F385601

General Info

Members Datasets Scaffolds Average Seq Length
283 194 566 148

Family's Representative Sequence

Representative Sequence 3300025302|Ga0207426_1024103|Ga0207426_10241033
Length 165
Sequence MGTDVELGGDNRQTLGAVAATMIPADIERGIPGADDPAILADIARSAGRDLALIHTGLAEIDKRAGGAFASLDRERREALINDWYASGGAAAAALGRVVLGAYYRDDRVLRALGHEARAPFPQGHVVEQGDWSLLDPVKRRAAFWRDDRAGPPDRFGKPDDSGGR

Samples

Sample ID Description Type Environment
1 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
102 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
103 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
115 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
177 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
182 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
185 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
187 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
188 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
189 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
190 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
191 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
192 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
193 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
194 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.79
Nodule 0
Rhizoplane 2.83
Rhizosphere 76.68
Stem 0
Stem Tuber 0
Unclassified 1.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207426_1024103 3300025302 Unclassified 2068
2 Ga0070658_10007364 3300005327 Bacteria 8889
3 Ga0070658_10100756 3300005327 Bacteria 2388
4 Ga0070683_100100599 3300005329 Bacteria 2721
5 Ga0070680_100019460 3300005336 Bacteria 5379
6 Ga0070680_100020445 3300005336 Bacteria 5254
7 Ga0070682_100106988 3300005337 Bacteria 1857
8 Ga0068868_101474935 3300005338 Bacteria 636
9 Ga0070660_100036667 3300005339 Bacteria 3715
10 Ga0070675_100128839 3300005354 Bacteria 2155
11 Ga0070659_101012012 3300005366 Bacteria 730
12 Ga0070709_10150300 3300005434 Bacteria 1609
13 Ga0070709_11131535 3300005434 Unclassified 627
14 Ga0070713_100174901 3300005436 Bacteria 1926
15 Ga0070713_100235114 3300005436 Bacteria 1667
16 Ga0070713_100475089 3300005436 Bacteria 1177
17 Ga0070713_100920214 3300005436 Bacteria 842
18 Ga0070708_100339610 3300005445 Bacteria 1415
19 Ga0070663_100770904 3300005455 Bacteria 823
20 Ga0070663_100794736 3300005455 Bacteria 811
21 Ga0070678_100360871 3300005456 Bacteria 1252
22 Ga0070662_100468485 3300005457 Bacteria 1048
23 Ga0070662_101080709 3300005457 Bacteria 688
24 Ga0070681_10008181 3300005458 Bacteria 10237
25 Ga0070681_10295618 3300005458 Bacteria 1529
26 Ga0070706_100229062 3300005467 Bacteria 1735
27 Ga0070707_100222316 3300005468 Bacteria 1839
28 Ga0070698_100063614 3300005471 Bacteria 3720
29 Ga0070679_100053903 3300005530 Bacteria 4003
30 Ga0070679_101171523 3300005530 Bacteria 713
31 Ga0070684_100029218 3300005535 Bacteria 4670
