Bacteria 1262
183 Ga0495624_0001896 3300046690 Bacteria 15925
184 Ga0495624_0140335 3300046690 Unclassified 1480
185 Ga0495624_0288241 3300046690 Bacteria 991
186 Ga0495600_0416814 3300046809 Unclassified 834
187 Ga0495581_0025051 3300047315 Bacteria 3457
188 Ga0495581_0035145 3300047315 Bacteria 2900
189 Ga0495674_0033088 3300047319 Bacteria 4685
190 Ga0495674_0241011 3300047319 Bacteria 1490
191 Ga0495676_0159155 3300047321 Bacteria 1599
192 Ga0495680_0253699 3300047322 Unclassified 1246
193 Ga0495680_0701395 3300047322 Unclassified 668
194 Ga0495684_0002978 3300047471 Bacteria 13332
195 Ga0495684_0007416 3300047471 Bacteria 8500
196 Ga0495684_0755954 3300047471 Bacteria 639
197 Ga0495593_0014917 3300047673 Bacteria 4414
198 Ga0495602_0979900 3300048088 Unclassified 559
199 Ga0495615_0060765 3300048090 Bacteria 996
200 Ga0496100_0001173 3300048903 Bacteria 12746
201 Ga0496100_0129072 3300048903 Bacteria 1778
202 Ga0496100_0675107 3300048903 Bacteria 805
203 Ga0496101_0012734 3300048904 Bacteria 5623
204 Ga0496101_0141326 3300048904 Bacteria 1835
205 Ga0496102_0003925 3300048905 Bacteria 12594
206 Ga0496102_0140920 3300048905 Bacteria 2261
207 Ga0496102_0482356 3300048905 Bacteria 1161
208 Ga0496103_0056840 3300048906 Bacteria 2429
209 Ga0496104_0001459 3300048907 Bacteria 20443
210 Ga0496104_0247364 3300048907 Unclassified 1696
211 Ga0496105_0035671 3300048908 Bacteria 4094
212 Ga0496105_0068206 3300048908 Bacteria 2938
213 Ga0496105_0633808 3300048908 Bacteria 826
214 Ga0496106_0020643 3300048909 Bacteria 4891
215 Ga0496106_0045847 3300048909 Bacteria 3285
216 Ga0496106_1065542 3300048909 Bacteria 634
217 Ga0496107_0024428 3300048910 Unclassified 4274
218 Ga0496108_0002474 3300048911 Bacteria 14790
219 Ga0496108_0008648 3300048911 Bacteria 8259
220 Ga0496108_0283130 3300048911 Bacteria 1443
221 Ga0496109_0001010 3300048912 Bacteria 23241
222 Ga0496109_0004411 3300048912 Bacteria 11758
223 Ga0496110_0002704 3300048913 Bacteria 13402
224 Ga0496110_0003213 3300048913 Bacteria 12442
225 Ga0496111_0000245 3300048914 Bacteria 26053
226 Ga0496111_0018099 3300048914 Bacteria 4875
227 Ga0496111_0326179 3300048914 Unclassified 1137
228 Ga0496112_0003218 3300048915 Bacteria 13448
229 Ga0496112_0051352 3300048915 Bacteria 4044
230 Ga0496112_0244691 3300048915 Bacteria 1746
231 Ga0496113_0036753 3300048916 Bacteria 3590
232 Ga0496113_0048318 3300048916 Bacteria 3165
233 Ga0496113_0065905 3300048916 Bacteria 2742
234 Ga0496114_0244269 3300048917 Bacteria 1579
235 Ga0496115_0037458 3300048918 Bacteria 3843
236 Ga0496115_0199022 3300048918 Bacteria 1655
237 Ga0496121_0231893 3300048924 Bacteria 1292
238 Ga0496126_0400084 3300048929 Bacteria 1114
239 Ga0501067_0056508 3300049583 Bacteria 2174
240 Ga0501067_0176306 3300049583 Bacteria 1190
241 Ga0501068_0163866 3300049584 Bacteria 1402
242 Ga0501070_0270280 3300049586 Bacteria 1388
243 Ga0501070_0468884 3300049586 Bacteria 1014
244 Ga0501071_0173692 3300049587 Bacteria 1614
245 Ga0501071_0771433 3300049587 Bacteria 741
246 Ga0501076_0575868 3300049592 Bacteria 929
247 Ga0501083_0022997 3300049744 Bacteria 4326
248 Ga0501083_0104199 3300049744 Bacteria 1869
249 nmdc:mga03683_417032_c1 3300050489 Bacteria 643
250 nmdc:mga03683_45780_c1 3300050489 Bacteria 1812
251 nmdc:mga0yw44_72570_c1 3300050492 Bacteria 2140
252 nmdc:mga0k408_137177_c1 3300050493 Bacteria 1454
253 nmdc:mga0k408_158399_c1 3300050493 Bacteria 1349
254 nmdc:mga0k408_510586_c1 3300050493 Bacteria 712
255 nmdc:mga07m45_94134_c1 3300050496 Bacteria 1718
256 nmdc:mga09592_458381_c1 3300050508 Bacteria 1099
257 nmdc:mga0qj67_98301_c1 3300050509 Bacteria 2357
258 nmdc:mga0n895_221910_c1 3300050512 Bacteria 1919
259 nmdc:mga08x19_422205_c1 3300050514 Bacteria 937