32 Ga0070697_100100817 3300005536 Bacteria 2399
33 Ga0068853_100096577 3300005539 Bacteria 2607
34 Ga0068853_101732742 3300005539 Bacteria 606
35 Ga0070686_100989241 3300005544 Bacteria 689
36 Ga0070693_100196357 3300005547 Bacteria 1308
37 Ga0070665_100003905 3300005548 Bacteria 15758
38 Ga0070665_100023966 3300005548 Bacteria 6146
39 Ga0070665_101554811 3300005548 Bacteria 670
40 Ga0068855_100014728 3300005563 Bacteria 9421
41 Ga0068855_100035876 3300005563 Bacteria 5905
42 Ga0068855_100046320 3300005563 Bacteria 5141
43 Ga0068855_100948375 3300005563 Bacteria 906
44 Ga0070664_101345214 3300005564 Bacteria 675
45 Ga0070664_101421607 3300005564 Bacteria 656
46 Ga0070664_101425123 3300005564 Bacteria 655
47 Ga0068857_100086737 3300005577 Bacteria 2799
48 Ga0068856_100222240 3300005614 Bacteria 1904
49 Ga0068856_100908852 3300005614 Bacteria 899
50 Ga0068852_100107461 3300005616 Bacteria 2531
51 Ga0068859_100216870 3300005617 Bacteria 2001
52 Ga0068851_10083693 3300005834 Bacteria 1670
53 Ga0068858_100276128 3300005842 Bacteria 1600
54 Ga0068860_100030504 3300005843 Bacteria 5185
55 Ga0068862_100716123 3300005844 Bacteria 971
56 Ga0070717_10071747 3300006028 Bacteria 2890
57 Ga0075365_10011626 3300006038 Bacteria 5185
58 Ga0075365_10110540 3300006038 Bacteria 1888
59 Ga0075365_10455167 3300006038 Bacteria 904
60 Ga0075365_10558535 3300006038 Bacteria 810
61 Ga0075368_10127662 3300006042 Bacteria 1056
62 Ga0075363_100036327 3300006048 Bacteria 2583
63 Ga0075363_100213124 3300006048 Bacteria 1106
64 Ga0075364_10373491 3300006051 Bacteria 972
65 Ga0070716_100085851 3300006173 Bacteria 1892
66 Ga0070716_100792748 3300006173 Bacteria 733
67 Ga0070712_100839316 3300006175 Bacteria 790
68 Ga0075362_10098968 3300006177 Bacteria 1362
69 Ga0075362_10172844 3300006177 Bacteria 1044
70 Ga0075367_10003954 3300006178 Bacteria 7152
71 Ga0075367_10118562 3300006178 Bacteria 1629
72 Ga0075367_10354920 3300006178 Bacteria 925
73 Ga0075369_10071744 3300006186 Bacteria 1525
74 Ga0075369_10238436 3300006186 Bacteria 843
75 Ga0075366_10179761 3300006195 Bacteria 1285
76 Ga0075370_10014390 3300006353 Bacteria 4220
77 Ga0075370_10086674 3300006353 Bacteria 1804
78 Ga0075370_10629458 3300006353 Bacteria 651
79 Ga0097620_100216859 3300006931 Bacteria 2001
80 Ga0099794_10222622 3300007265 Bacteria 970
81 Ga0099795_10021444 3300007788 Bacteria 2119
82 Ga0105240_10031486 3300009093 Bacteria 6880
83 Ga0105240_10054338 3300009093 Bacteria 5019
84 Ga0105240_10138060 3300009093 Bacteria 2917
85 Ga0111539_10532039 3300009094 Bacteria 1369
86 Ga0111539_11826436 3300009094 Bacteria 705
87 Ga0105243_12301078 3300009148 Bacteria 576
88 Ga0105237_10004661 3300009545 Bacteria 15792
89 Ga0105238_10073311 3300009551 Bacteria 3419
90 Ga0105238_10677147 3300009551 Bacteria 1043
91 Ga0105239_10032865 3300010375 Bacteria 5700
92 Ga0105239_10114515 3300010375 Bacteria 2991
93 Ga0105239_10384119 3300010375 Bacteria 1588
94 Ga0105239_11282406 3300010375 Bacteria 845
95 Ga0105239_12522750 3300010375 Unclassified 599
96 Ga0157370_10070737 3300013104 Bacteria 3293
97 Ga0157369_10031946 3300013105 Bacteria 5792
98 Ga0157369_10238999 3300013105 Bacteria 1897
99 Ga0157372_10559577 3300013307 Unclassified 1333
100 Ga0157375_11387468 3300013308 Bacteria 827
101 Ga0157380_12846907 3300014326 Bacteria 550
102 Ga0182008_10014967 3300014497 Bacteria 4057
103 Ga0163161_11189595 3300017792 Bacteria 659
104 Ga0207426_1016609 3300025302 Unclassified 2637
105 Ga0207656_10002591 3300025321 Bacteria 6116
106 Ga0207685_10587434 3300025905 Bacteria 596
107 Ga0207699_10140026 3300025906 Bacteria 1589
108 Ga0207699_10972541 3300025906 Bacteria 627
109 Ga0207645_10823851 3300025907 Bacteria 631
110 Ga0207705_10092721 3300025909 Bacteria 2213
111 Ga0207684_10169833 3300025910 Bacteria 1880
112 Ga0207707_10003366 3300025912 Bacteria 14191
113 Ga0207707_10007348 3300025912 Bacteria 9596
114 Ga0207695_10053587 3300025913 Bacteria 4218
115 Ga0207695_10075514 3300025913 Bacteria 3429
116 Ga0207695_10128734 3300025913 Bacteria 2491
117 Ga0207671_10018747 3300025914 Bacteria 5303
118 Ga0207660_10008039 3300025917 Bacteria 6821
119 Ga0207660_10019797 3300025917 Bacteria 4505
120 Ga0207657_10003018 3300025919 Bacteria 18028
121 Ga0207657_10329432 3300025919 Bacteria 1206
122 Ga0207649_10048797 3300025920 Bacteria 2612
123 Ga0207652_10079248 3300025921 Bacteria 2869
124 Ga0207652_10170252 3300025921 Bacteria 1954
125 Ga0207646_10070795 3300025922 Bacteria 3115
126 Ga0207681_11035346 3300025923 Bacteria 689
127 Ga0207694_10060978 3300025924 Bacteria 2936
128 Ga0207659_10377086 3300025926 Bacteria 1182
129 Ga0207700_10144651 3300025928 Bacteria 1958
130 Ga0207700_10201677 3300025928 Bacteria 1677
131 Ga0207700_10384192 3300025928 Bacteria 1228
132 Ga0207664_10696732 3300025929 Bacteria 913
133 Ga0207706_10359736 3300025933 Bacteria 1265
134 Ga0207670_10242992 3300025936 Bacteria 1388
135 Ga0207665_10068885 3300025939 Bacteria 2411
136 Ga0207665_11375014 3300025939 Bacteria 562
137 Ga0207691_10347092 3300025940 Bacteria 1270
138 Ga0207661_10035395 3300025944 Bacteria 3891
139 Ga0207661_10599228 3300025944 Bacteria 1011
140 Ga0207679_10702417 3300025945 Bacteria 918
141 Ga0207667_10013028 3300025949 Bacteria 9545
142 Ga0207667_10088416 3300025949 Bacteria 3204
143 Ga0207667_10104209 3300025949 Bacteria 2926
144 Ga0207651_10271213 3300025960 Bacteria 1398
145 Ga0207658_10525160 3300025986 Bacteria 1057
146 Ga0207703_10125222 3300026035 Bacteria 2211
147 Ga0207639_10074343 3300026041 Bacteria 2668
148 Ga0207702_10201280 3300026078 Bacteria 1846
149 Ga0207683_10358408 3300026121 Bacteria 1339
150 Ga0207698_10075123 3300026142 Bacteria 2699
151 Ga0209813_10027372 3300027866 Bacteria 1655
152 Ga0268266_10038474 3300028379 Bacteria 4072
153 Ga0268264_10074622 3300028381 Bacteria 2882