260 nmdc:mga0sz30_354701_c1 3300050516 Bacteria 656
261 Ga0495601_0000860 3300053077 Bacteria 16549
262 Ga0495612_0000075 3300053078 Bacteria 45362
263 Ga0495595_0147073 3300053084 Unclassified 1158
264 Ga0495619_0016493 3300053085 Bacteria 4677
265 Ga0495619_0185291 3300053085 Bacteria 1440
266 Ga0500641_0030319 3300053096 Bacteria 2124
267 Ga0500555_029376 3300053103 Unclassified 1563
268 Ga0500562_059419 3300053108 Bacteria 1027
269 Ga0500595_022087 3300053119 Bacteria 2260
270 Ga0500642_0040002 3300053130 Bacteria 2020
271 Ga0500616_0219869 3300053153 Bacteria 829
272 Ga0501084_0037052 3300054114 Bacteria 4075
273 Ga0501082_0008053 3300060353 Bacteria 9092
274 Ga0501082_0663722 3300060353 Unclassified 913
275 2513693285 2513237101 Bacteria 7952346
276 2874608817 2874604998 Bacteria 7834745
277 2876813876 2876808645 Bacteria 8824342
278 2879115454 2879110137 Bacteria 8907982
279 2889037289 2889033259 Bacteria 9099371
280 2922388843 2922386360 Bacteria 7017218
281 8006970861 8006964411 Bacteria 8966052
282 8006985248 8006984368 Bacteria 9651211
283 8056675897 8056673599 Bacteria 7871253
284 Ga0451802_1833524
285 JGI25153J46596_10014486
286 Ga0055526_1032969
287 Ga0065712_10004749
288 Ga0070690_100195149
289 Ga0070690_100218562
290 Ga0070689_100276163
291 Ga0070689_100519718
292 Ga0070687_100066413
293 Ga0070661_100148560
294 Ga0070669_100123404
295 Ga0070671_100380667
296 Ga0070671_100562812
297 Ga0070659_100543659
298 Ga0070709_10756673
299 Ga0070714_100078702
300 Ga0070713_100082707
301 Ga0070711_100021554
302 Ga0070711_100603879
303 Ga0070711_100642317
304 Ga0070662_100074075
305 Ga0070672_100150376
306 Ga0070686_100013357
307 Ga0070696_100305072
308 Ga0068857_100447823
309 Ga0068856_100865849
310 Ga0068856_101056949
311 Ga0070702_100262981
312 Ga0070702_100590469
313 Ga0068863_100326048
314 Ga0081455_10003587
315 Ga0075365_10086769
316 Ga0075365_10543799
317 Ga0075368_10046078
318 Ga0075368_10159467
319 Ga0075363_100075983
320 Ga0075364_10161525
321 Ga0075364_10198997
322 Ga0070715_10160755
323 Ga0070712_100004030
324 Ga0070712_100032613
325 Ga0070712_100070496
326 Ga0070712_100367598
327 Ga0075362_10100546
328 Ga0075367_10337439
329 Ga0075367_10338170
330 Ga0075367_10672215
331 Ga0075366_10170683
332 Ga0075366_10307063
333 Ga0068871_100304822
334 Ga0075430_100278992
335 Ga0075431_100149812
336 Ga0075431_100332195
337 Ga0075434_100154245
338 Ga0099794_10020742
339 Ga0099795_10003485
340 Ga0099795_10118991
341 Ga0105240_10609351
342 Ga0111539_10175002
343 Ga0111539_10960860
344 Ga0105245_10133415
345 Ga0105247_10611161
346 Ga0105242_10261892
347 Ga0105248_10328101
348 Ga0105237_10007210
349 Ga0105237_10103012
350 Ga0105238_10016103
351 Ga0105249_10587912
352 Ga0157378_11146288
353 Ga0163162_10592381
354 Ga0157372_10210363
355 Ga0157380_10803445
356 Ga0157380_11750692
357 Ga0182008_10034761
358 Ga0157377_10210308
359 Ga0157379_10180288
360 Ga0157376_10729221
361 Ga0163161_10115448
362 Ga0209758_1000125
363 Ga0207426_1105233
364 Ga0207695_10385362
365 Ga0207671_10836431
366 Ga0207693_10016658
367 Ga0207693_10037578
368 Ga0207693_10128155
369 Ga0207693_10187424
370 Ga0207663_10018787
371 Ga0207663_10189272
372 Ga0207663_10225081
373 Ga0207663_10914820
374 Ga0207662_10009869
375 Ga0207681_10112747
376 Ga0207681_10266457
377 Ga0207650_10111552
378 Ga0207700_10160580
379 Ga0207664_10085912
380 Ga0207644_10081473
381 Ga0207706_10035559
382 Ga0207706_11284080
383 Ga0207686_10341459
384 Ga0207670_10140393
385 Ga0207704_11200602
386 Ga0207665_10407791
387 Ga0207668_10059666
388 Ga0207698_10916150
389 Ga0209179_1033504
390 Ga0209588_1020542
391 Ga0265318_10167317
392 Ga0265325_10003643
393 Ga0265325_10065248
394 Ga0265331_10092422
395 Ga0307408_100082700
396 Ga0265314_10014246