154 Ga0265330_10017349 3300031235 Bacteria 3316
155 Ga0265330_10029344 3300031235 Bacteria 2474
156 Ga0265332_10014429 3300031238 Bacteria 3495
157 Ga0265332_10186482 3300031238 Bacteria 863
158 Ga0265328_10088065 3300031239 Bacteria 1146
159 Ga0265325_10002917 3300031241 Bacteria 11397
160 Ga0265340_10133886 3300031247 Bacteria 1136
161 Ga0265339_10119918 3300031249 Bacteria 1353
162 Ga0265331_10010634 3300031250 Bacteria 5081
163 Ga0265316_10725586 3300031344 Bacteria 699
164 Ga0265314_10136121 3300031711 Bacteria 1525
165 Ga0265342_10081784 3300031712 Bacteria 1864
166 Ga0307416_102197975 3300032002 Bacteria 653
167 Ga0307415_100385382 3300032126 Bacteria 1192
168 Ga0373936_0060570 3300035113 Bacteria 1544
169 Ga0373953_0009279 3300035117 Bacteria 3377
170 Ga0373957_0007882 3300035120 Bacteria 3427
171 Ga0373955_0071391 3300035172 Bacteria 1942
172 Ga0373931_0273479 3300035691 Bacteria 1035
173 Ga0373935_0713019 3300035692 Bacteria 738
174 Ga0373927_0011751 3300035695 Bacteria 5828
175 Ga0373927_0014784 3300035695 Bacteria 5161
176 Ga0373933_0007968 3300035724 Bacteria 5778
177 Ga0373947_0090085 3300035725 Bacteria 1911
178 Ga0373947_0696804 3300035725 Bacteria 693
179 Ga0373937_0006187 3300036401 Bacteria 10308
180 Ga0373937_0913368 3300036401 Bacteria 827
181 Ga0373937_1193018 3300036401 Bacteria 710
182 Ga0373937_1423601 3300036401 Bacteria 641
183 Ga0373937_1501310 3300036401 Bacteria 621
184 Ga0373925_0283633 3300037068 Bacteria 1334
185 Ga0395899_0064540 3300037312 Bacteria 2692
186 Ga0395900_0056029 3300037418 Bacteria 4058
187 Ga0395898_0234714 3300037466 Bacteria 1749
188 Ga0395901_0053633 3300038443 Bacteria 4189
189 Ga0395901_0054956 3300038443 Bacteria 4139
190 Ga0395901_0143021 3300038443 Bacteria 2514
191 Ga0436365_1831361 3300039437 Bacteria 598
192 Ga0436360_1239443 3300039438 Bacteria 13889
193 Ga0466967_0979410 3300045976 Bacteria 842
194 Ga0495592_0001464 3300046454 Bacteria 16415
195 Ga0495629_0008419 3300046459 Bacteria 7590
196 Ga0495651_0012761 3300046462 Bacteria 6486
197 Ga0495653_0050559 3300046463 Bacteria 3196
198 Ga0495580_0019297 3300046472 Bacteria 5066
199 Ga0495580_0180407 3300046472 Bacteria 1458
200 Ga0495639_0195516 3300046475 Bacteria 988
201 Ga0495608_0002573 3300046511 Bacteria 13016
202 Ga0495628_0081144 3300046516 Bacteria 2519
203 Ga0495630_1191230 3300046517 Bacteria 576
204 Ga0495652_0007302 3300046529 Bacteria 10195
205 Ga0495652_0697517 3300046529 Bacteria 683
206 Ga0495587_0763989 3300046536 Bacteria 528
207 Ga0495645_0015582 3300046543 Bacteria 5408
208 Ga0495667_0017938 3300046559 Bacteria 4780
209 Ga0495634_0550110 3300046642 Bacteria 673
210 Ga0495635_0004761 3300046663 Bacteria 9434
211 Ga0495588_0092970 3300046674 Bacteria 1581
212 Ga0495657_0013808 3300046675 Bacteria 5945
213 Ga0495599_0064047 3300046678 Bacteria 2296
214 Ga0495599_0188504 3300046678 Bacteria 1270
215 Ga0495623_0069621 3300046679 Bacteria 2192
216 Ga0495658_0217548 3300046683 Bacteria 1195
217 Ga0495613_0311996 3300046689 Bacteria 1087
218 Ga0495600_0014610 3300046809 Bacteria 4949
219 Ga0495581_0025682 3300047315 Bacteria 3416
220 Ga0495604_0007158 3300047317 Bacteria 8835
221 Ga0495674_0096529 3300047319 Bacteria 2519
222 Ga0495674_0920454 3300047319 Bacteria 674
223 Ga0495674_0937836 3300047319 Bacteria 666
224 Ga0495672_0351384 3300047320 Bacteria 685
225 Ga0495676_0294634 3300047321 Bacteria 1096
226 Ga0495680_0008847 3300047322 Bacteria 9107
227 Ga0495675_0013658 3300047444 Bacteria 5130
228 Ga0495675_0386052 3300047444 Bacteria 818
229 Ga0495684_0023921 3300047471 Bacteria 4698
230 Ga0495686_0050839 3300047472 Bacteria 2603
231 Ga0495593_0010683 3300047673 Bacteria 5293
232 Ga0495602_0393717 3300048088 Bacteria 989
233 Ga0495602_0507997 3300048088 Bacteria 841
234 Ga0495614_0083805 3300048089 Bacteria 1383
235 Ga0496102_0281761 3300048905 Bacteria 1567
236 Ga0496104_0863107 3300048907 Bacteria 810
237 Ga0496105_0133661 3300048908 Bacteria 2044
238 Ga0496109_0537748 3300048912 Bacteria 1102
239 Ga0496110_0103982 3300048913 Bacteria 2548
240 Ga0496112_0176325 3300048915 Bacteria 2102
241 Ga0496113_0021891 3300048916 Bacteria 4514
242 Ga0496115_0108498 3300048918 Bacteria 2279
243 Ga0496121_0000379 3300048924 Bacteria 91131
244 Ga0501034_0634674 3300049571 Bacteria 971
245 Ga0501080_1645027 3300049742 Bacteria 543
246 nmdc:mga03683_131900_c1 3300050489 Bacteria 1118
247 nmdc:mga03683_209199_c1 3300050489 Bacteria 897
248 nmdc:mga03683_285944_c1 3300050489 Bacteria 771
249 nmdc:mga03683_299111_c1 3300050489 Bacteria 754
250 nmdc:mga03683_460376_c1 3300050489 Bacteria 613
251 nmdc:mga03n38_15531_c1 3300050490 Bacteria 2942
252 nmdc:mga03n38_643025_c1 3300050490 Bacteria 607
253 nmdc:mga00v17_297330_c1 3300050491 Bacteria 1048
254 nmdc:mga00v17_489947_c1 3300050491 Bacteria 797
255 nmdc:mga00v17_597117_c1 3300050491 Bacteria 712
256 nmdc:mga0yw44_114347_c1 3300050492 Bacteria 1732
257 nmdc:mga0yw44_577862_c1 3300050492 Bacteria 763
258 nmdc:mga0yw44_70969_c1 3300050492 Bacteria 2161
259 nmdc:mga0yw44_73819_c1 3300050492 Bacteria 2123
260 nmdc:mga0yw44_833571_c1 3300050492 Bacteria 626
261 nmdc:mga0yw44_90042_c1 3300050492 Bacteria 1937
262 nmdc:mga0k408_204505_c1 3300050493 Bacteria 1179
263 nmdc:mga0k408_66763_c1 3300050493 Bacteria 2095
264 nmdc:mga04h51_127103_c1 3300050495 Bacteria 955
265 nmdc:mga07m45_243145_c1 3300050496 Bacteria 1047
266 nmdc:mga07m45_393789_c1 3300050496 Bacteria 804
267 nmdc:mga07m45_62435_c1 3300050496 Bacteria 2111
268 nmdc:mga07m45_7569_c2 3300050496 Bacteria 4924
269 nmdc:mga08y16_1230890_c1 3300050511 Bacteria 718
270 nmdc:mga0sz30_131224_c1 3300050516 Bacteria 1104
271 nmdc:mga0sz30_77031_c1 3300050516 Bacteria 1440
272 Ga0495595_0049175 3300053084 Bacteria 1949
273 Ga0495619_0010930 3300053085 Bacteria 5712