397 Ga0307516_10434797
398 Ga0307409_101092149
399 Ga0373926_0071602
400 Ga0373944_0003478
401 Ga0373923_0204481
402 Ga0373936_0006836
403 Ga0373945_0007596
404 Ga0373945_0008951
405 Ga0373943_0000126
406 Ga0373943_0015975
407 Ga0373943_0227463
408 Ga0373946_0002773
409 Ga0373946_0458025
410 Ga0373961_0024457
411 Ga0373935_0001507
412 Ga0373935_0006466
413 Ga0373935_0252827
414 Ga0373927_0001618
415 Ga0373927_0058382
416 Ga0373927_0344675
417 Ga0373947_0000581
418 Ga0373947_0430318
419 Ga0373937_0530255
420 Ga0373925_0004273
421 Ga0373925_0006642
422 Ga0373925_0254797
423 Ga0436365_1074512
424 Ga0436365_1198186
425 Ga0436365_1822775
426 Ga0436365_1828085
427 Ga0436365_1902034
428 Ga0451849_0809711
429 Ga0439434_0122038
430 Ga0439435_0160131
431 Ga0495629_0027587
432 Ga0495629_0117040
433 Ga0495653_0012640
434 Ga0495580_0016079
435 Ga0495639_0067639
436 Ga0495662_0018625
437 Ga0495662_0040061
438 Ga0495664_0000146
439 Ga0495664_0165705
440 Ga0495584_0099273
441 Ga0495584_0210193
442 Ga0495607_0152411
443 Ga0495608_0642618
444 Ga0495618_0000473
445 Ga0495618_0070341
446 Ga0495630_0008856
447 Ga0495630_0031348
448 Ga0495666_0058634
449 Ga0495652_0591221
450 Ga0495665_0085123
451 Ga0495640_0002833
452 Ga0495640_0121128
453 Ga0495586_0039223
454 Ga0495645_0002522
455 Ga0495667_0228627
456 Ga0495656_0025200
457 Ga0495656_0145138
458 Ga0495634_0003112
459 Ga0495634_0010907
460 Ga0495635_0003908
461 Ga0495659_0143431
462 Ga0495646_0102747
463 Ga0495658_0370883
464 Ga0495613_0079028
465 Ga0495613_0241695
466 Ga0495624_0001896
467 Ga0495624_0140335
468 Ga0495624_0288241
469 Ga0495600_0416814
470 Ga0495581_0025051
471 Ga0495581_0035145
472 Ga0495674_0033088
473 Ga0495674_0241011
474 Ga0495676_0159155
475 Ga0495680_0253699
476 Ga0495680_0701395
477 Ga0495684_0002978
478 Ga0495684_0007416
479 Ga0495684_0755954
480 Ga0495593_0014917
481 Ga0495602_0979900
482 Ga0495615_0060765
483 Ga0496100_0001173
484 Ga0496100_0129072
485 Ga0496100_0675107
486 Ga0496101_0012734
487 Ga0496101_0141326
488 Ga0496102_0003925
489 Ga0496102_0140920
490 Ga0496102_0482356
491 Ga0496103_0056840
492 Ga0496104_0001459
493 Ga0496104_0247364
494 Ga0496105_0035671
495 Ga0496105_0068206
496 Ga0496105_0633808
497 Ga0496106_0020643
498 Ga0496106_0045847
499 Ga0496106_1065542
500 Ga0496107_0024428
501 Ga0496108_0002474
502 Ga0496108_0008648
503 Ga0496108_0283130
504 Ga0496109_0001010
505 Ga0496109_0004411
506 Ga0496110_0002704
507 Ga0496110_0003213
508 Ga0496111_0000245
509 Ga0496111_0018099
510 Ga0496111_0326179
511 Ga0496112_0003218
512 Ga0496112_0051352
513 Ga0496112_0244691
514 Ga0496113_0036753
515 Ga0496113_0048318
516 Ga0496113_0065905
517 Ga0496114_0244269
518 Ga0496115_0037458
519 Ga0496115_0199022
520 Ga0496121_0231893
521 Ga0496126_0400084
522 Ga0501067_0056508
523 Ga0501067_0176306
524 Ga0501068_0163866
525 Ga0501070_0270280
526 Ga0501070_0468884
527 Ga0501071_0173692
528 Ga0501071_0771433
529 Ga0501076_0575868
530 Ga0501083_0022997
531 Ga0501083_0104199
532 nmdc:mga03683_417032_c1
533 nmdc:mga03683_45780_c1
534 nmdc:mga0yw44_72570_c1
535 nmdc:mga0k408_137177_c1
536 nmdc:mga0k408_158399_c1
537 nmdc:mga0k408_510586_c1
538 nmdc:mga07m45_94134_c1
539 nmdc:mga09592_458381_c1
540 nmdc:mga0qj67_98301_c1
541 nmdc:mga0n895_221910_c1
542 nmdc:mga08x19_422205_c1
543 nmdc:mga0sz30_354701_c1
544 Ga0495601_0000860
545 Ga0495612_0000075
546 Ga0495595_0147073
547 Ga0495619_0016493
548 Ga0495619_0185291
549 Ga0500641_0030319
550 Ga0500555_029376
551 Ga0500562_059419
552 Ga0500595_022087
553 Ga0500642_0040002
554 Ga0500616_0219869
555 Ga0501084_0037052
556 Ga0501082_0008053
557 Ga0501082_0663722
558 2513693285
559 2874608817
560 2876813876
561 2879115454
562 2889037289
563 2922388843
564 8006970861
565 8006985248
566 8056675897