274 Ga0495619_0295975 3300053085 Bacteria 1121
275 Ga0500595_007095 3300053119 Bacteria 4683
276 Ga0500642_0491081 3300053130 Bacteria 520
277 Ga0500655_013874 3300053133 Bacteria 1473
278 Ga0500568_0013503 3300053139 Bacteria 3722
279 Ga0500616_0002353 3300053153 Bacteria 15899
280 Ga0500616_0250569 3300053153 Bacteria 757
281 Ga0500620_051747 3300053155 Bacteria 1379
282 Ga0500609_032375 3300053731 Bacteria 719
283 Ga0500552_000623 3300053733 Bacteria 3342
284 Ga0207426_1024103
285 Ga0070658_10007364
286 Ga0070658_10100756
287 Ga0070683_100100599
288 Ga0070680_100019460
289 Ga0070680_100020445
290 Ga0070682_100106988
291 Ga0068868_101474935
292 Ga0070660_100036667
293 Ga0070675_100128839
294 Ga0070659_101012012
295 Ga0070709_10150300
296 Ga0070709_11131535
297 Ga0070713_100174901
298 Ga0070713_100235114
299 Ga0070713_100475089
300 Ga0070713_100920214
301 Ga0070708_100339610
302 Ga0070663_100770904
303 Ga0070663_100794736
304 Ga0070678_100360871
305 Ga0070662_100468485
306 Ga0070662_101080709
307 Ga0070681_10008181
308 Ga0070681_10295618
309 Ga0070706_100229062
310 Ga0070707_100222316
311 Ga0070698_100063614
312 Ga0070679_100053903
313 Ga0070679_101171523
314 Ga0070684_100029218
315 Ga0070697_100100817
316 Ga0068853_100096577
317 Ga0068853_101732742
318 Ga0070686_100989241
319 Ga0070693_100196357
320 Ga0070665_100003905
321 Ga0070665_100023966
322 Ga0070665_101554811
323 Ga0068855_100014728
324 Ga0068855_100035876
325 Ga0068855_100046320
326 Ga0068855_100948375
327 Ga0070664_101345214
328 Ga0070664_101421607
329 Ga0070664_101425123
330 Ga0068857_100086737
331 Ga0068856_100222240
332 Ga0068856_100908852
333 Ga0068852_100107461
334 Ga0068859_100216870
335 Ga0068851_10083693
336 Ga0068858_100276128
337 Ga0068860_100030504
338 Ga0068862_100716123
339 Ga0070717_10071747
340 Ga0075365_10011626
341 Ga0075365_10110540
342 Ga0075365_10455167
343 Ga0075365_10558535
344 Ga0075368_10127662
345 Ga0075363_100036327
346 Ga0075363_100213124
347 Ga0075364_10373491
348 Ga0070716_100085851
349 Ga0070716_100792748
350 Ga0070712_100839316
351 Ga0075362_10098968
352 Ga0075362_10172844
353 Ga0075367_10003954
354 Ga0075367_10118562
355 Ga0075367_10354920
356 Ga0075369_10071744
357 Ga0075369_10238436
358 Ga0075366_10179761
359 Ga0075370_10014390
360 Ga0075370_10086674
361 Ga0075370_10629458
362 Ga0097620_100216859
363 Ga0099794_10222622
364 Ga0099795_10021444
365 Ga0105240_10031486
366 Ga0105240_10054338
367 Ga0105240_10138060
368 Ga0111539_10532039
369 Ga0111539_11826436
370 Ga0105243_12301078
371 Ga0105237_10004661
372 Ga0105238_10073311
373 Ga0105238_10677147
374 Ga0105239_10032865
375 Ga0105239_10114515
376 Ga0105239_10384119
377 Ga0105239_11282406
378 Ga0105239_12522750
379 Ga0157370_10070737
380 Ga0157369_10031946
381 Ga0157369_10238999
382 Ga0157372_10559577
383 Ga0157375_11387468
384 Ga0157380_12846907
385 Ga0182008_10014967
386 Ga0163161_11189595
387 Ga0207426_1016609
388 Ga0207656_10002591
389 Ga0207685_10587434
390 Ga0207699_10140026
391 Ga0207699_10972541
392 Ga0207645_10823851
393 Ga0207705_10092721
394 Ga0207684_10169833
395 Ga0207707_10003366
396 Ga0207707_10007348
397 Ga0207695_10053587
398 Ga0207695_10075514
399 Ga0207695_10128734
400 Ga0207671_10018747
401 Ga0207660_10008039
402 Ga0207660_10019797
403 Ga0207657_10003018
404 Ga0207657_10329432
405 Ga0207649_10048797
406 Ga0207652_10079248
407 Ga0207652_10170252
408 Ga0207646_10070795
409 Ga0207681_11035346
410 Ga0207694_10060978
411 Ga0207659_10377086
412 Ga0207700_10144651
413 Ga0207700_10201677
414 Ga0207700_10384192
415 Ga0207664_10696732
416 Ga0207706_10359736
417 Ga0207670_10242992
418 Ga0207665_10068885
419 Ga0207665_11375014
420 Ga0207691_10347092
421 Ga0207661_10035395
422 Ga0207661_10599228
423 Ga0207679_10702417
424 Ga0207667_10013028
425 Ga0207667_10088416
426 Ga0207667_10104209
427 Ga0207651_10271213
428 Ga0207658_10525160
429 Ga0207703_10125222
430 Ga0207639_10074343
431 Ga0207702_10201280
432 Ga0207683_10358408
433 Ga0207698_10075123
434 Ga0209813_10027372
435 Ga0268266_10038474
436 Ga0268264_10074622
437 Ga0265330_10017349
438 Ga0265330_10029344
439 Ga0265332_10014429
440 Ga0265332_10186482
441 Ga0265328_10088065
442 Ga0265325_10002917
443 Ga0265340_10133886
444 Ga0265339_10119918
445 Ga0265331_10010634
446 Ga0265316_10725586
447 Ga0265314_10136121
448 Ga0265342_10081784
449 Ga0307416_102197975
450 Ga0307415_100385382
451 Ga0373936_0060570
452 Ga0373953_0009279
453 Ga0373957_0007882
454 Ga0373955_0071391
455 Ga0373931_0273479
456 Ga0373935_0713019
457 Ga0373927_0011751
458 Ga0373927_0014784
459 Ga0373933_0007968
460 Ga0373947_0090085
461 Ga0373947_0696804
462 Ga0373937_0006187
463 Ga0373937_0913368
464 Ga0373937_1193018
465 Ga0373937_1423601
466 Ga0373937_1501310
467 Ga0373925_0283633
468 Ga0395899_0064540
469 Ga0395900_0056029
470 Ga0395898_0234714
471 Ga0395901_0053633
472 Ga0395901_0054956
473 Ga0395901_0143021
474 Ga0436365_1831361
475 Ga0436360_1239443
476 Ga0466967_0979410
477 Ga0495592_0001464
478 Ga0495629_0008419
479 Ga0495651_0012761
480 Ga0495653_0050559
481 Ga0495580_0019297
482 Ga0495580_0180407
483 Ga0495639_0195516
484 Ga0495608_0002573
485 Ga0495628_0081144
486 Ga0495630_1191230
487 Ga0495652_0007302
488 Ga0495652_0697517
489 Ga0495587_0763989
490 Ga0495645_0015582
491 Ga0495667_0017938
492 Ga0495634_0550110
493 Ga0495635_0004761
494 Ga0495588_0092970
495 Ga0495657_0013808
496 Ga0495599_0064047
497 Ga0495599_0188504
498 Ga0495623_0069621
499 Ga0495658_0217548
500 Ga0495613_0311996
501 Ga0495600_0014610
502 Ga0495581_0025682
503 Ga0495604_0007158
504 Ga0495674_0096529
505 Ga0495674_0920454
506 Ga0495674_0937836
507 Ga0495672_0351384
508 Ga0495676_0294634
509 Ga0495680_0008847
510 Ga0495675_0013658
511 Ga0495675_0386052
512 Ga0495684_0023921
513 Ga0495686_0050839
514 Ga0495593_0010683