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13527

Acetyltransf_9

Acetyltransferase (GNAT) domain

12

136

0.74

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

21

133

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rs2-assembly1.cif.gz_A 1.55 angstrom crystal structure of gnat family n-acetyltransferase (yhbs) from escherichia coli in complex with coa 0.8409 1 165
4rs2-assembly1.cif.gz_A 1.55 angstrom crystal structure of gnat family n-acetyltransferase (yhbs) from escherichia coli in complex with coa 0.8177 1 165
2hv2-assembly1.cif.gz_F crystal structure of conserved protein of unknown function from enterococcus faecalis v583 at 2.4 a resolution, probable n-acyltransferase 0.8118 5 128
2q4y-assembly1.cif.gz_A ensemble refinement of the protein crystal structure of at1g77540-coenzyme a complex 0.8093 61 112
6b0u-assembly1.cif.gz_B-2 crystal structure of acetyltransferase eis from mycobacterium tuberculosis in complex with a lys-containing peptide 0.8006 7 129
ID Description Score Start End Superfamily
af_Q2G016_1_176_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8554 7 165 3.40.630.30
af_O13738_1_94_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8513 59 125 3.40.630.30
4rs2B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8428 1 166 3.40.630.30
af_B6SUK9_20_214_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8315 58 133 3.40.630.30
4rs2B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8242 1 166 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1I5AA48-F1-model_v4 Predicted N-acetyltransferase YhbS 0.9819 1 167 GO:0016747
AF-Q1QIF5-F1-model_v4 GCN5-related N-acetyltransferase 0.979 1 167 GO:0016747
AF-A0A1P8UQ73-F1-model_v4 Putative acetyltransferase 0.9737 45 165 GO:0016747
AF-A0A1E3H278-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9736 5 165 GO:0016747
AF-A0A1H1H4B1-F1-model_v4 Predicted N-acetyltransferase YhbS 0.973 1 165 GO:0016747

Map