515 Ga0495602_0393717
516 Ga0495602_0507997
517 Ga0495614_0083805
518 Ga0496102_0281761
519 Ga0496104_0863107
520 Ga0496105_0133661
521 Ga0496109_0537748
522 Ga0496110_0103982
523 Ga0496112_0176325
524 Ga0496113_0021891
525 Ga0496115_0108498
526 Ga0496121_0000379
527 Ga0501034_0634674
528 Ga0501080_1645027
529 nmdc:mga03683_131900_c1
530 nmdc:mga03683_209199_c1
531 nmdc:mga03683_285944_c1
532 nmdc:mga03683_299111_c1
533 nmdc:mga03683_460376_c1
534 nmdc:mga03n38_15531_c1
535 nmdc:mga03n38_643025_c1
536 nmdc:mga00v17_297330_c1
537 nmdc:mga00v17_489947_c1
538 nmdc:mga00v17_597117_c1
539 nmdc:mga0yw44_114347_c1
540 nmdc:mga0yw44_577862_c1
541 nmdc:mga0yw44_70969_c1
542 nmdc:mga0yw44_73819_c1
543 nmdc:mga0yw44_833571_c1
544 nmdc:mga0yw44_90042_c1
545 nmdc:mga0k408_204505_c1
546 nmdc:mga0k408_66763_c1
547 nmdc:mga04h51_127103_c1
548 nmdc:mga07m45_243145_c1
549 nmdc:mga07m45_393789_c1
550 nmdc:mga07m45_62435_c1
551 nmdc:mga07m45_7569_c2
552 nmdc:mga08y16_1230890_c1
553 nmdc:mga0sz30_131224_c1
554 nmdc:mga0sz30_77031_c1
555 Ga0495595_0049175
556 Ga0495619_0010930
557 Ga0495619_0295975
558 Ga0500595_007095
559 Ga0500642_0491081
560 Ga0500655_013874
561 Ga0500568_0013503
562 Ga0500616_0002353
563 Ga0500616_0250569
564 Ga0500620_051747
565 Ga0500609_032375
566 Ga0500552_000623

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gv8-assembly1.cif.gz_A characterization of extracellular matrix binding protein- (embp)-mediated staphylococcus epidermidis adherence to fibronectin 0.3637 2 96
4dk1-assembly1.cif.gz_B crystal structure of maca-mexa chimeric protein, containing the pseudomonas aeruginosa mexa alpha-hairpin domain. 0.3377 32 99
7f6j-assembly1.cif.gz_C crystal structure of the pdzd8 coiled-coil domain - rab7 complex 0.3109 1 109
5uh7-assembly1.cif.gz_A crystal structure of beta'mtbsi of mycobacterium tuberculosis rna polymerase 0.3107 33 97
3ctw-assembly1.cif.gz_D crystal structure of rcda from caulobacter crescentus cb15 0.3021 42 114
ID Description Score Start End Superfamily
af_A0A1D6I4R8_1_217_1.10.630.10 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.4631 34 122 1.10.630.10
4okvE00 Special;Helix non-globular;Helix Hairpins; 0.4163 37 98 6.10.140.1890
4okvE00 Special;Helix non-globular;Helix Hairpins; 0.3854 37 98 6.10.140.1890
af_Q8NF91_5411_5697_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.3769 34 97 1.20.58.60
af_G5EF26_121_215_1.20.81.10 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;RAP domain 0.3503 1 99 1.20.81.10
ID Description Score Start End GO Terms
AF-A0A258CPN5-F1-model_v4 Uncharacterized protein 0.8895 2 126
AF-A0A258CPN5-F1-model_v4 Uncharacterized protein 0.8269 2 126
AF-A0A512N3Z7-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.7863 2 144
AF-A0A2U3Q640-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.7761 1 144
AF-A0A512N3Z7-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.7756 2 144

Map